data_8VEA # _entry.id 8VEA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8VEA pdb_00008vea 10.2210/pdb8vea/pdb WWPDB D_1000280000 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-01-15 ? 2 'Structure model' 1 1 2025-03-26 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8VEA _pdbx_database_status.recvd_initial_deposition_date 2023-12-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email dabaker@uw.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Baker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7896-6217 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bera, A.K.' 1 ? 'Gerben, S.' 2 ? 'Baker, D.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biorxiv _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2692-8205 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Massively parallel assessment of designed protein solution properties using mass spectrometry and peptide barcoding.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1101/2025.02.24.639402 _citation.pdbx_database_id_PubMed 40060547 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Feldman, D.' 1 ? primary 'Sims, J.N.' 2 0000-0002-0479-0367 primary 'Li, X.' 3 ? primary 'Johnson, R.' 4 ? primary 'Gerben, S.' 5 ? primary 'Kim, D.E.' 6 0000-0002-0023-956X primary 'Richardson, C.' 7 ? primary 'Koepnick, B.' 8 ? primary 'Eisenach, H.' 9 ? primary 'Hicks, D.R.' 10 ? primary 'Yang, E.C.' 11 0000-0002-1305-9066 primary 'Wicky, B.I.M.' 12 ? primary 'Milles, L.F.' 13 0000-0001-8417-3205 primary 'Bera, A.K.' 14 ? primary 'Kang, A.' 15 ? primary 'Brackenbrough, E.' 16 ? primary 'Joyce, E.' 17 ? primary 'Sankaran, B.' 18 ? primary 'Lubner, J.M.' 19 ? primary 'Goreshnik, I.' 20 ? primary 'Vafeados, D.' 21 ? primary 'Allen, A.' 22 ? primary 'Stewart, L.' 23 ? primary 'MacCoss, M.J.' 24 0000-0003-1853-0256 primary 'Baker, D.' 25 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Designed helical oligomer sg266' _entity.formula_weight 16512.213 _entity.pdbx_number_of_molecules 3 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GFEEALELTIRAKEEGDPRLLERALEILERRLKEAQERGDLHLVLTIALLLAAIAHRLGDPRYLEVAVRVLEEAIREALE RGDVQLVYNLVEVLLHVARLLGDPRVFRFMLHILLEAYRIARENGDEQILIEIVHLFTEVIRG ; _entity_poly.pdbx_seq_one_letter_code_can ;GFEEALELTIRAKEEGDPRLLERALEILERRLKEAQERGDLHLVLTIALLLAAIAHRLGDPRYLEVAVRVLEEAIREALE RGDVQLVYNLVEVLLHVARLLGDPRVFRFMLHILLEAYRIARENGDEQILIEIVHLFTEVIRG ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PHE n 1 3 GLU n 1 4 GLU n 1 5 ALA n 1 6 LEU n 1 7 GLU n 1 8 LEU n 1 9 THR n 1 10 ILE n 1 11 ARG n 1 12 ALA n 1 13 LYS n 1 14 GLU n 1 15 GLU n 1 16 GLY n 1 17 ASP n 1 18 PRO n 1 19 ARG n 1 20 LEU n 1 21 LEU n 1 22 GLU n 1 23 ARG n 1 24 ALA n 1 25 LEU n 1 26 GLU n 1 27 ILE n 1 28 LEU n 1 29 GLU n 1 30 ARG n 1 31 ARG n 1 32 LEU n 1 33 LYS n 1 34 GLU n 1 35 ALA n 1 36 GLN n 1 37 GLU n 1 38 ARG n 1 39 GLY n 1 40 ASP n 1 41 LEU n 1 42 HIS n 1 43 LEU n 1 44 VAL n 1 45 LEU n 1 46 THR n 1 47 ILE n 1 48 ALA n 1 49 LEU n 1 50 LEU n 1 51 LEU n 1 52 ALA n 1 53 ALA n 1 54 ILE n 1 55 ALA n 1 56 HIS n 1 57 ARG n 1 58 LEU n 1 59 GLY n 1 60 ASP n 1 61 PRO n 1 62 ARG n 1 63 TYR n 1 64 LEU n 1 65 GLU n 1 66 VAL n 1 67 ALA n 1 68 VAL n 1 69 ARG n 1 70 VAL n 1 71 LEU n 1 72 GLU n 1 73 GLU n 1 74 ALA n 1 75 ILE n 1 76 ARG n 1 77 GLU n 1 78 ALA n 1 79 LEU n 1 80 GLU n 1 81 ARG n 1 82 GLY n 1 83 ASP n 1 84 VAL n 1 85 GLN n 1 86 LEU n 1 87 VAL n 1 88 TYR n 1 89 ASN n 1 90 LEU n 1 91 VAL n 1 92 GLU n 1 93 VAL n 1 94 LEU n 1 95 LEU n 1 96 HIS n 1 97 VAL n 1 98 ALA n 1 99 ARG n 1 100 LEU n 1 101 LEU n 1 102 GLY n 1 103 ASP n 1 104 PRO n 1 105 ARG n 1 106 VAL n 1 107 PHE n 1 108 ARG n 1 109 PHE n 1 110 MET n 1 111 LEU n 1 112 HIS n 1 113 ILE n 1 114 LEU n 1 115 LEU n 1 116 GLU n 1 117 ALA n 1 118 TYR n 1 119 ARG n 1 120 ILE n 1 121 ALA n 1 122 ARG n 1 123 GLU n 1 124 ASN n 1 125 GLY n 1 126 ASP n 1 127 GLU n 1 128 GLN n 1 129 ILE n 1 130 LEU n 1 131 ILE n 1 132 GLU n 1 133 ILE n 1 134 VAL n 1 135 HIS n 1 136 LEU n 1 137 PHE n 1 138 THR n 1 139 GLU n 1 140 VAL n 1 141 ILE n 1 142 ARG n 1 143 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 143 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 MET 110 110 110 MET MET A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 GLY 143 143 143 GLY GLY A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 PHE 2 2 2 PHE PHE B . n B 1 3 GLU 3 3 3 GLU GLU B . n B 1 4 GLU 4 4 4 GLU GLU B . n B 1 5 ALA 5 5 5 ALA ALA B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 GLU 7 7 7 GLU GLU B . n B 1 8 LEU 8 8 8 LEU LEU B . n B 1 9 THR 9 9 9 THR THR B . n B 1 10 ILE 10 10 10 ILE ILE B . n B 1 11 ARG 11 11 11 ARG ARG B . n B 1 12 ALA 12 12 12 ALA ALA B . n B 1 13 LYS 13 13 13 LYS LYS B . n B 1 14 GLU 14 14 14 GLU GLU B . n B 1 15 GLU 15 15 15 GLU GLU B . n B 1 16 GLY 16 16 16 GLY GLY B . n B 1 17 ASP 17 17 17 ASP ASP B . n B 1 18 PRO 18 18 18 PRO PRO B . n B 1 19 ARG 19 19 19 ARG ARG B . n B 1 20 LEU 20 20 20 LEU LEU B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 GLU 22 22 22 GLU GLU B . n B 1 23 ARG 23 23 23 ARG ARG B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 GLU 26 26 26 GLU GLU B . n B 1 27 ILE 27 27 27 ILE ILE B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 GLU 29 29 29 GLU GLU B . n B 1 30 ARG 30 30 30 ARG ARG B . n B 1 31 ARG 31 31 31 ARG ARG B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 LYS 33 33 33 LYS LYS B . n B 1 34 GLU 34 34 34 GLU GLU B . n B 1 35 ALA 35 35 35 ALA ALA B . n B 1 36 GLN 36 36 36 GLN GLN B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 ARG 38 38 38 ARG ARG B . n B 1 39 GLY 39 39 39 GLY GLY B . n B 1 40 ASP 40 40 40 ASP ASP B . n B 1 41 LEU 41 41 41 LEU LEU B . n B 1 42 HIS 42 42 42 HIS HIS B . n B 1 43 LEU 43 43 43 LEU LEU B . n B 1 44 VAL 44 44 44 VAL VAL B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 THR 46 46 46 THR THR B . n B 1 47 ILE 47 47 47 ILE ILE B . n B 1 48 ALA 48 48 48 ALA ALA B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 LEU 51 51 51 LEU LEU B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 ALA 53 53 53 ALA ALA B . n B 1 54 ILE 54 54 54 ILE ILE B . n B 1 55 ALA 55 55 55 ALA ALA B . n B 1 56 HIS 56 56 56 HIS HIS B . n B 1 57 ARG 57 57 57 ARG ARG B . n B 1 58 LEU 58 58 58 LEU LEU B . n B 1 59 GLY 59 59 59 GLY GLY B . n B 1 60 ASP 60 60 60 ASP ASP B . n B 1 61 PRO 61 61 61 PRO PRO B . n B 1 62 ARG 62 62 62 ARG ARG B . n B 1 63 TYR 63 63 63 TYR TYR B . n B 1 64 LEU 64 64 64 LEU LEU B . n B 1 65 GLU 65 65 65 GLU GLU B . n B 1 66 VAL 66 66 66 VAL VAL B . n B 1 67 ALA 67 67 67 ALA ALA B . n B 1 68 VAL 68 68 68 VAL VAL B . n B 1 69 ARG 69 69 69 ARG ARG B . n B 1 70 VAL 70 70 70 VAL VAL B . n B 1 71 LEU 71 71 71 LEU LEU B . n B 1 72 GLU 72 72 72 GLU GLU B . n B 1 73 GLU 73 73 73 GLU GLU B . n B 1 74 ALA 74 74 74 ALA ALA B . n B 1 75 ILE 75 75 75 ILE ILE B . n B 1 76 ARG 76 76 76 ARG ARG B . n B 1 77 GLU 77 77 77 GLU GLU B . n B 1 78 ALA 78 78 78 ALA ALA B . n B 1 79 LEU 79 79 79 LEU LEU B . n B 1 80 GLU 80 80 80 GLU GLU B . n B 1 81 ARG 81 81 81 ARG ARG B . n B 1 82 GLY 82 82 82 GLY GLY B . n B 1 83 ASP 83 83 83 ASP ASP B . n B 1 84 VAL 84 84 84 VAL VAL B . n B 1 85 GLN 85 85 85 GLN GLN B . n B 1 86 LEU 86 86 86 LEU LEU B . n B 1 87 VAL 87 87 87 VAL VAL B . n B 1 88 TYR 88 88 88 TYR TYR B . n B 1 89 ASN 89 89 89 ASN ASN B . n B 1 90 LEU 90 90 90 LEU LEU B . n B 1 91 VAL 91 91 91 VAL VAL B . n B 1 92 GLU 92 92 92 GLU GLU B . n B 1 93 VAL 93 93 93 VAL VAL B . n B 1 94 LEU 94 94 94 LEU LEU B . n B 1 95 LEU 95 95 95 LEU LEU B . n B 1 96 HIS 96 96 96 HIS HIS B . n B 1 97 VAL 97 97 97 VAL VAL B . n B 1 98 ALA 98 98 98 ALA ALA B . n B 1 99 ARG 99 99 99 ARG ARG B . n B 1 100 LEU 100 100 100 LEU LEU B . n B 1 101 LEU 101 101 101 LEU LEU B . n B 1 102 GLY 102 102 102 GLY GLY B . n B 1 103 ASP 103 103 103 ASP ASP B . n B 1 104 PRO 104 104 104 PRO PRO B . n B 1 105 ARG 105 105 105 ARG ARG B . n B 1 106 VAL 106 106 106 VAL VAL B . n B 1 107 PHE 107 107 107 PHE PHE B . n B 1 108 ARG 108 108 108 ARG ARG B . n B 1 109 PHE 109 109 109 PHE PHE B . n B 1 110 MET 110 110 110 MET MET B . n B 1 111 LEU 111 111 111 LEU LEU B . n B 1 112 HIS 112 112 112 HIS HIS B . n B 1 113 ILE 113 113 113 ILE ILE B . n B 1 114 LEU 114 114 114 LEU LEU B . n B 1 115 LEU 115 115 115 LEU LEU B . n B 1 116 GLU 116 116 116 GLU GLU B . n B 1 117 ALA 117 117 117 ALA ALA B . n B 1 118 TYR 118 118 118 TYR TYR B . n B 1 119 ARG 119 119 119 ARG ARG B . n B 1 120 ILE 120 120 120 ILE ILE B . n B 1 121 ALA 121 121 121 ALA ALA B . n B 1 122 ARG 122 122 122 ARG ARG B . n B 1 123 GLU 123 123 123 GLU GLU B . n B 1 124 ASN 124 124 124 ASN ASN B . n B 1 125 GLY 125 125 125 GLY GLY B . n B 1 126 ASP 126 126 126 ASP ASP B . n B 1 127 GLU 127 127 127 GLU GLU B . n B 1 128 GLN 128 128 128 GLN GLN B . n B 1 129 ILE 129 129 129 ILE ILE B . n B 1 130 LEU 130 130 130 LEU LEU B . n B 1 131 ILE 131 131 131 ILE ILE B . n B 1 132 GLU 132 132 132 GLU GLU B . n B 1 133 ILE 133 133 133 ILE ILE B . n B 1 134 VAL 134 134 134 VAL VAL B . n B 1 135 HIS 135 135 135 HIS HIS B . n B 1 136 LEU 136 136 136 LEU LEU B . n B 1 137 PHE 137 137 137 PHE PHE B . n B 1 138 THR 138 138 138 THR THR B . n B 1 139 GLU 139 139 139 GLU GLU B . n B 1 140 VAL 140 140 140 VAL VAL B . n B 1 141 ILE 141 141 141 ILE ILE B . n B 1 142 ARG 142 142 142 ARG ARG B . n B 1 143 GLY 143 143 143 GLY GLY B . n C 1 1 GLY 1 1 1 GLY GLY C . n C 1 2 PHE 2 2 2 PHE PHE C . n C 1 3 GLU 3 3 3 GLU GLU C . n C 1 4 GLU 4 4 4 GLU GLU C . n C 1 5 ALA 5 5 5 ALA ALA C . n C 1 6 LEU 6 6 6 LEU LEU C . n C 1 7 GLU 7 7 7 GLU GLU C . n C 1 8 LEU 8 8 8 LEU LEU C . n C 1 9 THR 9 9 9 THR THR C . n C 1 10 ILE 10 10 10 ILE ILE C . n C 1 11 ARG 11 11 11 ARG ARG C . n C 1 12 ALA 12 12 12 ALA ALA C . n C 1 13 LYS 13 13 13 LYS LYS C . n C 1 14 GLU 14 14 14 GLU GLU C . n C 1 15 GLU 15 15 15 GLU GLU C . n C 1 16 GLY 16 16 16 GLY GLY C . n C 1 17 ASP 17 17 17 ASP ASP C . n C 1 18 PRO 18 18 18 PRO PRO C . n C 1 19 ARG 19 19 19 ARG ARG C . n C 1 20 LEU 20 20 20 LEU LEU C . n C 1 21 LEU 21 21 21 LEU LEU C . n C 1 22 GLU 22 22 22 GLU GLU C . n C 1 23 ARG 23 23 23 ARG ARG C . n C 1 24 ALA 24 24 24 ALA ALA C . n C 1 25 LEU 25 25 25 LEU LEU C . n C 1 26 GLU 26 26 26 GLU GLU C . n C 1 27 ILE 27 27 27 ILE ILE C . n C 1 28 LEU 28 28 28 LEU LEU C . n C 1 29 GLU 29 29 29 GLU GLU C . n C 1 30 ARG 30 30 30 ARG ARG C . n C 1 31 ARG 31 31 31 ARG ARG C . n C 1 32 LEU 32 32 32 LEU LEU C . n C 1 33 LYS 33 33 33 LYS LYS C . n C 1 34 GLU 34 34 34 GLU GLU C . n C 1 35 ALA 35 35 35 ALA ALA C . n C 1 36 GLN 36 36 36 GLN GLN C . n C 1 37 GLU 37 37 37 GLU GLU C . n C 1 38 ARG 38 38 38 ARG ARG C . n C 1 39 GLY 39 39 39 GLY GLY C . n C 1 40 ASP 40 40 40 ASP ASP C . n C 1 41 LEU 41 41 41 LEU LEU C . n C 1 42 HIS 42 42 42 HIS HIS C . n C 1 43 LEU 43 43 43 LEU LEU C . n C 1 44 VAL 44 44 44 VAL VAL C . n C 1 45 LEU 45 45 45 LEU LEU C . n C 1 46 THR 46 46 46 THR THR C . n C 1 47 ILE 47 47 47 ILE ILE C . n C 1 48 ALA 48 48 48 ALA ALA C . n C 1 49 LEU 49 49 49 LEU LEU C . n C 1 50 LEU 50 50 50 LEU LEU C . n C 1 51 LEU 51 51 51 LEU LEU C . n C 1 52 ALA 52 52 52 ALA ALA C . n C 1 53 ALA 53 53 53 ALA ALA C . n C 1 54 ILE 54 54 54 ILE ILE C . n C 1 55 ALA 55 55 55 ALA ALA C . n C 1 56 HIS 56 56 56 HIS HIS C . n C 1 57 ARG 57 57 57 ARG ARG C . n C 1 58 LEU 58 58 58 LEU LEU C . n C 1 59 GLY 59 59 59 GLY GLY C . n C 1 60 ASP 60 60 60 ASP ASP C . n C 1 61 PRO 61 61 61 PRO PRO C . n C 1 62 ARG 62 62 62 ARG ARG C . n C 1 63 TYR 63 63 63 TYR TYR C . n C 1 64 LEU 64 64 64 LEU LEU C . n C 1 65 GLU 65 65 65 GLU GLU C . n C 1 66 VAL 66 66 66 VAL VAL C . n C 1 67 ALA 67 67 67 ALA ALA C . n C 1 68 VAL 68 68 68 VAL VAL C . n C 1 69 ARG 69 69 69 ARG ARG C . n C 1 70 VAL 70 70 70 VAL VAL C . n C 1 71 LEU 71 71 71 LEU LEU C . n C 1 72 GLU 72 72 72 GLU GLU C . n C 1 73 GLU 73 73 73 GLU GLU C . n C 1 74 ALA 74 74 74 ALA ALA C . n C 1 75 ILE 75 75 75 ILE ILE C . n C 1 76 ARG 76 76 76 ARG ARG C . n C 1 77 GLU 77 77 77 GLU GLU C . n C 1 78 ALA 78 78 78 ALA ALA C . n C 1 79 LEU 79 79 79 LEU LEU C . n C 1 80 GLU 80 80 80 GLU GLU C . n C 1 81 ARG 81 81 81 ARG ARG C . n C 1 82 GLY 82 82 82 GLY GLY C . n C 1 83 ASP 83 83 83 ASP ASP C . n C 1 84 VAL 84 84 84 VAL VAL C . n C 1 85 GLN 85 85 85 GLN GLN C . n C 1 86 LEU 86 86 86 LEU LEU C . n C 1 87 VAL 87 87 87 VAL VAL C . n C 1 88 TYR 88 88 88 TYR TYR C . n C 1 89 ASN 89 89 89 ASN ASN C . n C 1 90 LEU 90 90 90 LEU LEU C . n C 1 91 VAL 91 91 91 VAL VAL C . n C 1 92 GLU 92 92 92 GLU GLU C . n C 1 93 VAL 93 93 93 VAL VAL C . n C 1 94 LEU 94 94 94 LEU LEU C . n C 1 95 LEU 95 95 95 LEU LEU C . n C 1 96 HIS 96 96 96 HIS HIS C . n C 1 97 VAL 97 97 97 VAL VAL C . n C 1 98 ALA 98 98 98 ALA ALA C . n C 1 99 ARG 99 99 99 ARG ARG C . n C 1 100 LEU 100 100 100 LEU LEU C . n C 1 101 LEU 101 101 101 LEU LEU C . n C 1 102 GLY 102 102 102 GLY GLY C . n C 1 103 ASP 103 103 103 ASP ASP C . n C 1 104 PRO 104 104 104 PRO PRO C . n C 1 105 ARG 105 105 105 ARG ARG C . n C 1 106 VAL 106 106 106 VAL VAL C . n C 1 107 PHE 107 107 107 PHE PHE C . n C 1 108 ARG 108 108 108 ARG ARG C . n C 1 109 PHE 109 109 109 PHE PHE C . n C 1 110 MET 110 110 110 MET MET C . n C 1 111 LEU 111 111 111 LEU LEU C . n C 1 112 HIS 112 112 112 HIS HIS C . n C 1 113 ILE 113 113 113 ILE ILE C . n C 1 114 LEU 114 114 114 LEU LEU C . n C 1 115 LEU 115 115 115 LEU LEU C . n C 1 116 GLU 116 116 116 GLU GLU C . n C 1 117 ALA 117 117 117 ALA ALA C . n C 1 118 TYR 118 118 118 TYR TYR C . n C 1 119 ARG 119 119 119 ARG ARG C . n C 1 120 ILE 120 120 120 ILE ILE C . n C 1 121 ALA 121 121 121 ALA ALA C . n C 1 122 ARG 122 122 122 ARG ARG C . n C 1 123 GLU 123 123 123 GLU GLU C . n C 1 124 ASN 124 124 124 ASN ASN C . n C 1 125 GLY 125 125 125 GLY GLY C . n C 1 126 ASP 126 126 126 ASP ASP C . n C 1 127 GLU 127 127 127 GLU GLU C . n C 1 128 GLN 128 128 128 GLN GLN C . n C 1 129 ILE 129 129 129 ILE ILE C . n C 1 130 LEU 130 130 130 LEU LEU C . n C 1 131 ILE 131 131 131 ILE ILE C . n C 1 132 GLU 132 132 132 GLU GLU C . n C 1 133 ILE 133 133 133 ILE ILE C . n C 1 134 VAL 134 134 134 VAL VAL C . n C 1 135 HIS 135 135 135 HIS HIS C . n C 1 136 LEU 136 136 136 LEU LEU C . n C 1 137 PHE 137 137 137 PHE PHE C . n C 1 138 THR 138 138 138 THR THR C . n C 1 139 GLU 139 139 139 GLU GLU C . n C 1 140 VAL 140 140 140 VAL VAL C . n C 1 141 ILE 141 141 141 ILE ILE C . n C 1 142 ARG 142 142 142 ARG ARG C . n C 1 143 GLY 143 143 143 GLY GLY C . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_4761 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8VEA _cell.details ? _cell.formula_units_Z ? _cell.length_a 115.335 _cell.length_a_esd ? _cell.length_b 115.335 _cell.length_b_esd ? _cell.length_c 59.994 _cell.length_c_esd ? _cell.volume 691131.505 _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8VEA _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall 'P 6c' _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8VEA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.10 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Ammonium sulfate, 0.1 M HEPES pH 7.5, 25% w/v Polyethylene glycol 3,350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-03-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00031 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00031 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 98.7 _reflns.entry_id 8VEA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.30 _reflns.d_resolution_low 41.58 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6978 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.69 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.45 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.018 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.00 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.30 _reflns_shell.d_res_low 3.55 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 10.97 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1381 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 14.7 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.078 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.987 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.78 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.292 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 98.70 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8VEA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.30 _refine.ls_d_res_low 41.58 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6977 _refine.ls_number_reflns_R_free 704 _refine.ls_number_reflns_R_work 6274 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.69 _refine.ls_percent_reflns_R_free 10.09 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1902 _refine.ls_R_factor_R_free 0.2421 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1843 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.7294 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4504 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.30 _refine_hist.d_res_low 41.58 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3492 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3492 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0038 ? 3534 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.6316 ? 4773 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0368 ? 567 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0049 ? 621 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 5.6856 ? 489 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.30 3.55 . . 137 1381 99.78 . . . . 0.2742 . . . . . . . . . . . 0.3231 'X-RAY DIFFRACTION' 3.56 3.91 . . 135 1235 99.35 . . . . 0.2268 . . . . . . . . . . . 0.2737 'X-RAY DIFFRACTION' 3.91 4.48 . . 138 1250 99.36 . . . . 0.2024 . . . . . . . . . . . 0.2653 'X-RAY DIFFRACTION' 4.48 5.64 . . 147 1254 100.00 . . . . 0.1862 . . . . . . . . . . . 0.2678 'X-RAY DIFFRACTION' 5.64 41.58 . . 147 1291 100.00 . . . . 0.1414 . . . . . . . . . . . 0.1863 # _struct.entry_id 8VEA _struct.title 'De novo designed helical oligomer sg266' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8VEA _struct_keywords.text 'de novo designed protein, mass spectrometry, peptide barcoding, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8VEA _struct_ref.pdbx_db_accession 8VEA _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8VEA A 1 ? 143 ? 8VEA 1 ? 143 ? 1 143 2 1 8VEA B 1 ? 143 ? 8VEA 1 ? 143 ? 1 143 3 1 8VEA C 1 ? 143 ? 8VEA 1 ? 143 ? 1 143 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5050 ? 1 MORE -37 ? 1 'SSA (A^2)' 18790 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 2 ? GLY A 16 ? PHE A 2 GLY A 16 1 ? 15 HELX_P HELX_P2 AA2 ASP A 17 ? GLU A 37 ? ASP A 17 GLU A 37 1 ? 21 HELX_P HELX_P3 AA3 ASP A 40 ? GLY A 59 ? ASP A 40 GLY A 59 1 ? 20 HELX_P HELX_P4 AA4 ASP A 60 ? ARG A 81 ? ASP A 60 ARG A 81 1 ? 22 HELX_P HELX_P5 AA5 VAL A 84 ? GLY A 102 ? VAL A 84 GLY A 102 1 ? 19 HELX_P HELX_P6 AA6 ASP A 103 ? GLY A 125 ? ASP A 103 GLY A 125 1 ? 23 HELX_P HELX_P7 AA7 ASP A 126 ? ILE A 141 ? ASP A 126 ILE A 141 1 ? 16 HELX_P HELX_P8 AA8 PHE B 2 ? GLU B 15 ? PHE B 2 GLU B 15 1 ? 14 HELX_P HELX_P9 AA9 PRO B 18 ? GLY B 39 ? PRO B 18 GLY B 39 1 ? 22 HELX_P HELX_P10 AB1 ASP B 40 ? ARG B 57 ? ASP B 40 ARG B 57 1 ? 18 HELX_P HELX_P11 AB2 ASP B 60 ? ARG B 81 ? ASP B 60 ARG B 81 1 ? 22 HELX_P HELX_P12 AB3 ASP B 83 ? GLY B 102 ? ASP B 83 GLY B 102 1 ? 20 HELX_P HELX_P13 AB4 ASP B 103 ? ASN B 124 ? ASP B 103 ASN B 124 1 ? 22 HELX_P HELX_P14 AB5 GLU B 127 ? GLY B 143 ? GLU B 127 GLY B 143 1 ? 17 HELX_P HELX_P15 AB6 PHE C 2 ? GLU C 15 ? PHE C 2 GLU C 15 1 ? 14 HELX_P HELX_P16 AB7 ASP C 17 ? GLN C 36 ? ASP C 17 GLN C 36 1 ? 20 HELX_P HELX_P17 AB8 ASP C 40 ? GLY C 59 ? ASP C 40 GLY C 59 1 ? 20 HELX_P HELX_P18 AB9 ASP C 60 ? GLY C 82 ? ASP C 60 GLY C 82 1 ? 23 HELX_P HELX_P19 AC1 ASP C 83 ? GLY C 102 ? ASP C 83 GLY C 102 1 ? 20 HELX_P HELX_P20 AC2 ASP C 103 ? GLY C 125 ? ASP C 103 GLY C 125 1 ? 23 HELX_P HELX_P21 AC3 GLU C 127 ? GLY C 143 ? GLU C 127 GLY C 143 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 8VEA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 38 ? ? 70.71 -24.92 2 1 VAL A 84 ? ? 66.58 -52.03 3 1 GLU B 14 ? ? -59.17 -80.80 4 1 LEU B 58 ? ? 71.87 -36.07 5 1 ASN B 124 ? ? -81.24 -151.86 6 1 ARG B 142 ? ? -66.89 -74.04 7 1 GLU C 37 ? ? 62.46 -47.46 8 1 GLU C 127 ? ? 65.64 -73.75 9 1 ARG C 142 ? ? -69.69 -70.10 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 3.78935858855 -49.5599364056 -14.5405886379 0.732193552447 ? -0.0655063156295 ? -0.0295624875494 ? 0.792867105436 ? 0.0740708951636 ? 0.699580858124 ? 3.61767812622 ? -2.16848048473 ? 1.72238103819 ? 4.3277209289 ? -0.441831504636 ? 2.79277309595 ? 0.112547193154 ? 0.702897261873 ? -0.0975557950926 ? -0.466501309413 ? -0.00272971796407 ? -0.066430813816 ? -0.186986459512 ? 0.147032848307 ? 0.000155988397734 ? 2 'X-RAY DIFFRACTION' ? refined 9.55522140987 -46.3335813896 12.5838041281 0.856464099611 ? -0.20465423159 ? -0.131475907878 ? 0.925150341114 ? 0.052852266434 ? 0.824974203752 ? 4.12081786469 ? -1.61226409984 ? -1.254942772 ? 3.63746372633 ? 3.60164551634 ? 5.54407266667 ? 0.231702293188 ? -0.457886997567 ? 0.275177118676 ? 0.697593040572 ? -0.274290540414 ? -0.0259813160484 ? 0.512463569088 ? -0.515323582663 ? 9.8206853637e-05 ? 3 'X-RAY DIFFRACTION' ? refined -10.6211698174 -30.9946609806 1.65170235008 0.916258747269 ? 0.00918571278913 ? -0.0756613819203 ? 1.33155572083 ? -0.221053524166 ? 1.3190523275 ? 1.11315268745 ? 0.0449466019558 ? 0.971403288969 ? 2.03842625761 ? 0.612412955838 ? 4.17545358246 ? 0.0625204498431 ? -0.832566780874 ? 0.831087954454 ? 0.0339628659317 ? 0.0931272939314 ? 0.0155937835487 ? -0.981720832677 ? 0.0363719272826 ? 0.00063714214614 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 1 ? A 143 A 143 ? ? '(chain A and resseq 1:143)' 2 'X-RAY DIFFRACTION' 2 B 1 B 1 ? B 143 B 143 ? ? '(chain B and resseq 1:143)' 3 'X-RAY DIFFRACTION' 3 C 1 C 1 ? C 143 C 143 ? ? '(chain C and resseq 1:143)' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 THR N N N N 273 THR CA C N S 274 THR C C N N 275 THR O O N N 276 THR CB C N R 277 THR OG1 O N N 278 THR CG2 C N N 279 THR OXT O N N 280 THR H H N N 281 THR H2 H N N 282 THR HA H N N 283 THR HB H N N 284 THR HG1 H N N 285 THR HG21 H N N 286 THR HG22 H N N 287 THR HG23 H N N 288 THR HXT H N N 289 TYR N N N N 290 TYR CA C N S 291 TYR C C N N 292 TYR O O N N 293 TYR CB C N N 294 TYR CG C Y N 295 TYR CD1 C Y N 296 TYR CD2 C Y N 297 TYR CE1 C Y N 298 TYR CE2 C Y N 299 TYR CZ C Y N 300 TYR OH O N N 301 TYR OXT O N N 302 TYR H H N N 303 TYR H2 H N N 304 TYR HA H N N 305 TYR HB2 H N N 306 TYR HB3 H N N 307 TYR HD1 H N N 308 TYR HD2 H N N 309 TYR HE1 H N N 310 TYR HE2 H N N 311 TYR HH H N N 312 TYR HXT H N N 313 VAL N N N N 314 VAL CA C N S 315 VAL C C N N 316 VAL O O N N 317 VAL CB C N N 318 VAL CG1 C N N 319 VAL CG2 C N N 320 VAL OXT O N N 321 VAL H H N N 322 VAL H2 H N N 323 VAL HA H N N 324 VAL HB H N N 325 VAL HG11 H N N 326 VAL HG12 H N N 327 VAL HG13 H N N 328 VAL HG21 H N N 329 VAL HG22 H N N 330 VAL HG23 H N N 331 VAL HXT H N N 332 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 THR N CA sing N N 262 THR N H sing N N 263 THR N H2 sing N N 264 THR CA C sing N N 265 THR CA CB sing N N 266 THR CA HA sing N N 267 THR C O doub N N 268 THR C OXT sing N N 269 THR CB OG1 sing N N 270 THR CB CG2 sing N N 271 THR CB HB sing N N 272 THR OG1 HG1 sing N N 273 THR CG2 HG21 sing N N 274 THR CG2 HG22 sing N N 275 THR CG2 HG23 sing N N 276 THR OXT HXT sing N N 277 TYR N CA sing N N 278 TYR N H sing N N 279 TYR N H2 sing N N 280 TYR CA C sing N N 281 TYR CA CB sing N N 282 TYR CA HA sing N N 283 TYR C O doub N N 284 TYR C OXT sing N N 285 TYR CB CG sing N N 286 TYR CB HB2 sing N N 287 TYR CB HB3 sing N N 288 TYR CG CD1 doub Y N 289 TYR CG CD2 sing Y N 290 TYR CD1 CE1 sing Y N 291 TYR CD1 HD1 sing N N 292 TYR CD2 CE2 doub Y N 293 TYR CD2 HD2 sing N N 294 TYR CE1 CZ doub Y N 295 TYR CE1 HE1 sing N N 296 TYR CE2 CZ sing Y N 297 TYR CE2 HE2 sing N N 298 TYR CZ OH sing N N 299 TYR OH HH sing N N 300 TYR OXT HXT sing N N 301 VAL N CA sing N N 302 VAL N H sing N N 303 VAL N H2 sing N N 304 VAL CA C sing N N 305 VAL CA CB sing N N 306 VAL CA HA sing N N 307 VAL C O doub N N 308 VAL C OXT sing N N 309 VAL CB CG1 sing N N 310 VAL CB CG2 sing N N 311 VAL CB HB sing N N 312 VAL CG1 HG11 sing N N 313 VAL CG1 HG12 sing N N 314 VAL CG1 HG13 sing N N 315 VAL CG2 HG21 sing N N 316 VAL CG2 HG22 sing N N 317 VAL CG2 HG23 sing N N 318 VAL OXT HXT sing N N 319 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'In house de novo designed protein' # _atom_sites.entry_id 8VEA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.008670 _atom_sites.fract_transf_matrix[1][2] 0.005006 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010012 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016668 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_