data_8W1D # _entry.id 8W1D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8W1D pdb_00008w1d 10.2210/pdb8w1d/pdb WWPDB D_1000281638 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-05-29 2 'Structure model' 1 1 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8W1D _pdbx_database_status.recvd_initial_deposition_date 2024-02-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 swlovell@ku.edu Scott Lovell ? 'principal investigator/group leader' 0000-0002-3215-4472 3 mrivera@lsu.edu Mario Rivera ? 'principal investigator/group leader' 0000-0002-5692-5497 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lovell, S.' 1 0000-0002-3215-4472 'Battaile, K.P.' 2 0000-0003-0833-3259 'Rivera, M.' 3 0000-0002-5692-5497 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Front Mol Biosci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2296-889X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 1390745 _citation.page_last 1390745 _citation.title ;Pseudomonas aeruginosa gene PA4880 encodes a Dps-like protein with a Dps fold, bacterioferritin-type ferroxidase centers, and endonuclease activity. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fmolb.2024.1390745 _citation.pdbx_database_id_PubMed 38841187 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rajapaksha, N.' 1 ? primary 'Yao, H.' 2 ? primary 'Cook, A.' 3 ? primary 'Seibold, S.' 4 ? primary 'Liu, L.' 5 ? primary 'Battaile, K.P.' 6 ? primary 'Fontenot, L.' 7 ? primary 'Donnarumma, F.' 8 ? primary 'Lovell, S.' 9 ? primary 'Rivera, M.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DPS-LIKE PROTEIN' 20241.627 1 ? ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 2 ? ? ? ? 3 water nat water 18.015 147 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTTVQLTDVQTLRDRARKNIQEGAVTEGYSADRQTVLRLLNEALATELVCFLRYKRHYFMATGLKASIAAAEFLEHANQE MQHADQLAERIMQLGGEPDFNPRGLEERSHAEYVEGKTLKDMVTENLIAERIAIDSYREIITYLGNDDPTTRRIFEEILA QEEEHADDMADILDDLA ; _entity_poly.pdbx_seq_one_letter_code_can ;MTTVQLTDVQTLRDRARKNIQEGAVTEGYSADRQTVLRLLNEALATELVCFLRYKRHYFMATGLKASIAAAEFLEHANQE MQHADQLAERIMQLGGEPDFNPRGLEERSHAEYVEGKTLKDMVTENLIAERIAIDSYREIITYLGNDDPTTRRIFEEILA QEEEHADDMADILDDLA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 THR n 1 4 VAL n 1 5 GLN n 1 6 LEU n 1 7 THR n 1 8 ASP n 1 9 VAL n 1 10 GLN n 1 11 THR n 1 12 LEU n 1 13 ARG n 1 14 ASP n 1 15 ARG n 1 16 ALA n 1 17 ARG n 1 18 LYS n 1 19 ASN n 1 20 ILE n 1 21 GLN n 1 22 GLU n 1 23 GLY n 1 24 ALA n 1 25 VAL n 1 26 THR n 1 27 GLU n 1 28 GLY n 1 29 TYR n 1 30 SER n 1 31 ALA n 1 32 ASP n 1 33 ARG n 1 34 GLN n 1 35 THR n 1 36 VAL n 1 37 LEU n 1 38 ARG n 1 39 LEU n 1 40 LEU n 1 41 ASN n 1 42 GLU n 1 43 ALA n 1 44 LEU n 1 45 ALA n 1 46 THR n 1 47 GLU n 1 48 LEU n 1 49 VAL n 1 50 CYS n 1 51 PHE n 1 52 LEU n 1 53 ARG n 1 54 TYR n 1 55 LYS n 1 56 ARG n 1 57 HIS n 1 58 TYR n 1 59 PHE n 1 60 MET n 1 61 ALA n 1 62 THR n 1 63 GLY n 1 64 LEU n 1 65 LYS n 1 66 ALA n 1 67 SER n 1 68 ILE n 1 69 ALA n 1 70 ALA n 1 71 ALA n 1 72 GLU n 1 73 PHE n 1 74 LEU n 1 75 GLU n 1 76 HIS n 1 77 ALA n 1 78 ASN n 1 79 GLN n 1 80 GLU n 1 81 MET n 1 82 GLN n 1 83 HIS n 1 84 ALA n 1 85 ASP n 1 86 GLN n 1 87 LEU n 1 88 ALA n 1 89 GLU n 1 90 ARG n 1 91 ILE n 1 92 MET n 1 93 GLN n 1 94 LEU n 1 95 GLY n 1 96 GLY n 1 97 GLU n 1 98 PRO n 1 99 ASP n 1 100 PHE n 1 101 ASN n 1 102 PRO n 1 103 ARG n 1 104 GLY n 1 105 LEU n 1 106 GLU n 1 107 GLU n 1 108 ARG n 1 109 SER n 1 110 HIS n 1 111 ALA n 1 112 GLU n 1 113 TYR n 1 114 VAL n 1 115 GLU n 1 116 GLY n 1 117 LYS n 1 118 THR n 1 119 LEU n 1 120 LYS n 1 121 ASP n 1 122 MET n 1 123 VAL n 1 124 THR n 1 125 GLU n 1 126 ASN n 1 127 LEU n 1 128 ILE n 1 129 ALA n 1 130 GLU n 1 131 ARG n 1 132 ILE n 1 133 ALA n 1 134 ILE n 1 135 ASP n 1 136 SER n 1 137 TYR n 1 138 ARG n 1 139 GLU n 1 140 ILE n 1 141 ILE n 1 142 THR n 1 143 TYR n 1 144 LEU n 1 145 GLY n 1 146 ASN n 1 147 ASP n 1 148 ASP n 1 149 PRO n 1 150 THR n 1 151 THR n 1 152 ARG n 1 153 ARG n 1 154 ILE n 1 155 PHE n 1 156 GLU n 1 157 GLU n 1 158 ILE n 1 159 LEU n 1 160 ALA n 1 161 GLN n 1 162 GLU n 1 163 GLU n 1 164 GLU n 1 165 HIS n 1 166 ALA n 1 167 ASP n 1 168 ASP n 1 169 MET n 1 170 ALA n 1 171 ASP n 1 172 ILE n 1 173 LEU n 1 174 ASP n 1 175 ASP n 1 176 LEU n 1 177 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 177 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PA4880 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa PAO1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 GLN 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 ASP 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 GLN 10 10 ? ? ? A . n A 1 11 THR 11 11 ? ? ? A . n A 1 12 LEU 12 12 ? ? ? A . n A 1 13 ARG 13 13 ? ? ? A . n A 1 14 ASP 14 14 ? ? ? A . n A 1 15 ARG 15 15 ? ? ? A . n A 1 16 ALA 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 LYS 18 18 ? ? ? A . n A 1 19 ASN 19 19 ? ? ? A . n A 1 20 ILE 20 20 ? ? ? A . n A 1 21 GLN 21 21 ? ? ? A . n A 1 22 GLU 22 22 ? ? ? A . n A 1 23 GLY 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 VAL 25 25 ? ? ? A . n A 1 26 THR 26 26 ? ? ? A . n A 1 27 GLU 27 27 ? ? ? A . n A 1 28 GLY 28 28 ? ? ? A . n A 1 29 TYR 29 29 ? ? ? A . n A 1 30 SER 30 30 ? ? ? A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 MET 92 92 92 MET MET A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 TYR 143 143 143 TYR TYR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 MET 169 169 169 MET MET A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ALA 177 177 177 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 201 1 FE2 FE2 A . C 2 FE2 1 202 2 FE2 FE2 A . D 3 HOH 1 301 129 HOH HOH A . D 3 HOH 2 302 140 HOH HOH A . D 3 HOH 3 303 108 HOH HOH A . D 3 HOH 4 304 138 HOH HOH A . D 3 HOH 5 305 96 HOH HOH A . D 3 HOH 6 306 40 HOH HOH A . D 3 HOH 7 307 72 HOH HOH A . D 3 HOH 8 308 32 HOH HOH A . D 3 HOH 9 309 91 HOH HOH A . D 3 HOH 10 310 85 HOH HOH A . D 3 HOH 11 311 92 HOH HOH A . D 3 HOH 12 312 137 HOH HOH A . D 3 HOH 13 313 46 HOH HOH A . D 3 HOH 14 314 89 HOH HOH A . D 3 HOH 15 315 105 HOH HOH A . D 3 HOH 16 316 18 HOH HOH A . D 3 HOH 17 317 11 HOH HOH A . D 3 HOH 18 318 62 HOH HOH A . D 3 HOH 19 319 95 HOH HOH A . D 3 HOH 20 320 103 HOH HOH A . D 3 HOH 21 321 58 HOH HOH A . D 3 HOH 22 322 47 HOH HOH A . D 3 HOH 23 323 93 HOH HOH A . D 3 HOH 24 324 94 HOH HOH A . D 3 HOH 25 325 29 HOH HOH A . D 3 HOH 26 326 24 HOH HOH A . D 3 HOH 27 327 66 HOH HOH A . D 3 HOH 28 328 23 HOH HOH A . D 3 HOH 29 329 13 HOH HOH A . D 3 HOH 30 330 123 HOH HOH A . D 3 HOH 31 331 147 HOH HOH A . D 3 HOH 32 332 127 HOH HOH A . D 3 HOH 33 333 61 HOH HOH A . D 3 HOH 34 334 88 HOH HOH A . D 3 HOH 35 335 78 HOH HOH A . D 3 HOH 36 336 9 HOH HOH A . D 3 HOH 37 337 20 HOH HOH A . D 3 HOH 38 338 33 HOH HOH A . D 3 HOH 39 339 45 HOH HOH A . D 3 HOH 40 340 8 HOH HOH A . D 3 HOH 41 341 21 HOH HOH A . D 3 HOH 42 342 4 HOH HOH A . D 3 HOH 43 343 10 HOH HOH A . D 3 HOH 44 344 116 HOH HOH A . D 3 HOH 45 345 77 HOH HOH A . D 3 HOH 46 346 28 HOH HOH A . D 3 HOH 47 347 17 HOH HOH A . D 3 HOH 48 348 98 HOH HOH A . D 3 HOH 49 349 124 HOH HOH A . D 3 HOH 50 350 49 HOH HOH A . D 3 HOH 51 351 38 HOH HOH A . D 3 HOH 52 352 132 HOH HOH A . D 3 HOH 53 353 134 HOH HOH A . D 3 HOH 54 354 5 HOH HOH A . D 3 HOH 55 355 12 HOH HOH A . D 3 HOH 56 356 44 HOH HOH A . D 3 HOH 57 357 14 HOH HOH A . D 3 HOH 58 358 117 HOH HOH A . D 3 HOH 59 359 56 HOH HOH A . D 3 HOH 60 360 86 HOH HOH A . D 3 HOH 61 361 16 HOH HOH A . D 3 HOH 62 362 35 HOH HOH A . D 3 HOH 63 363 69 HOH HOH A . D 3 HOH 64 364 59 HOH HOH A . D 3 HOH 65 365 6 HOH HOH A . D 3 HOH 66 366 7 HOH HOH A . D 3 HOH 67 367 26 HOH HOH A . D 3 HOH 68 368 75 HOH HOH A . D 3 HOH 69 369 51 HOH HOH A . D 3 HOH 70 370 79 HOH HOH A . D 3 HOH 71 371 27 HOH HOH A . D 3 HOH 72 372 141 HOH HOH A . D 3 HOH 73 373 39 HOH HOH A . D 3 HOH 74 374 67 HOH HOH A . D 3 HOH 75 375 50 HOH HOH A . D 3 HOH 76 376 25 HOH HOH A . D 3 HOH 77 377 30 HOH HOH A . D 3 HOH 78 378 55 HOH HOH A . D 3 HOH 79 379 68 HOH HOH A . D 3 HOH 80 380 144 HOH HOH A . D 3 HOH 81 381 2 HOH HOH A . D 3 HOH 82 382 63 HOH HOH A . D 3 HOH 83 383 64 HOH HOH A . D 3 HOH 84 384 36 HOH HOH A . D 3 HOH 85 385 34 HOH HOH A . D 3 HOH 86 386 19 HOH HOH A . D 3 HOH 87 387 57 HOH HOH A . D 3 HOH 88 388 54 HOH HOH A . D 3 HOH 89 389 60 HOH HOH A . D 3 HOH 90 390 109 HOH HOH A . D 3 HOH 91 391 22 HOH HOH A . D 3 HOH 92 392 102 HOH HOH A . D 3 HOH 93 393 84 HOH HOH A . D 3 HOH 94 394 37 HOH HOH A . D 3 HOH 95 395 31 HOH HOH A . D 3 HOH 96 396 82 HOH HOH A . D 3 HOH 97 397 41 HOH HOH A . D 3 HOH 98 398 114 HOH HOH A . D 3 HOH 99 399 104 HOH HOH A . D 3 HOH 100 400 1 HOH HOH A . D 3 HOH 101 401 81 HOH HOH A . D 3 HOH 102 402 3 HOH HOH A . D 3 HOH 103 403 70 HOH HOH A . D 3 HOH 104 404 15 HOH HOH A . D 3 HOH 105 405 48 HOH HOH A . D 3 HOH 106 406 139 HOH HOH A . D 3 HOH 107 407 52 HOH HOH A . D 3 HOH 108 408 65 HOH HOH A . D 3 HOH 109 409 53 HOH HOH A . D 3 HOH 110 410 71 HOH HOH A . D 3 HOH 111 411 146 HOH HOH A . D 3 HOH 112 412 83 HOH HOH A . D 3 HOH 113 413 80 HOH HOH A . D 3 HOH 114 414 74 HOH HOH A . D 3 HOH 115 415 106 HOH HOH A . D 3 HOH 116 416 130 HOH HOH A . D 3 HOH 117 417 118 HOH HOH A . D 3 HOH 118 418 110 HOH HOH A . D 3 HOH 119 419 100 HOH HOH A . D 3 HOH 120 420 107 HOH HOH A . D 3 HOH 121 421 111 HOH HOH A . D 3 HOH 122 422 119 HOH HOH A . D 3 HOH 123 423 115 HOH HOH A . D 3 HOH 124 424 76 HOH HOH A . D 3 HOH 125 425 131 HOH HOH A . D 3 HOH 126 426 99 HOH HOH A . D 3 HOH 127 427 113 HOH HOH A . D 3 HOH 128 428 121 HOH HOH A . D 3 HOH 129 429 122 HOH HOH A . D 3 HOH 130 430 112 HOH HOH A . D 3 HOH 131 431 90 HOH HOH A . D 3 HOH 132 432 125 HOH HOH A . D 3 HOH 133 433 73 HOH HOH A . D 3 HOH 134 434 135 HOH HOH A . D 3 HOH 135 435 101 HOH HOH A . D 3 HOH 136 436 133 HOH HOH A . D 3 HOH 137 437 97 HOH HOH A . D 3 HOH 138 438 142 HOH HOH A . D 3 HOH 139 439 126 HOH HOH A . D 3 HOH 140 440 136 HOH HOH A . D 3 HOH 141 441 145 HOH HOH A . D 3 HOH 142 442 128 HOH HOH A . D 3 HOH 143 443 43 HOH HOH A . D 3 HOH 144 444 42 HOH HOH A . D 3 HOH 145 445 87 HOH HOH A . D 3 HOH 146 446 143 HOH HOH A . D 3 HOH 147 447 120 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 103 ? CG ? A ARG 103 CG 2 1 Y 1 A ARG 103 ? CD ? A ARG 103 CD 3 1 Y 1 A ARG 103 ? NE ? A ARG 103 NE 4 1 Y 1 A ARG 103 ? CZ ? A ARG 103 CZ 5 1 Y 1 A ARG 103 ? NH1 ? A ARG 103 NH1 6 1 Y 1 A ARG 103 ? NH2 ? A ARG 103 NH2 7 1 Y 1 A GLU 107 ? CD ? A GLU 107 CD 8 1 Y 1 A GLU 107 ? OE1 ? A GLU 107 OE1 9 1 Y 1 A GLU 107 ? OE2 ? A GLU 107 OE2 10 1 Y 1 A ASN 146 ? CG ? A ASN 146 CG 11 1 Y 1 A ASN 146 ? OD1 ? A ASN 146 OD1 12 1 Y 1 A ASN 146 ? ND2 ? A ASN 146 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.18rc4_3812: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXCD ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? ARP/wARP ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 96.97 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8W1D _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.938 _cell.length_a_esd ? _cell.length_b 44.580 _cell.length_b_esd ? _cell.length_c 51.468 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8W1D _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8W1D _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.63 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 24.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Proplex D5: 8% (w/v) PEG 6,000, 100 mM MES pH 6.0, 100 mM MgCl2' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-03-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double Crystal Si 111' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9201 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9201 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8W1D _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.30 _reflns.d_resolution_low 28.76 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 32140 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.91 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.088 _reflns.pdbx_Rpim_I_all 0.027 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 327050 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.083 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.30 _reflns_shell.d_res_low 1.32 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 13991 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1585 _reflns_shell.percent_possible_obs 99.8 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.8 _reflns_shell.pdbx_chi_squared 0.76 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.5 _reflns_shell.pdbx_Rrim_I_all 1.253 _reflns_shell.pdbx_Rpim_I_all 0.419 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.824 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.180 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8W1D _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.30 _refine.ls_d_res_low 28.76 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 32096 _refine.ls_number_reflns_R_free 1559 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.86 _refine.ls_percent_reflns_R_free 4.86 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1468 _refine.ls_R_factor_R_free 0.1790 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1451 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.03 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.99 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.13 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.30 _refine_hist.d_res_low 28.76 _refine_hist.number_atoms_solvent 147 _refine_hist.number_atoms_total 1320 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1171 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1193 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.922 ? 1614 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.936 ? 450 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.056 ? 182 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 216 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.30 1.34 . . 124 2758 100.00 . . . . 0.2176 . . . . . . . . . . . 0.2674 'X-RAY DIFFRACTION' 1.34 1.39 . . 160 2737 100.00 . . . . 0.1882 . . . . . . . . . . . 0.2206 'X-RAY DIFFRACTION' 1.39 1.45 . . 147 2752 100.00 . . . . 0.1658 . . . . . . . . . . . 0.1927 'X-RAY DIFFRACTION' 1.45 1.51 . . 149 2765 100.00 . . . . 0.1331 . . . . . . . . . . . 0.1807 'X-RAY DIFFRACTION' 1.51 1.59 . . 130 2773 100.00 . . . . 0.1172 . . . . . . . . . . . 0.1812 'X-RAY DIFFRACTION' 1.59 1.69 . . 132 2764 100.00 . . . . 0.1195 . . . . . . . . . . . 0.1787 'X-RAY DIFFRACTION' 1.69 1.82 . . 152 2782 100.00 . . . . 0.1267 . . . . . . . . . . . 0.1819 'X-RAY DIFFRACTION' 1.82 2.00 . . 139 2773 100.00 . . . . 0.1278 . . . . . . . . . . . 0.1666 'X-RAY DIFFRACTION' 2.00 2.29 . . 140 2785 100.00 . . . . 0.1256 . . . . . . . . . . . 0.1588 'X-RAY DIFFRACTION' 2.29 2.89 . . 139 2796 100.00 . . . . 0.1511 . . . . . . . . . . . 0.1649 'X-RAY DIFFRACTION' 2.89 28.76 . . 147 2852 100.00 . . . . 0.1553 . . . . . . . . . . . 0.1861 # _struct.entry_id 8W1D _struct.title 'CRYSTAL STRUCTURE OF DPS-LIKE PROTEIN PA4880 FROM PSEUDOMONAS AERUGINOSA (DIMERIC FORM)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8W1D _struct_keywords.text 'PA4880, DPS protein, metal binding, DNA cleavage, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9HUT3_PSEAE _struct_ref.pdbx_db_accession Q9HUT3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTTVQLTDVQTLRDRARKNIQEGAVTEGYSADRQTVLRLLNEALATELVCFLRYKRHYFMATGLKASIAAAEFLEHANQE MQHADQLAERIMQLGGEPDFNPRGLEERSHAEYVEGKTLKDMVTENLIAERIAIDSYREIITYLGNDDPTTRRIFEEILA QEEEHADDMADILDDLA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8W1D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 177 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HUT3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 177 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 177 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2850 ? 1 MORE -73 ? 1 'SSA (A^2)' 12810 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details '12 mer' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_755 -x+2,y,-z -1.0000000000 0.0000000000 0.0000000000 115.8760000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 32 ? LEU A 64 ? ASP A 32 LEU A 64 1 ? 33 HELX_P HELX_P2 AA2 ALA A 66 ? LEU A 94 ? ALA A 66 LEU A 94 1 ? 29 HELX_P HELX_P3 AA3 GLY A 104 ? SER A 109 ? GLY A 104 SER A 109 1 ? 6 HELX_P HELX_P4 AA4 THR A 118 ? GLY A 145 ? THR A 118 GLY A 145 1 ? 28 HELX_P HELX_P5 AA5 ASP A 148 ? ALA A 177 ? ASP A 148 ALA A 177 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 47 OE1 ? ? ? 1_555 B FE2 . FE ? ? A GLU 47 A FE2 201 1_555 ? ? ? ? ? ? ? 1.917 ? ? metalc2 metalc ? ? A GLU 47 OE2 ? ? ? 1_555 B FE2 . FE ? ? A GLU 47 A FE2 201 1_555 ? ? ? ? ? ? ? 2.389 ? ? metalc3 metalc ? ? A GLU 80 OE1 ? ? ? 1_555 B FE2 . FE ? ? A GLU 80 A FE2 201 1_555 ? ? ? ? ? ? ? 2.102 ? ? metalc4 metalc ? ? A GLU 80 OE2 ? ? ? 1_555 C FE2 . FE ? ? A GLU 80 A FE2 202 1_555 ? ? ? ? ? ? ? 1.917 ? ? metalc5 metalc ? ? A HIS 83 ND1 ? ? ? 1_555 B FE2 . FE ? ? A HIS 83 A FE2 201 1_555 ? ? ? ? ? ? ? 2.013 ? ? metalc6 metalc ? ? A GLU 130 OE1 ? ? ? 1_555 C FE2 . FE ? ? A GLU 130 A FE2 202 1_555 ? ? ? ? ? ? ? 2.124 ? ? metalc7 metalc ? ? A GLU 130 OE2 ? ? ? 1_555 C FE2 . FE ? ? A GLU 130 A FE2 202 1_555 ? ? ? ? ? ? ? 2.367 ? ? metalc8 metalc ? ? A GLU 162 OE2 ? ? ? 1_555 B FE2 . FE ? ? A GLU 162 A FE2 201 1_555 ? ? ? ? ? ? ? 1.891 ? ? metalc9 metalc ? ? A GLU 162 OE1 ? ? ? 1_555 C FE2 . FE ? ? A GLU 162 A FE2 202 1_555 ? ? ? ? ? ? ? 2.011 ? ? metalc10 metalc ? ? A HIS 165 ND1 ? ? ? 1_555 C FE2 . FE ? ? A HIS 165 A FE2 202 1_555 ? ? ? ? ? ? ? 2.059 ? ? metalc11 metalc ? ? B FE2 . FE ? ? ? 1_555 D HOH . O ? ? A FE2 201 A HOH 301 1_555 ? ? ? ? ? ? ? 2.158 ? ? metalc12 metalc ? ? C FE2 . FE ? ? ? 1_555 D HOH . O ? ? A FE2 202 A HOH 305 1_555 ? ? ? ? ? ? ? 2.197 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 47 ? A GLU 47 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE2 ? A GLU 47 ? A GLU 47 ? 1_555 59.2 ? 2 OE1 ? A GLU 47 ? A GLU 47 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 95.0 ? 3 OE2 ? A GLU 47 ? A GLU 47 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 153.9 ? 4 OE1 ? A GLU 47 ? A GLU 47 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 ND1 ? A HIS 83 ? A HIS 83 ? 1_555 110.2 ? 5 OE2 ? A GLU 47 ? A GLU 47 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 ND1 ? A HIS 83 ? A HIS 83 ? 1_555 102.0 ? 6 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 ND1 ? A HIS 83 ? A HIS 83 ? 1_555 90.0 ? 7 OE1 ? A GLU 47 ? A GLU 47 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE2 ? A GLU 162 ? A GLU 162 ? 1_555 127.8 ? 8 OE2 ? A GLU 47 ? A GLU 47 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE2 ? A GLU 162 ? A GLU 162 ? 1_555 82.8 ? 9 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE2 ? A GLU 162 ? A GLU 162 ? 1_555 114.3 ? 10 ND1 ? A HIS 83 ? A HIS 83 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE2 ? A GLU 162 ? A GLU 162 ? 1_555 111.8 ? 11 OE1 ? A GLU 47 ? A GLU 47 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? D HOH . ? A HOH 301 ? 1_555 79.8 ? 12 OE2 ? A GLU 47 ? A GLU 47 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? D HOH . ? A HOH 301 ? 1_555 89.5 ? 13 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? D HOH . ? A HOH 301 ? 1_555 81.4 ? 14 ND1 ? A HIS 83 ? A HIS 83 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? D HOH . ? A HOH 301 ? 1_555 167.5 ? 15 OE2 ? A GLU 162 ? A GLU 162 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? D HOH . ? A HOH 301 ? 1_555 64.4 ? 16 OE2 ? A GLU 80 ? A GLU 80 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 OE1 ? A GLU 130 ? A GLU 130 ? 1_555 130.4 ? 17 OE2 ? A GLU 80 ? A GLU 80 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 OE2 ? A GLU 130 ? A GLU 130 ? 1_555 89.2 ? 18 OE1 ? A GLU 130 ? A GLU 130 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 OE2 ? A GLU 130 ? A GLU 130 ? 1_555 57.2 ? 19 OE2 ? A GLU 80 ? A GLU 80 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 OE1 ? A GLU 162 ? A GLU 162 ? 1_555 120.8 ? 20 OE1 ? A GLU 130 ? A GLU 130 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 OE1 ? A GLU 162 ? A GLU 162 ? 1_555 87.9 ? 21 OE2 ? A GLU 130 ? A GLU 130 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 OE1 ? A GLU 162 ? A GLU 162 ? 1_555 144.8 ? 22 OE2 ? A GLU 80 ? A GLU 80 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 ND1 ? A HIS 165 ? A HIS 165 ? 1_555 106.6 ? 23 OE1 ? A GLU 130 ? A GLU 130 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 ND1 ? A HIS 165 ? A HIS 165 ? 1_555 110.0 ? 24 OE2 ? A GLU 130 ? A GLU 130 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 ND1 ? A HIS 165 ? A HIS 165 ? 1_555 92.6 ? 25 OE1 ? A GLU 162 ? A GLU 162 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 ND1 ? A HIS 165 ? A HIS 165 ? 1_555 95.4 ? 26 OE2 ? A GLU 80 ? A GLU 80 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O ? D HOH . ? A HOH 305 ? 1_555 69.6 ? 27 OE1 ? A GLU 130 ? A GLU 130 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O ? D HOH . ? A HOH 305 ? 1_555 70.9 ? 28 OE2 ? A GLU 130 ? A GLU 130 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O ? D HOH . ? A HOH 305 ? 1_555 83.2 ? 29 OE1 ? A GLU 162 ? A GLU 162 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O ? D HOH . ? A HOH 305 ? 1_555 90.2 ? 30 ND1 ? A HIS 165 ? A HIS 165 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O ? D HOH . ? A HOH 305 ? 1_555 174.3 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 301 ? ? O A HOH 305 ? ? 2.11 2 1 OE2 A GLU 162 ? ? O A HOH 301 ? ? 2.17 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 148 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -151.78 _pdbx_validate_torsion.psi 77.45 # _pdbx_entry_details.entry_id 8W1D _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A GLN 5 ? A GLN 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A ASP 8 ? A ASP 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A GLN 10 ? A GLN 10 11 1 Y 1 A THR 11 ? A THR 11 12 1 Y 1 A LEU 12 ? A LEU 12 13 1 Y 1 A ARG 13 ? A ARG 13 14 1 Y 1 A ASP 14 ? A ASP 14 15 1 Y 1 A ARG 15 ? A ARG 15 16 1 Y 1 A ALA 16 ? A ALA 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A LYS 18 ? A LYS 18 19 1 Y 1 A ASN 19 ? A ASN 19 20 1 Y 1 A ILE 20 ? A ILE 20 21 1 Y 1 A GLN 21 ? A GLN 21 22 1 Y 1 A GLU 22 ? A GLU 22 23 1 Y 1 A GLY 23 ? A GLY 23 24 1 Y 1 A ALA 24 ? A ALA 24 25 1 Y 1 A VAL 25 ? A VAL 25 26 1 Y 1 A THR 26 ? A THR 26 27 1 Y 1 A GLU 27 ? A GLU 27 28 1 Y 1 A GLY 28 ? A GLY 28 29 1 Y 1 A TYR 29 ? A TYR 29 30 1 Y 1 A SER 30 ? A SER 30 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE2 FE FE N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number AI169344 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FE2 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FE2 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code XXXX _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8W1D _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017260 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002111 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022432 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019574 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_