data_8WT0 # _entry.id 8WT0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8WT0 pdb_00008wt0 10.2210/pdb8wt0/pdb WWPDB D_1300041963 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8WT0 _pdbx_database_status.recvd_initial_deposition_date 2023-10-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 4 g87l12w12@163.com Liwei Guo ? 'principal investigator/group leader' 0000-0002-1319-6415 5 chenfurongcfr@163.com Furong Chen ? 'principal investigator/group leader' 0009-0002-4465-8210 6 lucanhua1985@163.com Canhua Lu ? 'principal investigator/group leader' 0000-0002-9165-5138 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chen, F.R.' 1 0009-0002-4465-8210 'Guo, L.W.' 2 0000-0002-1319-6415 'Lu, C.H.' 3 0000-0002-9165-5138 'Jiang, W.J.' 4 0000-0002-8808-7627 'Luo, Z.Q.' 5 0000-0001-8890-6621 'Liu, J.F.' 6 0000-0001-5825-5397 'Zhang, L.Q.' 7 0000-0002-6301-2987 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, F.R.' 1 ? primary 'Guo, L.W.' 2 ? primary 'Lu, C.H.' 3 ? primary 'Jiang, W.J.' 4 ? primary 'Luo, Z.Q.' 5 ? primary 'Liu, J.F.' 6 ? primary 'Zhang, L.Q.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cell filamentation protein Fic' 23366.240 1 ? ? ? ? 2 polymer man 'DUF2559 domain-containing protein' 7225.202 1 ? ? ? ? 3 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226 1 ? ? ? ? 4 non-polymer syn 'D(-)-TARTARIC ACID' 150.087 1 ? ? ? ? 5 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 6 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name fic-1 # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MPDKYGVGEDAYCYPGSTVLRNKLDIHDEATLSEAEQQLSAIAADNVEFSPPPYSLAYLQNIHRILFSDLFEWAGELRTV GMSKQATRFCQPEYMEKEASKIFTAMAAANWFEGMERAELIAAVAEAYSDINVVHPFREGNGRAQRILFEHLIMNAGFEI SWWGIEKDEWIYANIAAYNGVMEPMEQVFEKCIGQAIQAHHHHHH ; ;MPDKYGVGEDAYCYPGSTVLRNKLDIHDEATLSEAEQQLSAIAADNVEFSPPPYSLAYLQNIHRILFSDLFEWAGELRTV GMSKQATRFCQPEYMEKEASKIFTAMAAANWFEGMERAELIAAVAEAYSDINVVHPFREGNGRAQRILFEHLIMNAGFEI SWWGIEKDEWIYANIAAYNGVMEPMEQVFEKCIGQAIQAHHHHHH ; A ? 2 'polypeptide(L)' no no MGNVSLETKKAYAARTRRSNYAASLRLEGFKVTFADGERKMPTREEVLKAFTQTRTHHHHHH MGNVSLETKKAYAARTRRSNYAASLRLEGFKVTFADGERKMPTREEVLKAFTQTRTHHHHHH B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'TETRAETHYLENE GLYCOL' PG4 4 'D(-)-TARTARIC ACID' TAR 5 'MAGNESIUM ION' MG 6 'SULFATE ION' SO4 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 ASP n 1 4 LYS n 1 5 TYR n 1 6 GLY n 1 7 VAL n 1 8 GLY n 1 9 GLU n 1 10 ASP n 1 11 ALA n 1 12 TYR n 1 13 CYS n 1 14 TYR n 1 15 PRO n 1 16 GLY n 1 17 SER n 1 18 THR n 1 19 VAL n 1 20 LEU n 1 21 ARG n 1 22 ASN n 1 23 LYS n 1 24 LEU n 1 25 ASP n 1 26 ILE n 1 27 HIS n 1 28 ASP n 1 29 GLU n 1 30 ALA n 1 31 THR n 1 32 LEU n 1 33 SER n 1 34 GLU n 1 35 ALA n 1 36 GLU n 1 37 GLN n 1 38 GLN n 1 39 LEU n 1 40 SER n 1 41 ALA n 1 42 ILE n 1 43 ALA n 1 44 ALA n 1 45 ASP n 1 46 ASN n 1 47 VAL n 1 48 GLU n 1 49 PHE n 1 50 SER n 1 51 PRO n 1 52 PRO n 1 53 PRO n 1 54 TYR n 1 55 SER n 1 56 LEU n 1 57 ALA n 1 58 TYR n 1 59 LEU n 1 60 GLN n 1 61 ASN n 1 62 ILE n 1 63 HIS n 1 64 ARG n 1 65 ILE n 1 66 LEU n 1 67 PHE n 1 68 SER n 1 69 ASP n 1 70 LEU n 1 71 PHE n 1 72 GLU n 1 73 TRP n 1 74 ALA n 1 75 GLY n 1 76 GLU n 1 77 LEU n 1 78 ARG n 1 79 THR n 1 80 VAL n 1 81 GLY n 1 82 MET n 1 83 SER n 1 84 LYS n 1 85 GLN n 1 86 ALA n 1 87 THR n 1 88 ARG n 1 89 PHE n 1 90 CYS n 1 91 GLN n 1 92 PRO n 1 93 GLU n 1 94 TYR n 1 95 MET n 1 96 GLU n 1 97 LYS n 1 98 GLU n 1 99 ALA n 1 100 SER n 1 101 LYS n 1 102 ILE n 1 103 PHE n 1 104 THR n 1 105 ALA n 1 106 MET n 1 107 ALA n 1 108 ALA n 1 109 ALA n 1 110 ASN n 1 111 TRP n 1 112 PHE n 1 113 GLU n 1 114 GLY n 1 115 MET n 1 116 GLU n 1 117 ARG n 1 118 ALA n 1 119 GLU n 1 120 LEU n 1 121 ILE n 1 122 ALA n 1 123 ALA n 1 124 VAL n 1 125 ALA n 1 126 GLU n 1 127 ALA n 1 128 TYR n 1 129 SER n 1 130 ASP n 1 131 ILE n 1 132 ASN n 1 133 VAL n 1 134 VAL n 1 135 HIS n 1 136 PRO n 1 137 PHE n 1 138 ARG n 1 139 GLU n 1 140 GLY n 1 141 ASN n 1 142 GLY n 1 143 ARG n 1 144 ALA n 1 145 GLN n 1 146 ARG n 1 147 ILE n 1 148 LEU n 1 149 PHE n 1 150 GLU n 1 151 HIS n 1 152 LEU n 1 153 ILE n 1 154 MET n 1 155 ASN n 1 156 ALA n 1 157 GLY n 1 158 PHE n 1 159 GLU n 1 160 ILE n 1 161 SER n 1 162 TRP n 1 163 TRP n 1 164 GLY n 1 165 ILE n 1 166 GLU n 1 167 LYS n 1 168 ASP n 1 169 GLU n 1 170 TRP n 1 171 ILE n 1 172 TYR n 1 173 ALA n 1 174 ASN n 1 175 ILE n 1 176 ALA n 1 177 ALA n 1 178 TYR n 1 179 ASN n 1 180 GLY n 1 181 VAL n 1 182 MET n 1 183 GLU n 1 184 PRO n 1 185 MET n 1 186 GLU n 1 187 GLN n 1 188 VAL n 1 189 PHE n 1 190 GLU n 1 191 LYS n 1 192 CYS n 1 193 ILE n 1 194 GLY n 1 195 GLN n 1 196 ALA n 1 197 ILE n 1 198 GLN n 1 199 ALA n 1 200 HIS n 1 201 HIS n 1 202 HIS n 1 203 HIS n 1 204 HIS n 1 205 HIS n 2 1 MET n 2 2 GLY n 2 3 ASN n 2 4 VAL n 2 5 SER n 2 6 LEU n 2 7 GLU n 2 8 THR n 2 9 LYS n 2 10 LYS n 2 11 ALA n 2 12 TYR n 2 13 ALA n 2 14 ALA n 2 15 ARG n 2 16 THR n 2 17 ARG n 2 18 ARG n 2 19 SER n 2 20 ASN n 2 21 TYR n 2 22 ALA n 2 23 ALA n 2 24 SER n 2 25 LEU n 2 26 ARG n 2 27 LEU n 2 28 GLU n 2 29 GLY n 2 30 PHE n 2 31 LYS n 2 32 VAL n 2 33 THR n 2 34 PHE n 2 35 ALA n 2 36 ASP n 2 37 GLY n 2 38 GLU n 2 39 ARG n 2 40 LYS n 2 41 MET n 2 42 PRO n 2 43 THR n 2 44 ARG n 2 45 GLU n 2 46 GLU n 2 47 VAL n 2 48 LEU n 2 49 LYS n 2 50 ALA n 2 51 PHE n 2 52 THR n 2 53 GLN n 2 54 THR n 2 55 ARG n 2 56 THR n 2 57 HIS n 2 58 HIS n 2 59 HIS n 2 60 HIS n 2 61 HIS n 2 62 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 205 ? ? ? ? ? ? ? ? ? Pseudomonas 286 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 62 ? ? GN234_08370 ? ? ? ? ? ? 'Pseudomonas bijieensis' 2681983 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PG4 non-polymer . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5' 194.226 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 TAR non-polymer . 'D(-)-TARTARIC ACID' ? 'C4 H6 O6' 150.087 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 LYS 4 4 ? ? ? A . n A 1 5 TYR 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 VAL 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 GLU 9 9 ? ? ? A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 SER 83 83 ? ? ? A . n A 1 84 LYS 84 84 ? ? ? A . n A 1 85 GLN 85 85 ? ? ? A . n A 1 86 ALA 86 86 ? ? ? A . n A 1 87 THR 87 87 ? ? ? A . n A 1 88 ARG 88 88 ? ? ? A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 TRP 111 111 111 TRP TRP A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 MET 115 115 115 MET MET A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 MET 154 154 154 MET MET A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 TRP 162 162 162 TRP TRP A . n A 1 163 TRP 163 163 163 TRP TRP A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 ASN 179 179 179 ASN ASN A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 MET 182 182 182 MET MET A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 MET 185 185 185 MET MET A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 CYS 192 192 192 CYS CYS A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 GLN 195 195 195 GLN GLN A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 GLN 198 198 ? ? ? A . n A 1 199 ALA 199 199 ? ? ? A . n A 1 200 HIS 200 200 ? ? ? A . n A 1 201 HIS 201 201 ? ? ? A . n A 1 202 HIS 202 202 ? ? ? A . n A 1 203 HIS 203 203 ? ? ? A . n A 1 204 HIS 204 204 ? ? ? A . n A 1 205 HIS 205 205 ? ? ? A . n B 2 1 MET 1 1 ? ? ? B . n B 2 2 GLY 2 2 ? ? ? B . n B 2 3 ASN 3 3 ? ? ? B . n B 2 4 VAL 4 4 ? ? ? B . n B 2 5 SER 5 5 5 SER SER B . n B 2 6 LEU 6 6 6 LEU LEU B . n B 2 7 GLU 7 7 7 GLU GLU B . n B 2 8 THR 8 8 8 THR THR B . n B 2 9 LYS 9 9 9 LYS LYS B . n B 2 10 LYS 10 10 10 LYS LYS B . n B 2 11 ALA 11 11 11 ALA ALA B . n B 2 12 TYR 12 12 12 TYR TYR B . n B 2 13 ALA 13 13 13 ALA ALA B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 ARG 15 15 15 ARG ARG B . n B 2 16 THR 16 16 16 THR THR B . n B 2 17 ARG 17 17 17 ARG ARG B . n B 2 18 ARG 18 18 18 ARG ARG B . n B 2 19 SER 19 19 19 SER SER B . n B 2 20 ASN 20 20 20 ASN ASN B . n B 2 21 TYR 21 21 21 TYR TYR B . n B 2 22 ALA 22 22 22 ALA ALA B . n B 2 23 ALA 23 23 23 ALA ALA B . n B 2 24 SER 24 24 24 SER SER B . n B 2 25 LEU 25 25 25 LEU LEU B . n B 2 26 ARG 26 26 26 ARG ARG B . n B 2 27 LEU 27 27 27 LEU LEU B . n B 2 28 GLU 28 28 28 GLU GLU B . n B 2 29 GLY 29 29 29 GLY GLY B . n B 2 30 PHE 30 30 30 PHE PHE B . n B 2 31 LYS 31 31 31 LYS LYS B . n B 2 32 VAL 32 32 32 VAL VAL B . n B 2 33 THR 33 33 33 THR THR B . n B 2 34 PHE 34 34 34 PHE PHE B . n B 2 35 ALA 35 35 35 ALA ALA B . n B 2 36 ASP 36 36 36 ASP ASP B . n B 2 37 GLY 37 37 37 GLY GLY B . n B 2 38 GLU 38 38 38 GLU GLU B . n B 2 39 ARG 39 39 39 ARG ARG B . n B 2 40 LYS 40 40 40 LYS LYS B . n B 2 41 MET 41 41 41 MET MET B . n B 2 42 PRO 42 42 42 PRO PRO B . n B 2 43 THR 43 43 43 THR THR B . n B 2 44 ARG 44 44 44 ARG ARG B . n B 2 45 GLU 45 45 45 GLU GLU B . n B 2 46 GLU 46 46 46 GLU GLU B . n B 2 47 VAL 47 47 47 VAL VAL B . n B 2 48 LEU 48 48 ? ? ? B . n B 2 49 LYS 49 49 ? ? ? B . n B 2 50 ALA 50 50 ? ? ? B . n B 2 51 PHE 51 51 ? ? ? B . n B 2 52 THR 52 52 ? ? ? B . n B 2 53 GLN 53 53 ? ? ? B . n B 2 54 THR 54 54 ? ? ? B . n B 2 55 ARG 55 55 ? ? ? B . n B 2 56 THR 56 56 ? ? ? B . n B 2 57 HIS 57 57 ? ? ? B . n B 2 58 HIS 58 58 ? ? ? B . n B 2 59 HIS 59 59 ? ? ? B . n B 2 60 HIS 60 60 ? ? ? B . n B 2 61 HIS 61 61 ? ? ? B . n B 2 62 HIS 62 62 ? ? ? B . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 MG ? ? MG ? ? 'SUBJECT OF INVESTIGATION' ? 2 PG4 ? ? PG4 ? ? 'SUBJECT OF INVESTIGATION' ? 3 SO4 ? ? SO4 ? ? 'SUBJECT OF INVESTIGATION' ? 4 TAR ? ? TAR ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 PG4 1 301 201 PG4 PG4 A . D 4 TAR 1 302 301 TAR TAR A . E 5 MG 1 303 401 MG MG A . F 6 SO4 1 304 1 SO4 SO4 A . G 6 SO4 1 305 2 SO4 SO4 A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 8WT0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 107.026 _cell.length_a_esd ? _cell.length_b 107.026 _cell.length_b_esd ? _cell.length_c 113.529 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8WT0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8WT0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.07 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.5 M Li2SO4, 0.1M MES pH 5.6, 0.01 M MgCl2' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-10-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8WT0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 48.41 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13820 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.65 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.02 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1071 _reflns.pdbx_Rpim_I_all 0.02439 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1042 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.589 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.07 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1324 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.221 _reflns_shell.pdbx_Rpim_I_all 0.2808 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.967 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.40 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.187 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8WT0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5 _refine.ls_d_res_low 48.41 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13820 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.65 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2685 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2117 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 708 _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1801 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1835 _refine_hist.d_res_high 2.5 _refine_hist.d_res_low 48.41 # _struct.entry_id 8WT0 _struct.title 'The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8WT0 _struct_keywords.text ;Toxin-antitoxin, AMPylation, deAMPylation, Posttranslational Modification, Filamentation, cyclic adenosine monophosphate protein, STRUCTURAL PROTEIN ; _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? G N N 6 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP A0A172JHQ3_PSEFL A0A172JHQ3 ? 1 ;MPDKYGVGEDAYCYPGSTVLRNKLDIHDEATLSEAEQQLSAIAADNVEFSPPPYSLAYLQNIHRILFSDLFEWAGELRTV GMSKQATRFCQPEYMEKEASKIFTAMAAANWFEGMERAELIAAVAEAYSDINVVHPFREGNGRAQRILFEHLIMNAGFEI SWWGIEKDEWIYANIAAYNGVMEPMEQVFEKCIGQAIQA ; 1 2 UNP A0A6N1CBH0_9PSED A0A6N1CBH0 ? 2 MGNVSLETKKAYAARTRRSNYAASLRLEGFKVTFADGERKMPTREEVLKAFTQTRT 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8WT0 A 1 ? 199 ? A0A172JHQ3 1 ? 199 ? 1 199 2 2 8WT0 B 1 ? 56 ? A0A6N1CBH0 1 ? 56 ? 1 56 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8WT0 HIS A 200 ? UNP A0A172JHQ3 ? ? 'expression tag' 200 1 1 8WT0 HIS A 201 ? UNP A0A172JHQ3 ? ? 'expression tag' 201 2 1 8WT0 HIS A 202 ? UNP A0A172JHQ3 ? ? 'expression tag' 202 3 1 8WT0 HIS A 203 ? UNP A0A172JHQ3 ? ? 'expression tag' 203 4 1 8WT0 HIS A 204 ? UNP A0A172JHQ3 ? ? 'expression tag' 204 5 1 8WT0 HIS A 205 ? UNP A0A172JHQ3 ? ? 'expression tag' 205 6 2 8WT0 HIS B 57 ? UNP A0A6N1CBH0 ? ? 'expression tag' 57 7 2 8WT0 HIS B 58 ? UNP A0A6N1CBH0 ? ? 'expression tag' 58 8 2 8WT0 HIS B 59 ? UNP A0A6N1CBH0 ? ? 'expression tag' 59 9 2 8WT0 HIS B 60 ? UNP A0A6N1CBH0 ? ? 'expression tag' 60 10 2 8WT0 HIS B 61 ? UNP A0A6N1CBH0 ? ? 'expression tag' 61 11 2 8WT0 HIS B 62 ? UNP A0A6N1CBH0 ? ? 'expression tag' 62 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4020 ? 1 MORE -61 ? 1 'SSA (A^2)' 10760 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 28 ? ASP A 45 ? ASP A 28 ASP A 45 1 ? 18 HELX_P HELX_P2 AA2 SER A 55 ? SER A 68 ? SER A 55 SER A 68 1 ? 14 HELX_P HELX_P3 AA3 GLN A 91 ? GLU A 93 ? GLN A 91 GLU A 93 5 ? 3 HELX_P HELX_P4 AA4 TYR A 94 ? ALA A 109 ? TYR A 94 ALA A 109 1 ? 16 HELX_P HELX_P5 AA5 ASN A 110 ? GLU A 113 ? ASN A 110 GLU A 113 5 ? 4 HELX_P HELX_P6 AA6 GLU A 116 ? HIS A 135 ? GLU A 116 HIS A 135 1 ? 20 HELX_P HELX_P7 AA7 GLY A 140 ? ALA A 156 ? GLY A 140 ALA A 156 1 ? 17 HELX_P HELX_P8 AA8 TRP A 162 ? ILE A 165 ? TRP A 162 ILE A 165 5 ? 4 HELX_P HELX_P9 AA9 GLU A 166 ? ASN A 179 ? GLU A 166 ASN A 179 1 ? 14 HELX_P HELX_P10 AB1 MET A 182 ? CYS A 192 ? MET A 182 CYS A 192 1 ? 11 HELX_P HELX_P11 AB2 LEU B 6 ? GLU B 28 ? LEU B 6 GLU B 28 1 ? 23 HELX_P HELX_P12 AB3 THR B 33 ? ARG B 39 ? THR B 33 ARG B 39 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 52 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 52 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 53 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 53 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.64 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 158 ? ILE A 160 ? PHE A 158 ILE A 160 AA1 2 ILE A 193 ? ALA A 196 ? ILE A 193 ALA A 196 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 159 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 159 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 195 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 195 # _pdbx_entry_details.entry_id 8WT0 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id B _pdbx_validate_torsion.auth_seq_id 45 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -149.42 _pdbx_validate_torsion.psi 55.00 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A LYS 4 ? A LYS 4 5 1 Y 1 A TYR 5 ? A TYR 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A VAL 7 ? A VAL 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 1 Y 1 A GLU 9 ? A GLU 9 10 1 Y 1 A SER 83 ? A SER 83 11 1 Y 1 A LYS 84 ? A LYS 84 12 1 Y 1 A GLN 85 ? A GLN 85 13 1 Y 1 A ALA 86 ? A ALA 86 14 1 Y 1 A THR 87 ? A THR 87 15 1 Y 1 A ARG 88 ? A ARG 88 16 1 Y 1 A GLN 198 ? A GLN 198 17 1 Y 1 A ALA 199 ? A ALA 199 18 1 Y 1 A HIS 200 ? A HIS 200 19 1 Y 1 A HIS 201 ? A HIS 201 20 1 Y 1 A HIS 202 ? A HIS 202 21 1 Y 1 A HIS 203 ? A HIS 203 22 1 Y 1 A HIS 204 ? A HIS 204 23 1 Y 1 A HIS 205 ? A HIS 205 24 1 Y 1 B MET 1 ? B MET 1 25 1 Y 1 B GLY 2 ? B GLY 2 26 1 Y 1 B ASN 3 ? B ASN 3 27 1 Y 1 B VAL 4 ? B VAL 4 28 1 Y 1 B LEU 48 ? B LEU 48 29 1 Y 1 B LYS 49 ? B LYS 49 30 1 Y 1 B ALA 50 ? B ALA 50 31 1 Y 1 B PHE 51 ? B PHE 51 32 1 Y 1 B THR 52 ? B THR 52 33 1 Y 1 B GLN 53 ? B GLN 53 34 1 Y 1 B THR 54 ? B THR 54 35 1 Y 1 B ARG 55 ? B ARG 55 36 1 Y 1 B THR 56 ? B THR 56 37 1 Y 1 B HIS 57 ? B HIS 57 38 1 Y 1 B HIS 58 ? B HIS 58 39 1 Y 1 B HIS 59 ? B HIS 59 40 1 Y 1 B HIS 60 ? B HIS 60 41 1 Y 1 B HIS 61 ? B HIS 61 42 1 Y 1 B HIS 62 ? B HIS 62 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 MG MG MG N N 247 PG4 O1 O N N 248 PG4 C1 C N N 249 PG4 C2 C N N 250 PG4 O2 O N N 251 PG4 C3 C N N 252 PG4 C4 C N N 253 PG4 O3 O N N 254 PG4 C5 C N N 255 PG4 C6 C N N 256 PG4 O4 O N N 257 PG4 C7 C N N 258 PG4 C8 C N N 259 PG4 O5 O N N 260 PG4 HO1 H N N 261 PG4 H11 H N N 262 PG4 H12 H N N 263 PG4 H21 H N N 264 PG4 H22 H N N 265 PG4 H31 H N N 266 PG4 H32 H N N 267 PG4 H41 H N N 268 PG4 H42 H N N 269 PG4 H51 H N N 270 PG4 H52 H N N 271 PG4 H61 H N N 272 PG4 H62 H N N 273 PG4 H71 H N N 274 PG4 H72 H N N 275 PG4 H81 H N N 276 PG4 H82 H N N 277 PG4 HO5 H N N 278 PHE N N N N 279 PHE CA C N S 280 PHE C C N N 281 PHE O O N N 282 PHE CB C N N 283 PHE CG C Y N 284 PHE CD1 C Y N 285 PHE CD2 C Y N 286 PHE CE1 C Y N 287 PHE CE2 C Y N 288 PHE CZ C Y N 289 PHE OXT O N N 290 PHE H H N N 291 PHE H2 H N N 292 PHE HA H N N 293 PHE HB2 H N N 294 PHE HB3 H N N 295 PHE HD1 H N N 296 PHE HD2 H N N 297 PHE HE1 H N N 298 PHE HE2 H N N 299 PHE HZ H N N 300 PHE HXT H N N 301 PRO N N N N 302 PRO CA C N S 303 PRO C C N N 304 PRO O O N N 305 PRO CB C N N 306 PRO CG C N N 307 PRO CD C N N 308 PRO OXT O N N 309 PRO H H N N 310 PRO HA H N N 311 PRO HB2 H N N 312 PRO HB3 H N N 313 PRO HG2 H N N 314 PRO HG3 H N N 315 PRO HD2 H N N 316 PRO HD3 H N N 317 PRO HXT H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 SO4 S S N N 333 SO4 O1 O N N 334 SO4 O2 O N N 335 SO4 O3 O N N 336 SO4 O4 O N N 337 TAR O1 O N N 338 TAR O11 O N N 339 TAR C1 C N N 340 TAR C2 C N S 341 TAR O2 O N N 342 TAR C3 C N S 343 TAR O3 O N N 344 TAR C4 C N N 345 TAR O4 O N N 346 TAR O41 O N N 347 TAR HO1 H N N 348 TAR H2 H N N 349 TAR HO2 H N N 350 TAR H3 H N N 351 TAR HO3 H N N 352 TAR HO4 H N N 353 THR N N N N 354 THR CA C N S 355 THR C C N N 356 THR O O N N 357 THR CB C N R 358 THR OG1 O N N 359 THR CG2 C N N 360 THR OXT O N N 361 THR H H N N 362 THR H2 H N N 363 THR HA H N N 364 THR HB H N N 365 THR HG1 H N N 366 THR HG21 H N N 367 THR HG22 H N N 368 THR HG23 H N N 369 THR HXT H N N 370 TRP N N N N 371 TRP CA C N S 372 TRP C C N N 373 TRP O O N N 374 TRP CB C N N 375 TRP CG C Y N 376 TRP CD1 C Y N 377 TRP CD2 C Y N 378 TRP NE1 N Y N 379 TRP CE2 C Y N 380 TRP CE3 C Y N 381 TRP CZ2 C Y N 382 TRP CZ3 C Y N 383 TRP CH2 C Y N 384 TRP OXT O N N 385 TRP H H N N 386 TRP H2 H N N 387 TRP HA H N N 388 TRP HB2 H N N 389 TRP HB3 H N N 390 TRP HD1 H N N 391 TRP HE1 H N N 392 TRP HE3 H N N 393 TRP HZ2 H N N 394 TRP HZ3 H N N 395 TRP HH2 H N N 396 TRP HXT H N N 397 TYR N N N N 398 TYR CA C N S 399 TYR C C N N 400 TYR O O N N 401 TYR CB C N N 402 TYR CG C Y N 403 TYR CD1 C Y N 404 TYR CD2 C Y N 405 TYR CE1 C Y N 406 TYR CE2 C Y N 407 TYR CZ C Y N 408 TYR OH O N N 409 TYR OXT O N N 410 TYR H H N N 411 TYR H2 H N N 412 TYR HA H N N 413 TYR HB2 H N N 414 TYR HB3 H N N 415 TYR HD1 H N N 416 TYR HD2 H N N 417 TYR HE1 H N N 418 TYR HE2 H N N 419 TYR HH H N N 420 TYR HXT H N N 421 VAL N N N N 422 VAL CA C N S 423 VAL C C N N 424 VAL O O N N 425 VAL CB C N N 426 VAL CG1 C N N 427 VAL CG2 C N N 428 VAL OXT O N N 429 VAL H H N N 430 VAL H2 H N N 431 VAL HA H N N 432 VAL HB H N N 433 VAL HG11 H N N 434 VAL HG12 H N N 435 VAL HG13 H N N 436 VAL HG21 H N N 437 VAL HG22 H N N 438 VAL HG23 H N N 439 VAL HXT H N N 440 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PG4 O1 C1 sing N N 235 PG4 O1 HO1 sing N N 236 PG4 C1 C2 sing N N 237 PG4 C1 H11 sing N N 238 PG4 C1 H12 sing N N 239 PG4 C2 O2 sing N N 240 PG4 C2 H21 sing N N 241 PG4 C2 H22 sing N N 242 PG4 O2 C3 sing N N 243 PG4 C3 C4 sing N N 244 PG4 C3 H31 sing N N 245 PG4 C3 H32 sing N N 246 PG4 C4 O3 sing N N 247 PG4 C4 H41 sing N N 248 PG4 C4 H42 sing N N 249 PG4 O3 C5 sing N N 250 PG4 C5 C6 sing N N 251 PG4 C5 H51 sing N N 252 PG4 C5 H52 sing N N 253 PG4 C6 O4 sing N N 254 PG4 C6 H61 sing N N 255 PG4 C6 H62 sing N N 256 PG4 O4 C7 sing N N 257 PG4 C7 C8 sing N N 258 PG4 C7 H71 sing N N 259 PG4 C7 H72 sing N N 260 PG4 C8 O5 sing N N 261 PG4 C8 H81 sing N N 262 PG4 C8 H82 sing N N 263 PG4 O5 HO5 sing N N 264 PHE N CA sing N N 265 PHE N H sing N N 266 PHE N H2 sing N N 267 PHE CA C sing N N 268 PHE CA CB sing N N 269 PHE CA HA sing N N 270 PHE C O doub N N 271 PHE C OXT sing N N 272 PHE CB CG sing N N 273 PHE CB HB2 sing N N 274 PHE CB HB3 sing N N 275 PHE CG CD1 doub Y N 276 PHE CG CD2 sing Y N 277 PHE CD1 CE1 sing Y N 278 PHE CD1 HD1 sing N N 279 PHE CD2 CE2 doub Y N 280 PHE CD2 HD2 sing N N 281 PHE CE1 CZ doub Y N 282 PHE CE1 HE1 sing N N 283 PHE CE2 CZ sing Y N 284 PHE CE2 HE2 sing N N 285 PHE CZ HZ sing N N 286 PHE OXT HXT sing N N 287 PRO N CA sing N N 288 PRO N CD sing N N 289 PRO N H sing N N 290 PRO CA C sing N N 291 PRO CA CB sing N N 292 PRO CA HA sing N N 293 PRO C O doub N N 294 PRO C OXT sing N N 295 PRO CB CG sing N N 296 PRO CB HB2 sing N N 297 PRO CB HB3 sing N N 298 PRO CG CD sing N N 299 PRO CG HG2 sing N N 300 PRO CG HG3 sing N N 301 PRO CD HD2 sing N N 302 PRO CD HD3 sing N N 303 PRO OXT HXT sing N N 304 SER N CA sing N N 305 SER N H sing N N 306 SER N H2 sing N N 307 SER CA C sing N N 308 SER CA CB sing N N 309 SER CA HA sing N N 310 SER C O doub N N 311 SER C OXT sing N N 312 SER CB OG sing N N 313 SER CB HB2 sing N N 314 SER CB HB3 sing N N 315 SER OG HG sing N N 316 SER OXT HXT sing N N 317 SO4 S O1 doub N N 318 SO4 S O2 doub N N 319 SO4 S O3 sing N N 320 SO4 S O4 sing N N 321 TAR O1 C1 doub N N 322 TAR O11 C1 sing N N 323 TAR O11 HO1 sing N N 324 TAR C1 C2 sing N N 325 TAR C2 O2 sing N N 326 TAR C2 C3 sing N N 327 TAR C2 H2 sing N N 328 TAR O2 HO2 sing N N 329 TAR C3 O3 sing N N 330 TAR C3 C4 sing N N 331 TAR C3 H3 sing N N 332 TAR O3 HO3 sing N N 333 TAR C4 O4 doub N N 334 TAR C4 O41 sing N N 335 TAR O41 HO4 sing N N 336 THR N CA sing N N 337 THR N H sing N N 338 THR N H2 sing N N 339 THR CA C sing N N 340 THR CA CB sing N N 341 THR CA HA sing N N 342 THR C O doub N N 343 THR C OXT sing N N 344 THR CB OG1 sing N N 345 THR CB CG2 sing N N 346 THR CB HB sing N N 347 THR OG1 HG1 sing N N 348 THR CG2 HG21 sing N N 349 THR CG2 HG22 sing N N 350 THR CG2 HG23 sing N N 351 THR OXT HXT sing N N 352 TRP N CA sing N N 353 TRP N H sing N N 354 TRP N H2 sing N N 355 TRP CA C sing N N 356 TRP CA CB sing N N 357 TRP CA HA sing N N 358 TRP C O doub N N 359 TRP C OXT sing N N 360 TRP CB CG sing N N 361 TRP CB HB2 sing N N 362 TRP CB HB3 sing N N 363 TRP CG CD1 doub Y N 364 TRP CG CD2 sing Y N 365 TRP CD1 NE1 sing Y N 366 TRP CD1 HD1 sing N N 367 TRP CD2 CE2 doub Y N 368 TRP CD2 CE3 sing Y N 369 TRP NE1 CE2 sing Y N 370 TRP NE1 HE1 sing N N 371 TRP CE2 CZ2 sing Y N 372 TRP CE3 CZ3 doub Y N 373 TRP CE3 HE3 sing N N 374 TRP CZ2 CH2 doub Y N 375 TRP CZ2 HZ2 sing N N 376 TRP CZ3 CH2 sing Y N 377 TRP CZ3 HZ3 sing N N 378 TRP CH2 HH2 sing N N 379 TRP OXT HXT sing N N 380 TYR N CA sing N N 381 TYR N H sing N N 382 TYR N H2 sing N N 383 TYR CA C sing N N 384 TYR CA CB sing N N 385 TYR CA HA sing N N 386 TYR C O doub N N 387 TYR C OXT sing N N 388 TYR CB CG sing N N 389 TYR CB HB2 sing N N 390 TYR CB HB3 sing N N 391 TYR CG CD1 doub Y N 392 TYR CG CD2 sing Y N 393 TYR CD1 CE1 sing Y N 394 TYR CD1 HD1 sing N N 395 TYR CD2 CE2 doub Y N 396 TYR CD2 HD2 sing N N 397 TYR CE1 CZ doub Y N 398 TYR CE1 HE1 sing N N 399 TYR CE2 CZ sing Y N 400 TYR CE2 HE2 sing N N 401 TYR CZ OH sing N N 402 TYR OH HH sing N N 403 TYR OXT HXT sing N N 404 VAL N CA sing N N 405 VAL N H sing N N 406 VAL N H2 sing N N 407 VAL CA C sing N N 408 VAL CA CB sing N N 409 VAL CA HA sing N N 410 VAL C O doub N N 411 VAL C OXT sing N N 412 VAL CB CG1 sing N N 413 VAL CB CG2 sing N N 414 VAL CB HB sing N N 415 VAL CG1 HG11 sing N N 416 VAL CG1 HG12 sing N N 417 VAL CG1 HG13 sing N N 418 VAL CG2 HG21 sing N N 419 VAL CG2 HG22 sing N N 420 VAL CG2 HG23 sing N N 421 VAL OXT HXT sing N N 422 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number '31572045, 32272611, 32260702, 31901870' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5JFF _pdbx_initial_refinement_model.details 'Adenylylation control by intra- or intermolecularactive-site obstruction in Fic proteins' # _atom_sites.entry_id 8WT0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.009344 _atom_sites.fract_transf_matrix[1][2] 0.005394 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010789 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008808 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N O S # loop_ # loop_ #