data_8VJN # _entry.id 8VJN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.393 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8VJN pdb_00008vjn 10.2210/pdb8vjn/pdb WWPDB D_1000280197 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-05-08 2 'Structure model' 1 1 2024-05-22 3 'Structure model' 1 2 2024-05-29 4 'Structure model' 1 3 2024-06-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' citation 5 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 4 'Structure model' '_citation.page_first' 13 4 'Structure model' '_citation.page_last' 14 4 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8VJN _pdbx_database_status.recvd_initial_deposition_date 2024-01-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email elifits@hotmail.com _pdbx_contact_author.name_first Elif _pdbx_contact_author.name_last Eren _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7942-4943 # _audit_author.name 'Eren, E.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-7942-4943 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 121 _citation.language ? _citation.page_first e2400426121 _citation.page_last e2400426121 _citation.title 'Myxococcus xanthus encapsulin cargo protein EncD is a flavin-binding protein with ferric reductase activity.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2400426121 _citation.pdbx_database_id_PubMed 38748579 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eren, E.' 1 0000-0002-7942-4943 primary 'Watts, N.R.' 2 0000-0001-5089-635X primary 'Conway, J.F.' 3 0000-0002-6581-4748 primary 'Wingfield, P.T.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Encapsulin nanocompartment cargo protein EncD' 7641.625 4 ? ? 'residues 1-59' ? 2 non-polymer syn 'FLAVIN MONONUCLEOTIDE' 456.344 2 ? ? ? ? 3 water nat water 18.015 85 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MHHHHHHMAKNSNPSAFDRDFGYLMPFLDRVAAAASDLEDASARAELTRLMVEEKARWQRIQELLG _entity_poly.pdbx_seq_one_letter_code_can MHHHHHHMAKNSNPSAFDRDFGYLMPFLDRVAAAASDLEDASARAELTRLMVEEKARWQRIQELLG _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FLAVIN MONONUCLEOTIDE' FMN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 MET n 1 9 ALA n 1 10 LYS n 1 11 ASN n 1 12 SER n 1 13 ASN n 1 14 PRO n 1 15 SER n 1 16 ALA n 1 17 PHE n 1 18 ASP n 1 19 ARG n 1 20 ASP n 1 21 PHE n 1 22 GLY n 1 23 TYR n 1 24 LEU n 1 25 MET n 1 26 PRO n 1 27 PHE n 1 28 LEU n 1 29 ASP n 1 30 ARG n 1 31 VAL n 1 32 ALA n 1 33 ALA n 1 34 ALA n 1 35 ALA n 1 36 SER n 1 37 ASP n 1 38 LEU n 1 39 GLU n 1 40 ASP n 1 41 ALA n 1 42 SER n 1 43 ALA n 1 44 ARG n 1 45 ALA n 1 46 GLU n 1 47 LEU n 1 48 THR n 1 49 ARG n 1 50 LEU n 1 51 MET n 1 52 VAL n 1 53 GLU n 1 54 GLU n 1 55 LYS n 1 56 ALA n 1 57 ARG n 1 58 TRP n 1 59 GLN n 1 60 ARG n 1 61 ILE n 1 62 GLN n 1 63 GLU n 1 64 LEU n 1 65 LEU n 1 66 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 66 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'encD, MXAN_2410' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Myxococcus xanthus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 34 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 FMN non-polymer . 'FLAVIN MONONUCLEOTIDE' 'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P' 456.344 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -6 ? ? ? A . n A 1 2 HIS 2 -5 ? ? ? A . n A 1 3 HIS 3 -4 ? ? ? A . n A 1 4 HIS 4 -3 ? ? ? A . n A 1 5 HIS 5 -2 ? ? ? A . n A 1 6 HIS 6 -1 ? ? ? A . n A 1 7 HIS 7 0 ? ? ? A . n A 1 8 MET 8 1 ? ? ? A . n A 1 9 ALA 9 2 ? ? ? A . n A 1 10 LYS 10 3 ? ? ? A . n A 1 11 ASN 11 4 ? ? ? A . n A 1 12 SER 12 5 ? ? ? A . n A 1 13 ASN 13 6 ? ? ? A . n A 1 14 PRO 14 7 ? ? ? A . n A 1 15 SER 15 8 8 SER SER A . n A 1 16 ALA 16 9 9 ALA ALA A . n A 1 17 PHE 17 10 10 PHE PHE A . n A 1 18 ASP 18 11 11 ASP ASP A . n A 1 19 ARG 19 12 12 ARG ARG A . n A 1 20 ASP 20 13 13 ASP ASP A . n A 1 21 PHE 21 14 14 PHE PHE A . n A 1 22 GLY 22 15 15 GLY GLY A . n A 1 23 TYR 23 16 16 TYR TYR A . n A 1 24 LEU 24 17 17 LEU LEU A . n A 1 25 MET 25 18 18 MET MET A . n A 1 26 PRO 26 19 19 PRO PRO A . n A 1 27 PHE 27 20 20 PHE PHE A . n A 1 28 LEU 28 21 21 LEU LEU A . n A 1 29 ASP 29 22 22 ASP ASP A . n A 1 30 ARG 30 23 23 ARG ARG A . n A 1 31 VAL 31 24 24 VAL VAL A . n A 1 32 ALA 32 25 25 ALA ALA A . n A 1 33 ALA 33 26 26 ALA ALA A . n A 1 34 ALA 34 27 27 ALA ALA A . n A 1 35 ALA 35 28 28 ALA ALA A . n A 1 36 SER 36 29 29 SER SER A . n A 1 37 ASP 37 30 30 ASP ASP A . n A 1 38 LEU 38 31 31 LEU LEU A . n A 1 39 GLU 39 32 32 GLU GLU A . n A 1 40 ASP 40 33 33 ASP ASP A . n A 1 41 ALA 41 34 34 ALA ALA A . n A 1 42 SER 42 35 35 SER SER A . n A 1 43 ALA 43 36 36 ALA ALA A . n A 1 44 ARG 44 37 37 ARG ARG A . n A 1 45 ALA 45 38 38 ALA ALA A . n A 1 46 GLU 46 39 39 GLU GLU A . n A 1 47 LEU 47 40 40 LEU LEU A . n A 1 48 THR 48 41 41 THR THR A . n A 1 49 ARG 49 42 42 ARG ARG A . n A 1 50 LEU 50 43 43 LEU LEU A . n A 1 51 MET 51 44 44 MET MET A . n A 1 52 VAL 52 45 45 VAL VAL A . n A 1 53 GLU 53 46 46 GLU GLU A . n A 1 54 GLU 54 47 47 GLU GLU A . n A 1 55 LYS 55 48 48 LYS LYS A . n A 1 56 ALA 56 49 49 ALA ALA A . n A 1 57 ARG 57 50 50 ARG ARG A . n A 1 58 TRP 58 51 51 TRP TRP A . n A 1 59 GLN 59 52 52 GLN GLN A . n A 1 60 ARG 60 53 53 ARG ARG A . n A 1 61 ILE 61 54 54 ILE ILE A . n A 1 62 GLN 62 55 55 GLN GLN A . n A 1 63 GLU 63 56 56 GLU GLU A . n A 1 64 LEU 64 57 57 LEU LEU A . n A 1 65 LEU 65 58 58 LEU LEU A . n A 1 66 GLY 66 59 59 GLY GLY A . n B 1 1 MET 1 -6 ? ? ? B . n B 1 2 HIS 2 -5 ? ? ? B . n B 1 3 HIS 3 -4 ? ? ? B . n B 1 4 HIS 4 -3 ? ? ? B . n B 1 5 HIS 5 -2 ? ? ? B . n B 1 6 HIS 6 -1 ? ? ? B . n B 1 7 HIS 7 0 ? ? ? B . n B 1 8 MET 8 1 ? ? ? B . n B 1 9 ALA 9 2 ? ? ? B . n B 1 10 LYS 10 3 ? ? ? B . n B 1 11 ASN 11 4 ? ? ? B . n B 1 12 SER 12 5 ? ? ? B . n B 1 13 ASN 13 6 ? ? ? B . n B 1 14 PRO 14 7 ? ? ? B . n B 1 15 SER 15 8 8 SER SER B . n B 1 16 ALA 16 9 9 ALA ALA B . n B 1 17 PHE 17 10 10 PHE PHE B . n B 1 18 ASP 18 11 11 ASP ASP B . n B 1 19 ARG 19 12 12 ARG ARG B . n B 1 20 ASP 20 13 13 ASP ASP B . n B 1 21 PHE 21 14 14 PHE PHE B . n B 1 22 GLY 22 15 15 GLY GLY B . n B 1 23 TYR 23 16 16 TYR TYR B . n B 1 24 LEU 24 17 17 LEU LEU B . n B 1 25 MET 25 18 18 MET MET B . n B 1 26 PRO 26 19 19 PRO PRO B . n B 1 27 PHE 27 20 20 PHE PHE B . n B 1 28 LEU 28 21 21 LEU LEU B . n B 1 29 ASP 29 22 22 ASP ASP B . n B 1 30 ARG 30 23 23 ARG ARG B . n B 1 31 VAL 31 24 24 VAL VAL B . n B 1 32 ALA 32 25 25 ALA ALA B . n B 1 33 ALA 33 26 26 ALA ALA B . n B 1 34 ALA 34 27 27 ALA ALA B . n B 1 35 ALA 35 28 28 ALA ALA B . n B 1 36 SER 36 29 29 SER SER B . n B 1 37 ASP 37 30 30 ASP ASP B . n B 1 38 LEU 38 31 31 LEU LEU B . n B 1 39 GLU 39 32 32 GLU GLU B . n B 1 40 ASP 40 33 33 ASP ASP B . n B 1 41 ALA 41 34 34 ALA ALA B . n B 1 42 SER 42 35 35 SER SER B . n B 1 43 ALA 43 36 36 ALA ALA B . n B 1 44 ARG 44 37 37 ARG ARG B . n B 1 45 ALA 45 38 38 ALA ALA B . n B 1 46 GLU 46 39 39 GLU GLU B . n B 1 47 LEU 47 40 40 LEU LEU B . n B 1 48 THR 48 41 41 THR THR B . n B 1 49 ARG 49 42 42 ARG ARG B . n B 1 50 LEU 50 43 43 LEU LEU B . n B 1 51 MET 51 44 44 MET MET B . n B 1 52 VAL 52 45 45 VAL VAL B . n B 1 53 GLU 53 46 46 GLU GLU B . n B 1 54 GLU 54 47 47 GLU GLU B . n B 1 55 LYS 55 48 48 LYS LYS B . n B 1 56 ALA 56 49 49 ALA ALA B . n B 1 57 ARG 57 50 50 ARG ARG B . n B 1 58 TRP 58 51 51 TRP TRP B . n B 1 59 GLN 59 52 52 GLN GLN B . n B 1 60 ARG 60 53 53 ARG ARG B . n B 1 61 ILE 61 54 54 ILE ILE B . n B 1 62 GLN 62 55 55 GLN GLN B . n B 1 63 GLU 63 56 56 GLU GLU B . n B 1 64 LEU 64 57 57 LEU LEU B . n B 1 65 LEU 65 58 58 LEU LEU B . n B 1 66 GLY 66 59 ? ? ? B . n C 1 1 MET 1 -6 ? ? ? C . n C 1 2 HIS 2 -5 ? ? ? C . n C 1 3 HIS 3 -4 ? ? ? C . n C 1 4 HIS 4 -3 ? ? ? C . n C 1 5 HIS 5 -2 ? ? ? C . n C 1 6 HIS 6 -1 ? ? ? C . n C 1 7 HIS 7 0 ? ? ? C . n C 1 8 MET 8 1 ? ? ? C . n C 1 9 ALA 9 2 ? ? ? C . n C 1 10 LYS 10 3 ? ? ? C . n C 1 11 ASN 11 4 ? ? ? C . n C 1 12 SER 12 5 ? ? ? C . n C 1 13 ASN 13 6 ? ? ? C . n C 1 14 PRO 14 7 ? ? ? C . n C 1 15 SER 15 8 8 SER SER C . n C 1 16 ALA 16 9 9 ALA ALA C . n C 1 17 PHE 17 10 10 PHE PHE C . n C 1 18 ASP 18 11 11 ASP ASP C . n C 1 19 ARG 19 12 12 ARG ARG C . n C 1 20 ASP 20 13 13 ASP ASP C . n C 1 21 PHE 21 14 14 PHE PHE C . n C 1 22 GLY 22 15 15 GLY GLY C . n C 1 23 TYR 23 16 16 TYR TYR C . n C 1 24 LEU 24 17 17 LEU LEU C . n C 1 25 MET 25 18 18 MET MET C . n C 1 26 PRO 26 19 19 PRO PRO C . n C 1 27 PHE 27 20 20 PHE PHE C . n C 1 28 LEU 28 21 21 LEU LEU C . n C 1 29 ASP 29 22 22 ASP ASP C . n C 1 30 ARG 30 23 23 ARG ARG C . n C 1 31 VAL 31 24 24 VAL VAL C . n C 1 32 ALA 32 25 25 ALA ALA C . n C 1 33 ALA 33 26 26 ALA ALA C . n C 1 34 ALA 34 27 27 ALA ALA C . n C 1 35 ALA 35 28 28 ALA ALA C . n C 1 36 SER 36 29 29 SER SER C . n C 1 37 ASP 37 30 30 ASP ASP C . n C 1 38 LEU 38 31 31 LEU LEU C . n C 1 39 GLU 39 32 32 GLU GLU C . n C 1 40 ASP 40 33 33 ASP ASP C . n C 1 41 ALA 41 34 34 ALA ALA C . n C 1 42 SER 42 35 35 SER SER C . n C 1 43 ALA 43 36 36 ALA ALA C . n C 1 44 ARG 44 37 37 ARG ARG C . n C 1 45 ALA 45 38 38 ALA ALA C . n C 1 46 GLU 46 39 39 GLU GLU C . n C 1 47 LEU 47 40 40 LEU LEU C . n C 1 48 THR 48 41 41 THR THR C . n C 1 49 ARG 49 42 42 ARG ARG C . n C 1 50 LEU 50 43 43 LEU LEU C . n C 1 51 MET 51 44 44 MET MET C . n C 1 52 VAL 52 45 45 VAL VAL C . n C 1 53 GLU 53 46 46 GLU GLU C . n C 1 54 GLU 54 47 47 GLU GLU C . n C 1 55 LYS 55 48 48 LYS LYS C . n C 1 56 ALA 56 49 49 ALA ALA C . n C 1 57 ARG 57 50 50 ARG ARG C . n C 1 58 TRP 58 51 51 TRP TRP C . n C 1 59 GLN 59 52 52 GLN GLN C . n C 1 60 ARG 60 53 53 ARG ARG C . n C 1 61 ILE 61 54 54 ILE ILE C . n C 1 62 GLN 62 55 55 GLN GLN C . n C 1 63 GLU 63 56 56 GLU GLU C . n C 1 64 LEU 64 57 57 LEU LEU C . n C 1 65 LEU 65 58 58 LEU LEU C . n C 1 66 GLY 66 59 59 GLY GLY C . n D 1 1 MET 1 -6 ? ? ? D . n D 1 2 HIS 2 -5 ? ? ? D . n D 1 3 HIS 3 -4 ? ? ? D . n D 1 4 HIS 4 -3 ? ? ? D . n D 1 5 HIS 5 -2 ? ? ? D . n D 1 6 HIS 6 -1 ? ? ? D . n D 1 7 HIS 7 0 ? ? ? D . n D 1 8 MET 8 1 ? ? ? D . n D 1 9 ALA 9 2 ? ? ? D . n D 1 10 LYS 10 3 ? ? ? D . n D 1 11 ASN 11 4 ? ? ? D . n D 1 12 SER 12 5 ? ? ? D . n D 1 13 ASN 13 6 ? ? ? D . n D 1 14 PRO 14 7 ? ? ? D . n D 1 15 SER 15 8 8 SER SER D . n D 1 16 ALA 16 9 9 ALA ALA D . n D 1 17 PHE 17 10 10 PHE PHE D . n D 1 18 ASP 18 11 11 ASP ASP D . n D 1 19 ARG 19 12 12 ARG ARG D . n D 1 20 ASP 20 13 13 ASP ASP D . n D 1 21 PHE 21 14 14 PHE PHE D . n D 1 22 GLY 22 15 15 GLY GLY D . n D 1 23 TYR 23 16 16 TYR TYR D . n D 1 24 LEU 24 17 17 LEU LEU D . n D 1 25 MET 25 18 18 MET MET D . n D 1 26 PRO 26 19 19 PRO PRO D . n D 1 27 PHE 27 20 20 PHE PHE D . n D 1 28 LEU 28 21 21 LEU LEU D . n D 1 29 ASP 29 22 22 ASP ASP D . n D 1 30 ARG 30 23 23 ARG ARG D . n D 1 31 VAL 31 24 24 VAL VAL D . n D 1 32 ALA 32 25 25 ALA ALA D . n D 1 33 ALA 33 26 26 ALA ALA D . n D 1 34 ALA 34 27 27 ALA ALA D . n D 1 35 ALA 35 28 28 ALA ALA D . n D 1 36 SER 36 29 29 SER SER D . n D 1 37 ASP 37 30 30 ASP ASP D . n D 1 38 LEU 38 31 31 LEU LEU D . n D 1 39 GLU 39 32 32 GLU GLU D . n D 1 40 ASP 40 33 33 ASP ASP D . n D 1 41 ALA 41 34 34 ALA ALA D . n D 1 42 SER 42 35 35 SER SER D . n D 1 43 ALA 43 36 36 ALA ALA D . n D 1 44 ARG 44 37 37 ARG ARG D . n D 1 45 ALA 45 38 38 ALA ALA D . n D 1 46 GLU 46 39 39 GLU GLU D . n D 1 47 LEU 47 40 40 LEU LEU D . n D 1 48 THR 48 41 41 THR THR D . n D 1 49 ARG 49 42 42 ARG ARG D . n D 1 50 LEU 50 43 43 LEU LEU D . n D 1 51 MET 51 44 44 MET MET D . n D 1 52 VAL 52 45 45 VAL VAL D . n D 1 53 GLU 53 46 46 GLU GLU D . n D 1 54 GLU 54 47 47 GLU GLU D . n D 1 55 LYS 55 48 48 LYS LYS D . n D 1 56 ALA 56 49 49 ALA ALA D . n D 1 57 ARG 57 50 50 ARG ARG D . n D 1 58 TRP 58 51 51 TRP TRP D . n D 1 59 GLN 59 52 52 GLN GLN D . n D 1 60 ARG 60 53 53 ARG ARG D . n D 1 61 ILE 61 54 54 ILE ILE D . n D 1 62 GLN 62 55 55 GLN GLN D . n D 1 63 GLU 63 56 56 GLU GLU D . n D 1 64 LEU 64 57 57 LEU LEU D . n D 1 65 LEU 65 58 58 LEU LEU D . n D 1 66 GLY 66 59 59 GLY GLY D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 FMN 1 101 94 FMN FMN C . F 2 FMN 1 101 94 FMN FMN D . G 3 HOH 1 101 27 HOH HOH A . G 3 HOH 2 102 4 HOH HOH A . G 3 HOH 3 103 16 HOH HOH A . G 3 HOH 4 104 8 HOH HOH A . G 3 HOH 5 105 7 HOH HOH A . G 3 HOH 6 106 90 HOH HOH A . G 3 HOH 7 107 74 HOH HOH A . G 3 HOH 8 108 31 HOH HOH A . G 3 HOH 9 109 49 HOH HOH A . G 3 HOH 10 110 28 HOH HOH A . G 3 HOH 11 111 95 HOH HOH A . G 3 HOH 12 112 40 HOH HOH A . G 3 HOH 13 113 85 HOH HOH A . G 3 HOH 14 114 30 HOH HOH A . G 3 HOH 15 115 70 HOH HOH A . G 3 HOH 16 116 72 HOH HOH A . H 3 HOH 1 101 76 HOH HOH B . H 3 HOH 2 102 59 HOH HOH B . H 3 HOH 3 103 82 HOH HOH B . H 3 HOH 4 104 52 HOH HOH B . H 3 HOH 5 105 80 HOH HOH B . H 3 HOH 6 106 51 HOH HOH B . H 3 HOH 7 107 61 HOH HOH B . H 3 HOH 8 108 22 HOH HOH B . H 3 HOH 9 109 78 HOH HOH B . H 3 HOH 10 110 36 HOH HOH B . H 3 HOH 11 111 32 HOH HOH B . H 3 HOH 12 112 100 HOH HOH B . H 3 HOH 13 113 65 HOH HOH B . H 3 HOH 14 114 102 HOH HOH B . I 3 HOH 1 201 46 HOH HOH C . I 3 HOH 2 202 1 HOH HOH C . I 3 HOH 3 203 25 HOH HOH C . I 3 HOH 4 204 97 HOH HOH C . I 3 HOH 5 205 2 HOH HOH C . I 3 HOH 6 206 75 HOH HOH C . I 3 HOH 7 207 60 HOH HOH C . I 3 HOH 8 208 15 HOH HOH C . I 3 HOH 9 209 77 HOH HOH C . I 3 HOH 10 210 14 HOH HOH C . I 3 HOH 11 211 93 HOH HOH C . I 3 HOH 12 212 6 HOH HOH C . I 3 HOH 13 213 47 HOH HOH C . I 3 HOH 14 214 11 HOH HOH C . I 3 HOH 15 215 18 HOH HOH C . I 3 HOH 16 216 21 HOH HOH C . I 3 HOH 17 217 13 HOH HOH C . I 3 HOH 18 218 83 HOH HOH C . I 3 HOH 19 219 23 HOH HOH C . I 3 HOH 20 220 53 HOH HOH C . I 3 HOH 21 221 58 HOH HOH C . I 3 HOH 22 222 64 HOH HOH C . I 3 HOH 23 223 73 HOH HOH C . I 3 HOH 24 224 99 HOH HOH C . I 3 HOH 25 225 50 HOH HOH C . I 3 HOH 26 226 101 HOH HOH C . I 3 HOH 27 227 92 HOH HOH C . I 3 HOH 28 228 69 HOH HOH C . I 3 HOH 29 229 62 HOH HOH C . I 3 HOH 30 230 44 HOH HOH C . I 3 HOH 31 231 91 HOH HOH C . I 3 HOH 32 232 42 HOH HOH C . J 3 HOH 1 201 56 HOH HOH D . J 3 HOH 2 202 34 HOH HOH D . J 3 HOH 3 203 26 HOH HOH D . J 3 HOH 4 204 24 HOH HOH D . J 3 HOH 5 205 98 HOH HOH D . J 3 HOH 6 206 20 HOH HOH D . J 3 HOH 7 207 79 HOH HOH D . J 3 HOH 8 208 43 HOH HOH D . J 3 HOH 9 209 12 HOH HOH D . J 3 HOH 10 210 45 HOH HOH D . J 3 HOH 11 211 9 HOH HOH D . J 3 HOH 12 212 54 HOH HOH D . J 3 HOH 13 213 88 HOH HOH D . J 3 HOH 14 214 81 HOH HOH D . J 3 HOH 15 215 66 HOH HOH D . J 3 HOH 16 216 96 HOH HOH D . J 3 HOH 17 217 86 HOH HOH D . J 3 HOH 18 218 55 HOH HOH D . J 3 HOH 19 219 94 HOH HOH D . J 3 HOH 20 220 68 HOH HOH D . J 3 HOH 21 221 89 HOH HOH D . J 3 HOH 22 222 71 HOH HOH D . J 3 HOH 23 223 67 HOH HOH D . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id C _pdbx_unobs_or_zero_occ_atoms.auth_comp_id SER _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 8 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id OG _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id C _pdbx_unobs_or_zero_occ_atoms.label_comp_id SER _pdbx_unobs_or_zero_occ_atoms.label_seq_id 15 _pdbx_unobs_or_zero_occ_atoms.label_atom_id OG # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2-3874 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 96.83 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8VJN _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.566 _cell.length_a_esd ? _cell.length_b 27.999 _cell.length_b_esd ? _cell.length_c 86.469 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8VJN _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8VJN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.72 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 28.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG 1500, 0.1 M PCTP (sodium propionate, sodium cacodylate and Bis-Tris propane, 2:1:2)' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-05-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9774 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9774 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8VJN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.31 _reflns.d_resolution_low 42.93 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9203 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.94 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.93 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.31 _reflns_shell.d_res_low 2.4 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 726 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.0 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.37 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 80 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.84 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8VJN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.31 _refine.ls_d_res_low 32.54 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9189 _refine.ls_number_reflns_R_free 919 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.98 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1879 _refine.ls_R_factor_R_free 0.2306 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1828 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.91 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.34 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.31 _refine_hist.d_res_low 32.54 _refine_hist.number_atoms_solvent 85 _refine_hist.number_atoms_total 1806 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1659 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 62 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? ? ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.052 ? ? ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.803 ? 246 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.052 ? 250 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 ? 302 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.31 2.43 . . 108 988 84.00 . . . . 0.2561 . . . . . . . . . . . 0.3102 'X-RAY DIFFRACTION' 2.43 2.58 . . 129 1154 96.00 . . . . 0.2418 . . . . . . . . . . . 0.3464 'X-RAY DIFFRACTION' 2.58 2.78 . . 133 1199 100.00 . . . . 0.2356 . . . . . . . . . . . 0.3219 'X-RAY DIFFRACTION' 2.78 3.06 . . 135 1220 100.00 . . . . 0.2061 . . . . . . . . . . . 0.2741 'X-RAY DIFFRACTION' 3.06 3.51 . . 135 1214 100.00 . . . . 0.1889 . . . . . . . . . . . 0.2242 'X-RAY DIFFRACTION' 3.51 4.42 . . 136 1218 100.00 . . . . 0.1434 . . . . . . . . . . . 0.1906 'X-RAY DIFFRACTION' 4.42 32.54 . . 143 1277 99.00 . . . . 0.1692 . . . . . . . . . . . 0.1957 # _struct.entry_id 8VJN _struct.title 'Myxococcus xanthus encapsulin cargo protein EncD in complex with flavin mononucleotide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8VJN _struct_keywords.text 'Encapsulin, cargo protein, EncD, flavin, flavin mononucleotide, EncA, FLAVOPROTEIN' _struct_keywords.pdbx_keywords FLAVOPROTEIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 3 ? H N N 3 ? I N N 3 ? J N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ENCD_MYXXD _struct_ref.pdbx_db_accession Q1D9P3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MAKNSNPSAFDRDFGYLMPFLDRVAAAASDLEDASARAELTRLMVEEKARWQRIQELLG _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8VJN A 8 ? 66 ? Q1D9P3 1 ? 59 ? 1 59 2 1 8VJN B 8 ? 66 ? Q1D9P3 1 ? 59 ? 1 59 3 1 8VJN C 8 ? 66 ? Q1D9P3 1 ? 59 ? 1 59 4 1 8VJN D 8 ? 66 ? Q1D9P3 1 ? 59 ? 1 59 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8VJN MET A 1 ? UNP Q1D9P3 ? ? 'initiating methionine' -6 1 1 8VJN HIS A 2 ? UNP Q1D9P3 ? ? 'expression tag' -5 2 1 8VJN HIS A 3 ? UNP Q1D9P3 ? ? 'expression tag' -4 3 1 8VJN HIS A 4 ? UNP Q1D9P3 ? ? 'expression tag' -3 4 1 8VJN HIS A 5 ? UNP Q1D9P3 ? ? 'expression tag' -2 5 1 8VJN HIS A 6 ? UNP Q1D9P3 ? ? 'expression tag' -1 6 1 8VJN HIS A 7 ? UNP Q1D9P3 ? ? 'expression tag' 0 7 2 8VJN MET B 1 ? UNP Q1D9P3 ? ? 'initiating methionine' -6 8 2 8VJN HIS B 2 ? UNP Q1D9P3 ? ? 'expression tag' -5 9 2 8VJN HIS B 3 ? UNP Q1D9P3 ? ? 'expression tag' -4 10 2 8VJN HIS B 4 ? UNP Q1D9P3 ? ? 'expression tag' -3 11 2 8VJN HIS B 5 ? UNP Q1D9P3 ? ? 'expression tag' -2 12 2 8VJN HIS B 6 ? UNP Q1D9P3 ? ? 'expression tag' -1 13 2 8VJN HIS B 7 ? UNP Q1D9P3 ? ? 'expression tag' 0 14 3 8VJN MET C 1 ? UNP Q1D9P3 ? ? 'initiating methionine' -6 15 3 8VJN HIS C 2 ? UNP Q1D9P3 ? ? 'expression tag' -5 16 3 8VJN HIS C 3 ? UNP Q1D9P3 ? ? 'expression tag' -4 17 3 8VJN HIS C 4 ? UNP Q1D9P3 ? ? 'expression tag' -3 18 3 8VJN HIS C 5 ? UNP Q1D9P3 ? ? 'expression tag' -2 19 3 8VJN HIS C 6 ? UNP Q1D9P3 ? ? 'expression tag' -1 20 3 8VJN HIS C 7 ? UNP Q1D9P3 ? ? 'expression tag' 0 21 4 8VJN MET D 1 ? UNP Q1D9P3 ? ? 'initiating methionine' -6 22 4 8VJN HIS D 2 ? UNP Q1D9P3 ? ? 'expression tag' -5 23 4 8VJN HIS D 3 ? UNP Q1D9P3 ? ? 'expression tag' -4 24 4 8VJN HIS D 4 ? UNP Q1D9P3 ? ? 'expression tag' -3 25 4 8VJN HIS D 5 ? UNP Q1D9P3 ? ? 'expression tag' -2 26 4 8VJN HIS D 6 ? UNP Q1D9P3 ? ? 'expression tag' -1 27 4 8VJN HIS D 7 ? UNP Q1D9P3 ? ? 'expression tag' 0 28 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2940 ? 1 MORE -18 ? 1 'SSA (A^2)' 6020 ? 2 'ABSA (A^2)' 2920 ? 2 MORE -18 ? 2 'SSA (A^2)' 6180 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,E,G,I 2 1 B,D,F,H,J # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 17 ? SER A 36 ? PHE A 10 SER A 29 1 ? 20 HELX_P HELX_P2 AA2 ASP A 40 ? GLY A 66 ? ASP A 33 GLY A 59 1 ? 27 HELX_P HELX_P3 AA3 PHE B 17 ? SER B 36 ? PHE B 10 SER B 29 1 ? 20 HELX_P HELX_P4 AA4 ASP B 40 ? LEU B 65 ? ASP B 33 LEU B 58 1 ? 26 HELX_P HELX_P5 AA5 PHE C 17 ? SER C 36 ? PHE C 10 SER C 29 1 ? 20 HELX_P HELX_P6 AA6 ASP C 40 ? GLY C 66 ? ASP C 33 GLY C 59 1 ? 27 HELX_P HELX_P7 AA7 PHE D 17 ? ALA D 35 ? PHE D 10 ALA D 28 1 ? 19 HELX_P HELX_P8 AA8 SER D 36 ? LEU D 38 ? SER D 29 LEU D 31 5 ? 3 HELX_P HELX_P9 AA9 ASP D 40 ? GLY D 66 ? ASP D 33 GLY D 59 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 22.0562 _pdbx_refine_tls.origin_y -5.1802 _pdbx_refine_tls.origin_z 21.4996 _pdbx_refine_tls.T[1][1] 0.2599 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0056 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0052 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.3045 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0271 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.2785 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] -0.4094 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.0877 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.3456 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.4191 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.1964 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.4534 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0234 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0145 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0037 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0096 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0019 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0045 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0047 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0086 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0000 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # _pdbx_entry_details.entry_id 8VJN _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 116 ? 6.19 . 2 1 O ? D HOH 223 ? 6.46 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -6 ? A MET 1 2 1 Y 1 A HIS -5 ? A HIS 2 3 1 Y 1 A HIS -4 ? A HIS 3 4 1 Y 1 A HIS -3 ? A HIS 4 5 1 Y 1 A HIS -2 ? A HIS 5 6 1 Y 1 A HIS -1 ? A HIS 6 7 1 Y 1 A HIS 0 ? A HIS 7 8 1 Y 1 A MET 1 ? A MET 8 9 1 Y 1 A ALA 2 ? A ALA 9 10 1 Y 1 A LYS 3 ? A LYS 10 11 1 Y 1 A ASN 4 ? A ASN 11 12 1 Y 1 A SER 5 ? A SER 12 13 1 Y 1 A ASN 6 ? A ASN 13 14 1 Y 1 A PRO 7 ? A PRO 14 15 1 Y 1 B MET -6 ? B MET 1 16 1 Y 1 B HIS -5 ? B HIS 2 17 1 Y 1 B HIS -4 ? B HIS 3 18 1 Y 1 B HIS -3 ? B HIS 4 19 1 Y 1 B HIS -2 ? B HIS 5 20 1 Y 1 B HIS -1 ? B HIS 6 21 1 Y 1 B HIS 0 ? B HIS 7 22 1 Y 1 B MET 1 ? B MET 8 23 1 Y 1 B ALA 2 ? B ALA 9 24 1 Y 1 B LYS 3 ? B LYS 10 25 1 Y 1 B ASN 4 ? B ASN 11 26 1 Y 1 B SER 5 ? B SER 12 27 1 Y 1 B ASN 6 ? B ASN 13 28 1 Y 1 B PRO 7 ? B PRO 14 29 1 Y 1 B GLY 59 ? B GLY 66 30 1 Y 1 C MET -6 ? C MET 1 31 1 Y 1 C HIS -5 ? C HIS 2 32 1 Y 1 C HIS -4 ? C HIS 3 33 1 Y 1 C HIS -3 ? C HIS 4 34 1 Y 1 C HIS -2 ? C HIS 5 35 1 Y 1 C HIS -1 ? C HIS 6 36 1 Y 1 C HIS 0 ? C HIS 7 37 1 Y 1 C MET 1 ? C MET 8 38 1 Y 1 C ALA 2 ? C ALA 9 39 1 Y 1 C LYS 3 ? C LYS 10 40 1 Y 1 C ASN 4 ? C ASN 11 41 1 Y 1 C SER 5 ? C SER 12 42 1 Y 1 C ASN 6 ? C ASN 13 43 1 Y 1 C PRO 7 ? C PRO 14 44 1 Y 1 D MET -6 ? D MET 1 45 1 Y 1 D HIS -5 ? D HIS 2 46 1 Y 1 D HIS -4 ? D HIS 3 47 1 Y 1 D HIS -3 ? D HIS 4 48 1 Y 1 D HIS -2 ? D HIS 5 49 1 Y 1 D HIS -1 ? D HIS 6 50 1 Y 1 D HIS 0 ? D HIS 7 51 1 Y 1 D MET 1 ? D MET 8 52 1 Y 1 D ALA 2 ? D ALA 9 53 1 Y 1 D LYS 3 ? D LYS 10 54 1 Y 1 D ASN 4 ? D ASN 11 55 1 Y 1 D SER 5 ? D SER 12 56 1 Y 1 D ASN 6 ? D ASN 13 57 1 Y 1 D PRO 7 ? D PRO 14 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 FMN N1 N N N 74 FMN C2 C N N 75 FMN O2 O N N 76 FMN N3 N N N 77 FMN C4 C N N 78 FMN O4 O N N 79 FMN C4A C N N 80 FMN N5 N N N 81 FMN C5A C Y N 82 FMN C6 C Y N 83 FMN C7 C Y N 84 FMN C7M C N N 85 FMN C8 C Y N 86 FMN C8M C N N 87 FMN C9 C Y N 88 FMN C9A C Y N 89 FMN N10 N N N 90 FMN C10 C N N 91 FMN "C1'" C N N 92 FMN "C2'" C N S 93 FMN "O2'" O N N 94 FMN "C3'" C N S 95 FMN "O3'" O N N 96 FMN "C4'" C N R 97 FMN "O4'" O N N 98 FMN "C5'" C N N 99 FMN "O5'" O N N 100 FMN P P N N 101 FMN O1P O N N 102 FMN O2P O N N 103 FMN O3P O N N 104 FMN HN3 H N N 105 FMN H6 H N N 106 FMN HM71 H N N 107 FMN HM72 H N N 108 FMN HM73 H N N 109 FMN HM81 H N N 110 FMN HM82 H N N 111 FMN HM83 H N N 112 FMN H9 H N N 113 FMN "H1'1" H N N 114 FMN "H1'2" H N N 115 FMN "H2'" H N N 116 FMN "HO2'" H N N 117 FMN "H3'" H N N 118 FMN "HO3'" H N N 119 FMN "H4'" H N N 120 FMN "HO4'" H N N 121 FMN "H5'1" H N N 122 FMN "H5'2" H N N 123 FMN HOP2 H N N 124 FMN HOP3 H N N 125 GLN N N N N 126 GLN CA C N S 127 GLN C C N N 128 GLN O O N N 129 GLN CB C N N 130 GLN CG C N N 131 GLN CD C N N 132 GLN OE1 O N N 133 GLN NE2 N N N 134 GLN OXT O N N 135 GLN H H N N 136 GLN H2 H N N 137 GLN HA H N N 138 GLN HB2 H N N 139 GLN HB3 H N N 140 GLN HG2 H N N 141 GLN HG3 H N N 142 GLN HE21 H N N 143 GLN HE22 H N N 144 GLN HXT H N N 145 GLU N N N N 146 GLU CA C N S 147 GLU C C N N 148 GLU O O N N 149 GLU CB C N N 150 GLU CG C N N 151 GLU CD C N N 152 GLU OE1 O N N 153 GLU OE2 O N N 154 GLU OXT O N N 155 GLU H H N N 156 GLU H2 H N N 157 GLU HA H N N 158 GLU HB2 H N N 159 GLU HB3 H N N 160 GLU HG2 H N N 161 GLU HG3 H N N 162 GLU HE2 H N N 163 GLU HXT H N N 164 GLY N N N N 165 GLY CA C N N 166 GLY C C N N 167 GLY O O N N 168 GLY OXT O N N 169 GLY H H N N 170 GLY H2 H N N 171 GLY HA2 H N N 172 GLY HA3 H N N 173 GLY HXT H N N 174 HIS N N N N 175 HIS CA C N S 176 HIS C C N N 177 HIS O O N N 178 HIS CB C N N 179 HIS CG C Y N 180 HIS ND1 N Y N 181 HIS CD2 C Y N 182 HIS CE1 C Y N 183 HIS NE2 N Y N 184 HIS OXT O N N 185 HIS H H N N 186 HIS H2 H N N 187 HIS HA H N N 188 HIS HB2 H N N 189 HIS HB3 H N N 190 HIS HD1 H N N 191 HIS HD2 H N N 192 HIS HE1 H N N 193 HIS HE2 H N N 194 HIS HXT H N N 195 HOH O O N N 196 HOH H1 H N N 197 HOH H2 H N N 198 ILE N N N N 199 ILE CA C N S 200 ILE C C N N 201 ILE O O N N 202 ILE CB C N S 203 ILE CG1 C N N 204 ILE CG2 C N N 205 ILE CD1 C N N 206 ILE OXT O N N 207 ILE H H N N 208 ILE H2 H N N 209 ILE HA H N N 210 ILE HB H N N 211 ILE HG12 H N N 212 ILE HG13 H N N 213 ILE HG21 H N N 214 ILE HG22 H N N 215 ILE HG23 H N N 216 ILE HD11 H N N 217 ILE HD12 H N N 218 ILE HD13 H N N 219 ILE HXT H N N 220 LEU N N N N 221 LEU CA C N S 222 LEU C C N N 223 LEU O O N N 224 LEU CB C N N 225 LEU CG C N N 226 LEU CD1 C N N 227 LEU CD2 C N N 228 LEU OXT O N N 229 LEU H H N N 230 LEU H2 H N N 231 LEU HA H N N 232 LEU HB2 H N N 233 LEU HB3 H N N 234 LEU HG H N N 235 LEU HD11 H N N 236 LEU HD12 H N N 237 LEU HD13 H N N 238 LEU HD21 H N N 239 LEU HD22 H N N 240 LEU HD23 H N N 241 LEU HXT H N N 242 LYS N N N N 243 LYS CA C N S 244 LYS C C N N 245 LYS O O N N 246 LYS CB C N N 247 LYS CG C N N 248 LYS CD C N N 249 LYS CE C N N 250 LYS NZ N N N 251 LYS OXT O N N 252 LYS H H N N 253 LYS H2 H N N 254 LYS HA H N N 255 LYS HB2 H N N 256 LYS HB3 H N N 257 LYS HG2 H N N 258 LYS HG3 H N N 259 LYS HD2 H N N 260 LYS HD3 H N N 261 LYS HE2 H N N 262 LYS HE3 H N N 263 LYS HZ1 H N N 264 LYS HZ2 H N N 265 LYS HZ3 H N N 266 LYS HXT H N N 267 MET N N N N 268 MET CA C N S 269 MET C C N N 270 MET O O N N 271 MET CB C N N 272 MET CG C N N 273 MET SD S N N 274 MET CE C N N 275 MET OXT O N N 276 MET H H N N 277 MET H2 H N N 278 MET HA H N N 279 MET HB2 H N N 280 MET HB3 H N N 281 MET HG2 H N N 282 MET HG3 H N N 283 MET HE1 H N N 284 MET HE2 H N N 285 MET HE3 H N N 286 MET HXT H N N 287 PHE N N N N 288 PHE CA C N S 289 PHE C C N N 290 PHE O O N N 291 PHE CB C N N 292 PHE CG C Y N 293 PHE CD1 C Y N 294 PHE CD2 C Y N 295 PHE CE1 C Y N 296 PHE CE2 C Y N 297 PHE CZ C Y N 298 PHE OXT O N N 299 PHE H H N N 300 PHE H2 H N N 301 PHE HA H N N 302 PHE HB2 H N N 303 PHE HB3 H N N 304 PHE HD1 H N N 305 PHE HD2 H N N 306 PHE HE1 H N N 307 PHE HE2 H N N 308 PHE HZ H N N 309 PHE HXT H N N 310 PRO N N N N 311 PRO CA C N S 312 PRO C C N N 313 PRO O O N N 314 PRO CB C N N 315 PRO CG C N N 316 PRO CD C N N 317 PRO OXT O N N 318 PRO H H N N 319 PRO HA H N N 320 PRO HB2 H N N 321 PRO HB3 H N N 322 PRO HG2 H N N 323 PRO HG3 H N N 324 PRO HD2 H N N 325 PRO HD3 H N N 326 PRO HXT H N N 327 SER N N N N 328 SER CA C N S 329 SER C C N N 330 SER O O N N 331 SER CB C N N 332 SER OG O N N 333 SER OXT O N N 334 SER H H N N 335 SER H2 H N N 336 SER HA H N N 337 SER HB2 H N N 338 SER HB3 H N N 339 SER HG H N N 340 SER HXT H N N 341 THR N N N N 342 THR CA C N S 343 THR C C N N 344 THR O O N N 345 THR CB C N R 346 THR OG1 O N N 347 THR CG2 C N N 348 THR OXT O N N 349 THR H H N N 350 THR H2 H N N 351 THR HA H N N 352 THR HB H N N 353 THR HG1 H N N 354 THR HG21 H N N 355 THR HG22 H N N 356 THR HG23 H N N 357 THR HXT H N N 358 TRP N N N N 359 TRP CA C N S 360 TRP C C N N 361 TRP O O N N 362 TRP CB C N N 363 TRP CG C Y N 364 TRP CD1 C Y N 365 TRP CD2 C Y N 366 TRP NE1 N Y N 367 TRP CE2 C Y N 368 TRP CE3 C Y N 369 TRP CZ2 C Y N 370 TRP CZ3 C Y N 371 TRP CH2 C Y N 372 TRP OXT O N N 373 TRP H H N N 374 TRP H2 H N N 375 TRP HA H N N 376 TRP HB2 H N N 377 TRP HB3 H N N 378 TRP HD1 H N N 379 TRP HE1 H N N 380 TRP HE3 H N N 381 TRP HZ2 H N N 382 TRP HZ3 H N N 383 TRP HH2 H N N 384 TRP HXT H N N 385 TYR N N N N 386 TYR CA C N S 387 TYR C C N N 388 TYR O O N N 389 TYR CB C N N 390 TYR CG C Y N 391 TYR CD1 C Y N 392 TYR CD2 C Y N 393 TYR CE1 C Y N 394 TYR CE2 C Y N 395 TYR CZ C Y N 396 TYR OH O N N 397 TYR OXT O N N 398 TYR H H N N 399 TYR H2 H N N 400 TYR HA H N N 401 TYR HB2 H N N 402 TYR HB3 H N N 403 TYR HD1 H N N 404 TYR HD2 H N N 405 TYR HE1 H N N 406 TYR HE2 H N N 407 TYR HH H N N 408 TYR HXT H N N 409 VAL N N N N 410 VAL CA C N S 411 VAL C C N N 412 VAL O O N N 413 VAL CB C N N 414 VAL CG1 C N N 415 VAL CG2 C N N 416 VAL OXT O N N 417 VAL H H N N 418 VAL H2 H N N 419 VAL HA H N N 420 VAL HB H N N 421 VAL HG11 H N N 422 VAL HG12 H N N 423 VAL HG13 H N N 424 VAL HG21 H N N 425 VAL HG22 H N N 426 VAL HG23 H N N 427 VAL HXT H N N 428 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 FMN N1 C2 sing N N 70 FMN N1 C10 doub N N 71 FMN C2 O2 doub N N 72 FMN C2 N3 sing N N 73 FMN N3 C4 sing N N 74 FMN N3 HN3 sing N N 75 FMN C4 O4 doub N N 76 FMN C4 C4A sing N N 77 FMN C4A N5 doub N N 78 FMN C4A C10 sing N N 79 FMN N5 C5A sing N N 80 FMN C5A C6 doub Y N 81 FMN C5A C9A sing Y N 82 FMN C6 C7 sing Y N 83 FMN C6 H6 sing N N 84 FMN C7 C7M sing N N 85 FMN C7 C8 doub Y N 86 FMN C7M HM71 sing N N 87 FMN C7M HM72 sing N N 88 FMN C7M HM73 sing N N 89 FMN C8 C8M sing N N 90 FMN C8 C9 sing Y N 91 FMN C8M HM81 sing N N 92 FMN C8M HM82 sing N N 93 FMN C8M HM83 sing N N 94 FMN C9 C9A doub Y N 95 FMN C9 H9 sing N N 96 FMN C9A N10 sing N N 97 FMN N10 C10 sing N N 98 FMN N10 "C1'" sing N N 99 FMN "C1'" "C2'" sing N N 100 FMN "C1'" "H1'1" sing N N 101 FMN "C1'" "H1'2" sing N N 102 FMN "C2'" "O2'" sing N N 103 FMN "C2'" "C3'" sing N N 104 FMN "C2'" "H2'" sing N N 105 FMN "O2'" "HO2'" sing N N 106 FMN "C3'" "O3'" sing N N 107 FMN "C3'" "C4'" sing N N 108 FMN "C3'" "H3'" sing N N 109 FMN "O3'" "HO3'" sing N N 110 FMN "C4'" "O4'" sing N N 111 FMN "C4'" "C5'" sing N N 112 FMN "C4'" "H4'" sing N N 113 FMN "O4'" "HO4'" sing N N 114 FMN "C5'" "O5'" sing N N 115 FMN "C5'" "H5'1" sing N N 116 FMN "C5'" "H5'2" sing N N 117 FMN "O5'" P sing N N 118 FMN P O1P doub N N 119 FMN P O2P sing N N 120 FMN P O3P sing N N 121 FMN O2P HOP2 sing N N 122 FMN O3P HOP3 sing N N 123 GLN N CA sing N N 124 GLN N H sing N N 125 GLN N H2 sing N N 126 GLN CA C sing N N 127 GLN CA CB sing N N 128 GLN CA HA sing N N 129 GLN C O doub N N 130 GLN C OXT sing N N 131 GLN CB CG sing N N 132 GLN CB HB2 sing N N 133 GLN CB HB3 sing N N 134 GLN CG CD sing N N 135 GLN CG HG2 sing N N 136 GLN CG HG3 sing N N 137 GLN CD OE1 doub N N 138 GLN CD NE2 sing N N 139 GLN NE2 HE21 sing N N 140 GLN NE2 HE22 sing N N 141 GLN OXT HXT sing N N 142 GLU N CA sing N N 143 GLU N H sing N N 144 GLU N H2 sing N N 145 GLU CA C sing N N 146 GLU CA CB sing N N 147 GLU CA HA sing N N 148 GLU C O doub N N 149 GLU C OXT sing N N 150 GLU CB CG sing N N 151 GLU CB HB2 sing N N 152 GLU CB HB3 sing N N 153 GLU CG CD sing N N 154 GLU CG HG2 sing N N 155 GLU CG HG3 sing N N 156 GLU CD OE1 doub N N 157 GLU CD OE2 sing N N 158 GLU OE2 HE2 sing N N 159 GLU OXT HXT sing N N 160 GLY N CA sing N N 161 GLY N H sing N N 162 GLY N H2 sing N N 163 GLY CA C sing N N 164 GLY CA HA2 sing N N 165 GLY CA HA3 sing N N 166 GLY C O doub N N 167 GLY C OXT sing N N 168 GLY OXT HXT sing N N 169 HIS N CA sing N N 170 HIS N H sing N N 171 HIS N H2 sing N N 172 HIS CA C sing N N 173 HIS CA CB sing N N 174 HIS CA HA sing N N 175 HIS C O doub N N 176 HIS C OXT sing N N 177 HIS CB CG sing N N 178 HIS CB HB2 sing N N 179 HIS CB HB3 sing N N 180 HIS CG ND1 sing Y N 181 HIS CG CD2 doub Y N 182 HIS ND1 CE1 doub Y N 183 HIS ND1 HD1 sing N N 184 HIS CD2 NE2 sing Y N 185 HIS CD2 HD2 sing N N 186 HIS CE1 NE2 sing Y N 187 HIS CE1 HE1 sing N N 188 HIS NE2 HE2 sing N N 189 HIS OXT HXT sing N N 190 HOH O H1 sing N N 191 HOH O H2 sing N N 192 ILE N CA sing N N 193 ILE N H sing N N 194 ILE N H2 sing N N 195 ILE CA C sing N N 196 ILE CA CB sing N N 197 ILE CA HA sing N N 198 ILE C O doub N N 199 ILE C OXT sing N N 200 ILE CB CG1 sing N N 201 ILE CB CG2 sing N N 202 ILE CB HB sing N N 203 ILE CG1 CD1 sing N N 204 ILE CG1 HG12 sing N N 205 ILE CG1 HG13 sing N N 206 ILE CG2 HG21 sing N N 207 ILE CG2 HG22 sing N N 208 ILE CG2 HG23 sing N N 209 ILE CD1 HD11 sing N N 210 ILE CD1 HD12 sing N N 211 ILE CD1 HD13 sing N N 212 ILE OXT HXT sing N N 213 LEU N CA sing N N 214 LEU N H sing N N 215 LEU N H2 sing N N 216 LEU CA C sing N N 217 LEU CA CB sing N N 218 LEU CA HA sing N N 219 LEU C O doub N N 220 LEU C OXT sing N N 221 LEU CB CG sing N N 222 LEU CB HB2 sing N N 223 LEU CB HB3 sing N N 224 LEU CG CD1 sing N N 225 LEU CG CD2 sing N N 226 LEU CG HG sing N N 227 LEU CD1 HD11 sing N N 228 LEU CD1 HD12 sing N N 229 LEU CD1 HD13 sing N N 230 LEU CD2 HD21 sing N N 231 LEU CD2 HD22 sing N N 232 LEU CD2 HD23 sing N N 233 LEU OXT HXT sing N N 234 LYS N CA sing N N 235 LYS N H sing N N 236 LYS N H2 sing N N 237 LYS CA C sing N N 238 LYS CA CB sing N N 239 LYS CA HA sing N N 240 LYS C O doub N N 241 LYS C OXT sing N N 242 LYS CB CG sing N N 243 LYS CB HB2 sing N N 244 LYS CB HB3 sing N N 245 LYS CG CD sing N N 246 LYS CG HG2 sing N N 247 LYS CG HG3 sing N N 248 LYS CD CE sing N N 249 LYS CD HD2 sing N N 250 LYS CD HD3 sing N N 251 LYS CE NZ sing N N 252 LYS CE HE2 sing N N 253 LYS CE HE3 sing N N 254 LYS NZ HZ1 sing N N 255 LYS NZ HZ2 sing N N 256 LYS NZ HZ3 sing N N 257 LYS OXT HXT sing N N 258 MET N CA sing N N 259 MET N H sing N N 260 MET N H2 sing N N 261 MET CA C sing N N 262 MET CA CB sing N N 263 MET CA HA sing N N 264 MET C O doub N N 265 MET C OXT sing N N 266 MET CB CG sing N N 267 MET CB HB2 sing N N 268 MET CB HB3 sing N N 269 MET CG SD sing N N 270 MET CG HG2 sing N N 271 MET CG HG3 sing N N 272 MET SD CE sing N N 273 MET CE HE1 sing N N 274 MET CE HE2 sing N N 275 MET CE HE3 sing N N 276 MET OXT HXT sing N N 277 PHE N CA sing N N 278 PHE N H sing N N 279 PHE N H2 sing N N 280 PHE CA C sing N N 281 PHE CA CB sing N N 282 PHE CA HA sing N N 283 PHE C O doub N N 284 PHE C OXT sing N N 285 PHE CB CG sing N N 286 PHE CB HB2 sing N N 287 PHE CB HB3 sing N N 288 PHE CG CD1 doub Y N 289 PHE CG CD2 sing Y N 290 PHE CD1 CE1 sing Y N 291 PHE CD1 HD1 sing N N 292 PHE CD2 CE2 doub Y N 293 PHE CD2 HD2 sing N N 294 PHE CE1 CZ doub Y N 295 PHE CE1 HE1 sing N N 296 PHE CE2 CZ sing Y N 297 PHE CE2 HE2 sing N N 298 PHE CZ HZ sing N N 299 PHE OXT HXT sing N N 300 PRO N CA sing N N 301 PRO N CD sing N N 302 PRO N H sing N N 303 PRO CA C sing N N 304 PRO CA CB sing N N 305 PRO CA HA sing N N 306 PRO C O doub N N 307 PRO C OXT sing N N 308 PRO CB CG sing N N 309 PRO CB HB2 sing N N 310 PRO CB HB3 sing N N 311 PRO CG CD sing N N 312 PRO CG HG2 sing N N 313 PRO CG HG3 sing N N 314 PRO CD HD2 sing N N 315 PRO CD HD3 sing N N 316 PRO OXT HXT sing N N 317 SER N CA sing N N 318 SER N H sing N N 319 SER N H2 sing N N 320 SER CA C sing N N 321 SER CA CB sing N N 322 SER CA HA sing N N 323 SER C O doub N N 324 SER C OXT sing N N 325 SER CB OG sing N N 326 SER CB HB2 sing N N 327 SER CB HB3 sing N N 328 SER OG HG sing N N 329 SER OXT HXT sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of Arthritis and Musculoskeletal and Skin Diseases (NIH/NIAMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'Intramural Research' _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FMN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FMN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8VJN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011420 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001368 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.035716 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011647 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_