data_8X0N # _entry.id 8X0N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8X0N pdb_00008x0n 10.2210/pdb8x0n/pdb WWPDB D_1300042184 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-11-06 ? 2 'Structure model' 1 1 2024-11-13 ? 3 'Structure model' 1 2 2025-05-07 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8X0N _pdbx_database_status.recvd_initial_deposition_date 2023-11-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email zhangl99@ustc.edu.cn _pdbx_contact_author.name_first Liang _pdbx_contact_author.name_last Zhang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8338-784X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Xu, Z.Y.' 1 0000-0002-6148-0509 'Liu, Y.' 2 ? 'Li, F.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J Mol Cell Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1759-4685 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Phase separation of hnRNPA1 and TERRA regulates telomeric stability.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/jmcb/mjae037 _citation.pdbx_database_id_PubMed 39313323 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, Z.' 1 ? primary 'Liu, Y.' 2 ? primary 'Li, F.' 3 ? primary 'Yang, Y.' 4 ? primary 'Zhang, H.' 5 ? primary 'Meng, F.' 6 ? primary 'Liu, X.' 7 ? primary 'Xie, X.' 8 ? primary 'Chen, X.' 9 ? primary 'Shi, Y.' 10 ? primary 'Zhang, L.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Heterogeneous nuclear ribonucleoprotein A1' 23131.965 1 ? ? ? ? 2 polymer syn ;RNA (5'-R(*UP*UP*AP*GP*GP*GP*UP*UP*AP*GP*GP*G)-3') ; 3909.352 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVD GRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVD KIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRHHHHHH ; ;MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVD GRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVD KIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRHHHHHH ; A ? 2 polyribonucleotide no no UUAGGGUUAGGG UUAGGGUUAGGG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LYS n 1 4 SER n 1 5 GLU n 1 6 SER n 1 7 PRO n 1 8 LYS n 1 9 GLU n 1 10 PRO n 1 11 GLU n 1 12 GLN n 1 13 LEU n 1 14 ARG n 1 15 LYS n 1 16 LEU n 1 17 PHE n 1 18 ILE n 1 19 GLY n 1 20 GLY n 1 21 LEU n 1 22 SER n 1 23 PHE n 1 24 GLU n 1 25 THR n 1 26 THR n 1 27 ASP n 1 28 GLU n 1 29 SER n 1 30 LEU n 1 31 ARG n 1 32 SER n 1 33 HIS n 1 34 PHE n 1 35 GLU n 1 36 GLN n 1 37 TRP n 1 38 GLY n 1 39 THR n 1 40 LEU n 1 41 THR n 1 42 ASP n 1 43 CYS n 1 44 VAL n 1 45 VAL n 1 46 MET n 1 47 ARG n 1 48 ASP n 1 49 PRO n 1 50 ASN n 1 51 THR n 1 52 LYS n 1 53 ARG n 1 54 SER n 1 55 ARG n 1 56 GLY n 1 57 PHE n 1 58 GLY n 1 59 PHE n 1 60 VAL n 1 61 THR n 1 62 TYR n 1 63 ALA n 1 64 THR n 1 65 VAL n 1 66 GLU n 1 67 GLU n 1 68 VAL n 1 69 ASP n 1 70 ALA n 1 71 ALA n 1 72 MET n 1 73 ASN n 1 74 ALA n 1 75 ARG n 1 76 PRO n 1 77 HIS n 1 78 LYS n 1 79 VAL n 1 80 ASP n 1 81 GLY n 1 82 ARG n 1 83 VAL n 1 84 VAL n 1 85 GLU n 1 86 PRO n 1 87 LYS n 1 88 ARG n 1 89 ALA n 1 90 VAL n 1 91 SER n 1 92 ARG n 1 93 GLU n 1 94 ASP n 1 95 SER n 1 96 GLN n 1 97 ARG n 1 98 PRO n 1 99 GLY n 1 100 ALA n 1 101 HIS n 1 102 LEU n 1 103 THR n 1 104 VAL n 1 105 LYS n 1 106 LYS n 1 107 ILE n 1 108 PHE n 1 109 VAL n 1 110 GLY n 1 111 GLY n 1 112 ILE n 1 113 LYS n 1 114 GLU n 1 115 ASP n 1 116 THR n 1 117 GLU n 1 118 GLU n 1 119 HIS n 1 120 HIS n 1 121 LEU n 1 122 ARG n 1 123 ASP n 1 124 TYR n 1 125 PHE n 1 126 GLU n 1 127 GLN n 1 128 TYR n 1 129 GLY n 1 130 LYS n 1 131 ILE n 1 132 GLU n 1 133 VAL n 1 134 ILE n 1 135 GLU n 1 136 ILE n 1 137 MET n 1 138 THR n 1 139 ASP n 1 140 ARG n 1 141 GLY n 1 142 SER n 1 143 GLY n 1 144 LYS n 1 145 LYS n 1 146 ARG n 1 147 GLY n 1 148 PHE n 1 149 ALA n 1 150 PHE n 1 151 VAL n 1 152 THR n 1 153 PHE n 1 154 ASP n 1 155 ASP n 1 156 HIS n 1 157 ASP n 1 158 SER n 1 159 VAL n 1 160 ASP n 1 161 LYS n 1 162 ILE n 1 163 VAL n 1 164 ILE n 1 165 GLN n 1 166 LYS n 1 167 TYR n 1 168 HIS n 1 169 THR n 1 170 VAL n 1 171 ASN n 1 172 GLY n 1 173 HIS n 1 174 ASN n 1 175 CYS n 1 176 GLU n 1 177 VAL n 1 178 ARG n 1 179 LYS n 1 180 ALA n 1 181 LEU n 1 182 SER n 1 183 LYS n 1 184 GLN n 1 185 GLU n 1 186 MET n 1 187 ALA n 1 188 SER n 1 189 ALA n 1 190 SER n 1 191 SER n 1 192 SER n 1 193 GLN n 1 194 ARG n 1 195 GLY n 1 196 ARG n 1 197 HIS n 1 198 HIS n 1 199 HIS n 1 200 HIS n 1 201 HIS n 1 202 HIS n 2 1 U n 2 2 U n 2 3 A n 2 4 G n 2 5 G n 2 6 G n 2 7 U n 2 8 U n 2 9 A n 2 10 G n 2 11 G n 2 12 G n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 202 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HNRNPA1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 12 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 MET 137 137 137 MET MET A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 HIS 156 156 156 HIS HIS A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 HIS 168 168 168 HIS HIS A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 CYS 175 175 175 CYS CYS A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 MET 186 186 186 MET MET A . n A 1 187 ALA 187 187 ? ? ? A . n A 1 188 SER 188 188 ? ? ? A . n A 1 189 ALA 189 189 ? ? ? A . n A 1 190 SER 190 190 ? ? ? A . n A 1 191 SER 191 191 ? ? ? A . n A 1 192 SER 192 192 ? ? ? A . n A 1 193 GLN 193 193 ? ? ? A . n A 1 194 ARG 194 194 ? ? ? A . n A 1 195 GLY 195 195 ? ? ? A . n A 1 196 ARG 196 196 ? ? ? A . n A 1 197 HIS 197 197 ? ? ? A . n A 1 198 HIS 198 198 ? ? ? A . n A 1 199 HIS 199 199 ? ? ? A . n A 1 200 HIS 200 200 ? ? ? A . n A 1 201 HIS 201 201 ? ? ? A . n A 1 202 HIS 202 202 ? ? ? A . n B 2 1 U 1 1 1 U U B . n B 2 2 U 2 2 2 U U B . n B 2 3 A 3 3 3 A A B . n B 2 4 G 4 4 4 G G B . n B 2 5 G 5 5 5 G G B . n B 2 6 G 6 6 6 G G B . n B 2 7 U 7 7 7 U U B . n B 2 8 U 8 8 8 U U B . n B 2 9 A 9 9 9 A A B . n B 2 10 G 10 10 10 G G B . n B 2 11 G 11 11 11 G G B . n B 2 12 G 12 12 12 G G B . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 8 ? CG ? A LYS 8 CG 2 1 Y 1 A LYS 8 ? CD ? A LYS 8 CD 3 1 Y 1 A LYS 8 ? CE ? A LYS 8 CE 4 1 Y 1 A LYS 8 ? NZ ? A LYS 8 NZ 5 1 Y 1 A GLN 96 ? CG ? A GLN 96 CG 6 1 Y 1 A GLN 96 ? CD ? A GLN 96 CD 7 1 Y 1 A GLN 96 ? OE1 ? A GLN 96 OE1 8 1 Y 1 A GLN 96 ? NE2 ? A GLN 96 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8X0N _cell.details ? _cell.formula_units_Z ? _cell.length_a 101.298 _cell.length_a_esd ? _cell.length_b 101.298 _cell.length_b_esd ? _cell.length_c 55.339 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8X0N _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8X0N _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.27 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100mM HEPES, pH7.0, 10% PEG 4000, 10% 2-Propanol' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-09-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8X0N _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.80 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7512 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.976 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.158 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 2.85 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 350 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.735 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.523 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8X0N _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.800 _refine.ls_d_res_low 28.824 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7075 _refine.ls_number_reflns_R_free 548 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.51 _refine.ls_percent_reflns_R_free 7.75 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2385 _refine.ls_R_factor_R_free 0.2897 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2344 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.28 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.39 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1449 _refine_hist.pdbx_number_atoms_nucleic_acid 259 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1708 _refine_hist.d_res_high 2.800 _refine_hist.d_res_low 28.824 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1768 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.458 ? 2439 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 8.116 ? 1033 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.039 ? 271 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 274 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.8005 3.0820 . . 126 1464 87.00 . . . . 0.3132 . . . . . . . . . . . 0.3595 'X-RAY DIFFRACTION' 3.0820 3.5273 . . 140 1638 97.00 . . . . 0.2617 . . . . . . . . . . . 0.3423 'X-RAY DIFFRACTION' 3.5273 4.4414 . . 144 1682 98.00 . . . . 0.2167 . . . . . . . . . . . 0.2813 'X-RAY DIFFRACTION' 4.4414 28.82 . . 138 1743 95.00 . . . . 0.2125 . . . . . . . . . . . 0.2455 # _struct.entry_id 8X0N _struct.title 'The molecular mechanism of hnRNPA1 recognize TERRA RNA.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8X0N _struct_keywords.text 'hnRNPA1, UP1, TERRA, RNA BINDING PROTEIN, RNA BINDING PROTEIN-RNA complex' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN/RNA' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ROA1_HUMAN P09651 ? 1 ;MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVD GRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVD KIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGR ; 1 2 PDB 8X0N 8X0N ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8X0N A 1 ? 196 ? P09651 1 ? 196 ? 1 196 2 2 8X0N B 1 ? 12 ? 8X0N 1 ? 12 ? 1 12 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8X0N HIS A 197 ? UNP P09651 ? ? 'expression tag' 197 1 1 8X0N HIS A 198 ? UNP P09651 ? ? 'expression tag' 198 2 1 8X0N HIS A 199 ? UNP P09651 ? ? 'expression tag' 199 3 1 8X0N HIS A 200 ? UNP P09651 ? ? 'expression tag' 200 4 1 8X0N HIS A 201 ? UNP P09651 ? ? 'expression tag' 201 5 1 8X0N HIS A 202 ? UNP P09651 ? ? 'expression tag' 202 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7340 ? 1 MORE -18 ? 1 'SSA (A^2)' 20370 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -27.6695000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 10 ? ARG A 14 ? PRO A 10 ARG A 14 1 ? 5 HELX_P HELX_P2 AA2 THR A 26 ? GLU A 35 ? THR A 26 GLU A 35 1 ? 10 HELX_P HELX_P3 AA3 GLN A 36 ? GLY A 38 ? GLN A 36 GLY A 38 5 ? 3 HELX_P HELX_P4 AA4 THR A 64 ? ASN A 73 ? THR A 64 ASN A 73 1 ? 10 HELX_P HELX_P5 AA5 GLU A 93 ? ARG A 97 ? GLU A 93 ARG A 97 5 ? 5 HELX_P HELX_P6 AA6 GLU A 117 ? GLU A 126 ? GLU A 117 GLU A 126 1 ? 10 HELX_P HELX_P7 AA7 GLN A 127 ? GLY A 129 ? GLN A 127 GLY A 129 5 ? 3 HELX_P HELX_P8 AA8 ASP A 155 ? ILE A 164 ? ASP A 155 ILE A 164 1 ? 10 HELX_P HELX_P9 AA9 SER A 182 ? MET A 186 ? SER A 182 MET A 186 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 75 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 75 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 76 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 76 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.31 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 40 ? ARG A 47 ? LEU A 40 ARG A 47 AA1 2 SER A 54 ? TYR A 62 ? SER A 54 TYR A 62 AA1 3 LYS A 15 ? GLY A 19 ? LYS A 15 GLY A 19 AA1 4 VAL A 83 ? ARG A 88 ? VAL A 83 ARG A 88 AA1 5 HIS A 77 ? LYS A 78 ? HIS A 77 LYS A 78 AA2 1 ILE A 131 ? THR A 138 ? ILE A 131 THR A 138 AA2 2 LYS A 145 ? PHE A 153 ? LYS A 145 PHE A 153 AA2 3 LYS A 106 ? GLY A 110 ? LYS A 106 GLY A 110 AA2 4 HIS A 173 ? LYS A 179 ? HIS A 173 LYS A 179 AA2 5 TYR A 167 ? VAL A 170 ? TYR A 167 VAL A 170 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 41 ? N THR A 41 O THR A 61 ? O THR A 61 AA1 2 3 O VAL A 60 ? O VAL A 60 N LEU A 16 ? N LEU A 16 AA1 3 4 N PHE A 17 ? N PHE A 17 O LYS A 87 ? O LYS A 87 AA1 4 5 O VAL A 84 ? O VAL A 84 N HIS A 77 ? N HIS A 77 AA2 1 2 N GLU A 132 ? N GLU A 132 O THR A 152 ? O THR A 152 AA2 2 3 O ALA A 149 ? O ALA A 149 N VAL A 109 ? N VAL A 109 AA2 3 4 N PHE A 108 ? N PHE A 108 O ARG A 178 ? O ARG A 178 AA2 4 5 O CYS A 175 ? O CYS A 175 N HIS A 168 ? N HIS A 168 # _pdbx_entry_details.entry_id 8X0N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 52 ? ? 58.91 18.04 2 1 GLU A 93 ? ? -60.46 -70.62 3 1 GLU A 132 ? ? -93.02 -60.29 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -25.5379 26.5740 -0.0841 0.2812 ? -0.0025 ? -0.0044 ? 0.3346 ? -0.0468 ? 0.2187 ? 4.7860 ? 2.8460 ? 0.8892 ? 2.6113 ? 0.3830 ? 0.4272 ? -0.0184 ? -0.1351 ? 0.0660 ? 0.0427 ? -0.0756 ? 0.0663 ? -0.1258 ? 0.0359 ? 0.0705 ? 2 'X-RAY DIFFRACTION' ? refined -8.7139 29.4333 -6.7751 0.5298 ? 0.0479 ? -0.1525 ? 0.4190 ? -0.0030 ? 0.4470 ? 0.7427 ? 0.2945 ? -0.7589 ? 0.5920 ? 0.3772 ? 3.6599 ? 0.4872 ? 0.0938 ? -0.2917 ? 0.1357 ? 0.2139 ? -0.3786 ? 0.4247 ? 0.8652 ? -0.4931 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;(chain 'A' and resid 6 through 186) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;(chain 'B' and resid 1 through 12) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A ALA 187 ? A ALA 187 7 1 Y 1 A SER 188 ? A SER 188 8 1 Y 1 A ALA 189 ? A ALA 189 9 1 Y 1 A SER 190 ? A SER 190 10 1 Y 1 A SER 191 ? A SER 191 11 1 Y 1 A SER 192 ? A SER 192 12 1 Y 1 A GLN 193 ? A GLN 193 13 1 Y 1 A ARG 194 ? A ARG 194 14 1 Y 1 A GLY 195 ? A GLY 195 15 1 Y 1 A ARG 196 ? A ARG 196 16 1 Y 1 A HIS 197 ? A HIS 197 17 1 Y 1 A HIS 198 ? A HIS 198 18 1 Y 1 A HIS 199 ? A HIS 199 19 1 Y 1 A HIS 200 ? A HIS 200 20 1 Y 1 A HIS 201 ? A HIS 201 21 1 Y 1 A HIS 202 ? A HIS 202 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A OP3 O N N 1 A P P N N 2 A OP1 O N N 3 A OP2 O N N 4 A "O5'" O N N 5 A "C5'" C N N 6 A "C4'" C N R 7 A "O4'" O N N 8 A "C3'" C N S 9 A "O3'" O N N 10 A "C2'" C N R 11 A "O2'" O N N 12 A "C1'" C N R 13 A N9 N Y N 14 A C8 C Y N 15 A N7 N Y N 16 A C5 C Y N 17 A C6 C Y N 18 A N6 N N N 19 A N1 N Y N 20 A C2 C Y N 21 A N3 N Y N 22 A C4 C Y N 23 A HOP3 H N N 24 A HOP2 H N N 25 A "H5'" H N N 26 A "H5''" H N N 27 A "H4'" H N N 28 A "H3'" H N N 29 A "HO3'" H N N 30 A "H2'" H N N 31 A "HO2'" H N N 32 A "H1'" H N N 33 A H8 H N N 34 A H61 H N N 35 A H62 H N N 36 A H2 H N N 37 ALA N N N N 38 ALA CA C N S 39 ALA C C N N 40 ALA O O N N 41 ALA CB C N N 42 ALA OXT O N N 43 ALA H H N N 44 ALA H2 H N N 45 ALA HA H N N 46 ALA HB1 H N N 47 ALA HB2 H N N 48 ALA HB3 H N N 49 ALA HXT H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 CYS N N N N 111 CYS CA C N R 112 CYS C C N N 113 CYS O O N N 114 CYS CB C N N 115 CYS SG S N N 116 CYS OXT O N N 117 CYS H H N N 118 CYS H2 H N N 119 CYS HA H N N 120 CYS HB2 H N N 121 CYS HB3 H N N 122 CYS HG H N N 123 CYS HXT H N N 124 G OP3 O N N 125 G P P N N 126 G OP1 O N N 127 G OP2 O N N 128 G "O5'" O N N 129 G "C5'" C N N 130 G "C4'" C N R 131 G "O4'" O N N 132 G "C3'" C N S 133 G "O3'" O N N 134 G "C2'" C N R 135 G "O2'" O N N 136 G "C1'" C N R 137 G N9 N Y N 138 G C8 C Y N 139 G N7 N Y N 140 G C5 C Y N 141 G C6 C N N 142 G O6 O N N 143 G N1 N N N 144 G C2 C N N 145 G N2 N N N 146 G N3 N N N 147 G C4 C Y N 148 G HOP3 H N N 149 G HOP2 H N N 150 G "H5'" H N N 151 G "H5''" H N N 152 G "H4'" H N N 153 G "H3'" H N N 154 G "HO3'" H N N 155 G "H2'" H N N 156 G "HO2'" H N N 157 G "H1'" H N N 158 G H8 H N N 159 G H1 H N N 160 G H21 H N N 161 G H22 H N N 162 GLN N N N N 163 GLN CA C N S 164 GLN C C N N 165 GLN O O N N 166 GLN CB C N N 167 GLN CG C N N 168 GLN CD C N N 169 GLN OE1 O N N 170 GLN NE2 N N N 171 GLN OXT O N N 172 GLN H H N N 173 GLN H2 H N N 174 GLN HA H N N 175 GLN HB2 H N N 176 GLN HB3 H N N 177 GLN HG2 H N N 178 GLN HG3 H N N 179 GLN HE21 H N N 180 GLN HE22 H N N 181 GLN HXT H N N 182 GLU N N N N 183 GLU CA C N S 184 GLU C C N N 185 GLU O O N N 186 GLU CB C N N 187 GLU CG C N N 188 GLU CD C N N 189 GLU OE1 O N N 190 GLU OE2 O N N 191 GLU OXT O N N 192 GLU H H N N 193 GLU H2 H N N 194 GLU HA H N N 195 GLU HB2 H N N 196 GLU HB3 H N N 197 GLU HG2 H N N 198 GLU HG3 H N N 199 GLU HE2 H N N 200 GLU HXT H N N 201 GLY N N N N 202 GLY CA C N N 203 GLY C C N N 204 GLY O O N N 205 GLY OXT O N N 206 GLY H H N N 207 GLY H2 H N N 208 GLY HA2 H N N 209 GLY HA3 H N N 210 GLY HXT H N N 211 HIS N N N N 212 HIS CA C N S 213 HIS C C N N 214 HIS O O N N 215 HIS CB C N N 216 HIS CG C Y N 217 HIS ND1 N Y N 218 HIS CD2 C Y N 219 HIS CE1 C Y N 220 HIS NE2 N Y N 221 HIS OXT O N N 222 HIS H H N N 223 HIS H2 H N N 224 HIS HA H N N 225 HIS HB2 H N N 226 HIS HB3 H N N 227 HIS HD1 H N N 228 HIS HD2 H N N 229 HIS HE1 H N N 230 HIS HE2 H N N 231 HIS HXT H N N 232 ILE N N N N 233 ILE CA C N S 234 ILE C C N N 235 ILE O O N N 236 ILE CB C N S 237 ILE CG1 C N N 238 ILE CG2 C N N 239 ILE CD1 C N N 240 ILE OXT O N N 241 ILE H H N N 242 ILE H2 H N N 243 ILE HA H N N 244 ILE HB H N N 245 ILE HG12 H N N 246 ILE HG13 H N N 247 ILE HG21 H N N 248 ILE HG22 H N N 249 ILE HG23 H N N 250 ILE HD11 H N N 251 ILE HD12 H N N 252 ILE HD13 H N N 253 ILE HXT H N N 254 LEU N N N N 255 LEU CA C N S 256 LEU C C N N 257 LEU O O N N 258 LEU CB C N N 259 LEU CG C N N 260 LEU CD1 C N N 261 LEU CD2 C N N 262 LEU OXT O N N 263 LEU H H N N 264 LEU H2 H N N 265 LEU HA H N N 266 LEU HB2 H N N 267 LEU HB3 H N N 268 LEU HG H N N 269 LEU HD11 H N N 270 LEU HD12 H N N 271 LEU HD13 H N N 272 LEU HD21 H N N 273 LEU HD22 H N N 274 LEU HD23 H N N 275 LEU HXT H N N 276 LYS N N N N 277 LYS CA C N S 278 LYS C C N N 279 LYS O O N N 280 LYS CB C N N 281 LYS CG C N N 282 LYS CD C N N 283 LYS CE C N N 284 LYS NZ N N N 285 LYS OXT O N N 286 LYS H H N N 287 LYS H2 H N N 288 LYS HA H N N 289 LYS HB2 H N N 290 LYS HB3 H N N 291 LYS HG2 H N N 292 LYS HG3 H N N 293 LYS HD2 H N N 294 LYS HD3 H N N 295 LYS HE2 H N N 296 LYS HE3 H N N 297 LYS HZ1 H N N 298 LYS HZ2 H N N 299 LYS HZ3 H N N 300 LYS HXT H N N 301 MET N N N N 302 MET CA C N S 303 MET C C N N 304 MET O O N N 305 MET CB C N N 306 MET CG C N N 307 MET SD S N N 308 MET CE C N N 309 MET OXT O N N 310 MET H H N N 311 MET H2 H N N 312 MET HA H N N 313 MET HB2 H N N 314 MET HB3 H N N 315 MET HG2 H N N 316 MET HG3 H N N 317 MET HE1 H N N 318 MET HE2 H N N 319 MET HE3 H N N 320 MET HXT H N N 321 PHE N N N N 322 PHE CA C N S 323 PHE C C N N 324 PHE O O N N 325 PHE CB C N N 326 PHE CG C Y N 327 PHE CD1 C Y N 328 PHE CD2 C Y N 329 PHE CE1 C Y N 330 PHE CE2 C Y N 331 PHE CZ C Y N 332 PHE OXT O N N 333 PHE H H N N 334 PHE H2 H N N 335 PHE HA H N N 336 PHE HB2 H N N 337 PHE HB3 H N N 338 PHE HD1 H N N 339 PHE HD2 H N N 340 PHE HE1 H N N 341 PHE HE2 H N N 342 PHE HZ H N N 343 PHE HXT H N N 344 PRO N N N N 345 PRO CA C N S 346 PRO C C N N 347 PRO O O N N 348 PRO CB C N N 349 PRO CG C N N 350 PRO CD C N N 351 PRO OXT O N N 352 PRO H H N N 353 PRO HA H N N 354 PRO HB2 H N N 355 PRO HB3 H N N 356 PRO HG2 H N N 357 PRO HG3 H N N 358 PRO HD2 H N N 359 PRO HD3 H N N 360 PRO HXT H N N 361 SER N N N N 362 SER CA C N S 363 SER C C N N 364 SER O O N N 365 SER CB C N N 366 SER OG O N N 367 SER OXT O N N 368 SER H H N N 369 SER H2 H N N 370 SER HA H N N 371 SER HB2 H N N 372 SER HB3 H N N 373 SER HG H N N 374 SER HXT H N N 375 THR N N N N 376 THR CA C N S 377 THR C C N N 378 THR O O N N 379 THR CB C N R 380 THR OG1 O N N 381 THR CG2 C N N 382 THR OXT O N N 383 THR H H N N 384 THR H2 H N N 385 THR HA H N N 386 THR HB H N N 387 THR HG1 H N N 388 THR HG21 H N N 389 THR HG22 H N N 390 THR HG23 H N N 391 THR HXT H N N 392 TRP N N N N 393 TRP CA C N S 394 TRP C C N N 395 TRP O O N N 396 TRP CB C N N 397 TRP CG C Y N 398 TRP CD1 C Y N 399 TRP CD2 C Y N 400 TRP NE1 N Y N 401 TRP CE2 C Y N 402 TRP CE3 C Y N 403 TRP CZ2 C Y N 404 TRP CZ3 C Y N 405 TRP CH2 C Y N 406 TRP OXT O N N 407 TRP H H N N 408 TRP H2 H N N 409 TRP HA H N N 410 TRP HB2 H N N 411 TRP HB3 H N N 412 TRP HD1 H N N 413 TRP HE1 H N N 414 TRP HE3 H N N 415 TRP HZ2 H N N 416 TRP HZ3 H N N 417 TRP HH2 H N N 418 TRP HXT H N N 419 TYR N N N N 420 TYR CA C N S 421 TYR C C N N 422 TYR O O N N 423 TYR CB C N N 424 TYR CG C Y N 425 TYR CD1 C Y N 426 TYR CD2 C Y N 427 TYR CE1 C Y N 428 TYR CE2 C Y N 429 TYR CZ C Y N 430 TYR OH O N N 431 TYR OXT O N N 432 TYR H H N N 433 TYR H2 H N N 434 TYR HA H N N 435 TYR HB2 H N N 436 TYR HB3 H N N 437 TYR HD1 H N N 438 TYR HD2 H N N 439 TYR HE1 H N N 440 TYR HE2 H N N 441 TYR HH H N N 442 TYR HXT H N N 443 U OP3 O N N 444 U P P N N 445 U OP1 O N N 446 U OP2 O N N 447 U "O5'" O N N 448 U "C5'" C N N 449 U "C4'" C N R 450 U "O4'" O N N 451 U "C3'" C N S 452 U "O3'" O N N 453 U "C2'" C N R 454 U "O2'" O N N 455 U "C1'" C N R 456 U N1 N N N 457 U C2 C N N 458 U O2 O N N 459 U N3 N N N 460 U C4 C N N 461 U O4 O N N 462 U C5 C N N 463 U C6 C N N 464 U HOP3 H N N 465 U HOP2 H N N 466 U "H5'" H N N 467 U "H5''" H N N 468 U "H4'" H N N 469 U "H3'" H N N 470 U "HO3'" H N N 471 U "H2'" H N N 472 U "HO2'" H N N 473 U "H1'" H N N 474 U H3 H N N 475 U H5 H N N 476 U H6 H N N 477 VAL N N N N 478 VAL CA C N S 479 VAL C C N N 480 VAL O O N N 481 VAL CB C N N 482 VAL CG1 C N N 483 VAL CG2 C N N 484 VAL OXT O N N 485 VAL H H N N 486 VAL H2 H N N 487 VAL HA H N N 488 VAL HB H N N 489 VAL HG11 H N N 490 VAL HG12 H N N 491 VAL HG13 H N N 492 VAL HG21 H N N 493 VAL HG22 H N N 494 VAL HG23 H N N 495 VAL HXT H N N 496 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A OP3 P sing N N 1 A OP3 HOP3 sing N N 2 A P OP1 doub N N 3 A P OP2 sing N N 4 A P "O5'" sing N N 5 A OP2 HOP2 sing N N 6 A "O5'" "C5'" sing N N 7 A "C5'" "C4'" sing N N 8 A "C5'" "H5'" sing N N 9 A "C5'" "H5''" sing N N 10 A "C4'" "O4'" sing N N 11 A "C4'" "C3'" sing N N 12 A "C4'" "H4'" sing N N 13 A "O4'" "C1'" sing N N 14 A "C3'" "O3'" sing N N 15 A "C3'" "C2'" sing N N 16 A "C3'" "H3'" sing N N 17 A "O3'" "HO3'" sing N N 18 A "C2'" "O2'" sing N N 19 A "C2'" "C1'" sing N N 20 A "C2'" "H2'" sing N N 21 A "O2'" "HO2'" sing N N 22 A "C1'" N9 sing N N 23 A "C1'" "H1'" sing N N 24 A N9 C8 sing Y N 25 A N9 C4 sing Y N 26 A C8 N7 doub Y N 27 A C8 H8 sing N N 28 A N7 C5 sing Y N 29 A C5 C6 sing Y N 30 A C5 C4 doub Y N 31 A C6 N6 sing N N 32 A C6 N1 doub Y N 33 A N6 H61 sing N N 34 A N6 H62 sing N N 35 A N1 C2 sing Y N 36 A C2 N3 doub Y N 37 A C2 H2 sing N N 38 A N3 C4 sing Y N 39 ALA N CA sing N N 40 ALA N H sing N N 41 ALA N H2 sing N N 42 ALA CA C sing N N 43 ALA CA CB sing N N 44 ALA CA HA sing N N 45 ALA C O doub N N 46 ALA C OXT sing N N 47 ALA CB HB1 sing N N 48 ALA CB HB2 sing N N 49 ALA CB HB3 sing N N 50 ALA OXT HXT sing N N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 CYS N CA sing N N 109 CYS N H sing N N 110 CYS N H2 sing N N 111 CYS CA C sing N N 112 CYS CA CB sing N N 113 CYS CA HA sing N N 114 CYS C O doub N N 115 CYS C OXT sing N N 116 CYS CB SG sing N N 117 CYS CB HB2 sing N N 118 CYS CB HB3 sing N N 119 CYS SG HG sing N N 120 CYS OXT HXT sing N N 121 G OP3 P sing N N 122 G OP3 HOP3 sing N N 123 G P OP1 doub N N 124 G P OP2 sing N N 125 G P "O5'" sing N N 126 G OP2 HOP2 sing N N 127 G "O5'" "C5'" sing N N 128 G "C5'" "C4'" sing N N 129 G "C5'" "H5'" sing N N 130 G "C5'" "H5''" sing N N 131 G "C4'" "O4'" sing N N 132 G "C4'" "C3'" sing N N 133 G "C4'" "H4'" sing N N 134 G "O4'" "C1'" sing N N 135 G "C3'" "O3'" sing N N 136 G "C3'" "C2'" sing N N 137 G "C3'" "H3'" sing N N 138 G "O3'" "HO3'" sing N N 139 G "C2'" "O2'" sing N N 140 G "C2'" "C1'" sing N N 141 G "C2'" "H2'" sing N N 142 G "O2'" "HO2'" sing N N 143 G "C1'" N9 sing N N 144 G "C1'" "H1'" sing N N 145 G N9 C8 sing Y N 146 G N9 C4 sing Y N 147 G C8 N7 doub Y N 148 G C8 H8 sing N N 149 G N7 C5 sing Y N 150 G C5 C6 sing N N 151 G C5 C4 doub Y N 152 G C6 O6 doub N N 153 G C6 N1 sing N N 154 G N1 C2 sing N N 155 G N1 H1 sing N N 156 G C2 N2 sing N N 157 G C2 N3 doub N N 158 G N2 H21 sing N N 159 G N2 H22 sing N N 160 G N3 C4 sing N N 161 GLN N CA sing N N 162 GLN N H sing N N 163 GLN N H2 sing N N 164 GLN CA C sing N N 165 GLN CA CB sing N N 166 GLN CA HA sing N N 167 GLN C O doub N N 168 GLN C OXT sing N N 169 GLN CB CG sing N N 170 GLN CB HB2 sing N N 171 GLN CB HB3 sing N N 172 GLN CG CD sing N N 173 GLN CG HG2 sing N N 174 GLN CG HG3 sing N N 175 GLN CD OE1 doub N N 176 GLN CD NE2 sing N N 177 GLN NE2 HE21 sing N N 178 GLN NE2 HE22 sing N N 179 GLN OXT HXT sing N N 180 GLU N CA sing N N 181 GLU N H sing N N 182 GLU N H2 sing N N 183 GLU CA C sing N N 184 GLU CA CB sing N N 185 GLU CA HA sing N N 186 GLU C O doub N N 187 GLU C OXT sing N N 188 GLU CB CG sing N N 189 GLU CB HB2 sing N N 190 GLU CB HB3 sing N N 191 GLU CG CD sing N N 192 GLU CG HG2 sing N N 193 GLU CG HG3 sing N N 194 GLU CD OE1 doub N N 195 GLU CD OE2 sing N N 196 GLU OE2 HE2 sing N N 197 GLU OXT HXT sing N N 198 GLY N CA sing N N 199 GLY N H sing N N 200 GLY N H2 sing N N 201 GLY CA C sing N N 202 GLY CA HA2 sing N N 203 GLY CA HA3 sing N N 204 GLY C O doub N N 205 GLY C OXT sing N N 206 GLY OXT HXT sing N N 207 HIS N CA sing N N 208 HIS N H sing N N 209 HIS N H2 sing N N 210 HIS CA C sing N N 211 HIS CA CB sing N N 212 HIS CA HA sing N N 213 HIS C O doub N N 214 HIS C OXT sing N N 215 HIS CB CG sing N N 216 HIS CB HB2 sing N N 217 HIS CB HB3 sing N N 218 HIS CG ND1 sing Y N 219 HIS CG CD2 doub Y N 220 HIS ND1 CE1 doub Y N 221 HIS ND1 HD1 sing N N 222 HIS CD2 NE2 sing Y N 223 HIS CD2 HD2 sing N N 224 HIS CE1 NE2 sing Y N 225 HIS CE1 HE1 sing N N 226 HIS NE2 HE2 sing N N 227 HIS OXT HXT sing N N 228 ILE N CA sing N N 229 ILE N H sing N N 230 ILE N H2 sing N N 231 ILE CA C sing N N 232 ILE CA CB sing N N 233 ILE CA HA sing N N 234 ILE C O doub N N 235 ILE C OXT sing N N 236 ILE CB CG1 sing N N 237 ILE CB CG2 sing N N 238 ILE CB HB sing N N 239 ILE CG1 CD1 sing N N 240 ILE CG1 HG12 sing N N 241 ILE CG1 HG13 sing N N 242 ILE CG2 HG21 sing N N 243 ILE CG2 HG22 sing N N 244 ILE CG2 HG23 sing N N 245 ILE CD1 HD11 sing N N 246 ILE CD1 HD12 sing N N 247 ILE CD1 HD13 sing N N 248 ILE OXT HXT sing N N 249 LEU N CA sing N N 250 LEU N H sing N N 251 LEU N H2 sing N N 252 LEU CA C sing N N 253 LEU CA CB sing N N 254 LEU CA HA sing N N 255 LEU C O doub N N 256 LEU C OXT sing N N 257 LEU CB CG sing N N 258 LEU CB HB2 sing N N 259 LEU CB HB3 sing N N 260 LEU CG CD1 sing N N 261 LEU CG CD2 sing N N 262 LEU CG HG sing N N 263 LEU CD1 HD11 sing N N 264 LEU CD1 HD12 sing N N 265 LEU CD1 HD13 sing N N 266 LEU CD2 HD21 sing N N 267 LEU CD2 HD22 sing N N 268 LEU CD2 HD23 sing N N 269 LEU OXT HXT sing N N 270 LYS N CA sing N N 271 LYS N H sing N N 272 LYS N H2 sing N N 273 LYS CA C sing N N 274 LYS CA CB sing N N 275 LYS CA HA sing N N 276 LYS C O doub N N 277 LYS C OXT sing N N 278 LYS CB CG sing N N 279 LYS CB HB2 sing N N 280 LYS CB HB3 sing N N 281 LYS CG CD sing N N 282 LYS CG HG2 sing N N 283 LYS CG HG3 sing N N 284 LYS CD CE sing N N 285 LYS CD HD2 sing N N 286 LYS CD HD3 sing N N 287 LYS CE NZ sing N N 288 LYS CE HE2 sing N N 289 LYS CE HE3 sing N N 290 LYS NZ HZ1 sing N N 291 LYS NZ HZ2 sing N N 292 LYS NZ HZ3 sing N N 293 LYS OXT HXT sing N N 294 MET N CA sing N N 295 MET N H sing N N 296 MET N H2 sing N N 297 MET CA C sing N N 298 MET CA CB sing N N 299 MET CA HA sing N N 300 MET C O doub N N 301 MET C OXT sing N N 302 MET CB CG sing N N 303 MET CB HB2 sing N N 304 MET CB HB3 sing N N 305 MET CG SD sing N N 306 MET CG HG2 sing N N 307 MET CG HG3 sing N N 308 MET SD CE sing N N 309 MET CE HE1 sing N N 310 MET CE HE2 sing N N 311 MET CE HE3 sing N N 312 MET OXT HXT sing N N 313 PHE N CA sing N N 314 PHE N H sing N N 315 PHE N H2 sing N N 316 PHE CA C sing N N 317 PHE CA CB sing N N 318 PHE CA HA sing N N 319 PHE C O doub N N 320 PHE C OXT sing N N 321 PHE CB CG sing N N 322 PHE CB HB2 sing N N 323 PHE CB HB3 sing N N 324 PHE CG CD1 doub Y N 325 PHE CG CD2 sing Y N 326 PHE CD1 CE1 sing Y N 327 PHE CD1 HD1 sing N N 328 PHE CD2 CE2 doub Y N 329 PHE CD2 HD2 sing N N 330 PHE CE1 CZ doub Y N 331 PHE CE1 HE1 sing N N 332 PHE CE2 CZ sing Y N 333 PHE CE2 HE2 sing N N 334 PHE CZ HZ sing N N 335 PHE OXT HXT sing N N 336 PRO N CA sing N N 337 PRO N CD sing N N 338 PRO N H sing N N 339 PRO CA C sing N N 340 PRO CA CB sing N N 341 PRO CA HA sing N N 342 PRO C O doub N N 343 PRO C OXT sing N N 344 PRO CB CG sing N N 345 PRO CB HB2 sing N N 346 PRO CB HB3 sing N N 347 PRO CG CD sing N N 348 PRO CG HG2 sing N N 349 PRO CG HG3 sing N N 350 PRO CD HD2 sing N N 351 PRO CD HD3 sing N N 352 PRO OXT HXT sing N N 353 SER N CA sing N N 354 SER N H sing N N 355 SER N H2 sing N N 356 SER CA C sing N N 357 SER CA CB sing N N 358 SER CA HA sing N N 359 SER C O doub N N 360 SER C OXT sing N N 361 SER CB OG sing N N 362 SER CB HB2 sing N N 363 SER CB HB3 sing N N 364 SER OG HG sing N N 365 SER OXT HXT sing N N 366 THR N CA sing N N 367 THR N H sing N N 368 THR N H2 sing N N 369 THR CA C sing N N 370 THR CA CB sing N N 371 THR CA HA sing N N 372 THR C O doub N N 373 THR C OXT sing N N 374 THR CB OG1 sing N N 375 THR CB CG2 sing N N 376 THR CB HB sing N N 377 THR OG1 HG1 sing N N 378 THR CG2 HG21 sing N N 379 THR CG2 HG22 sing N N 380 THR CG2 HG23 sing N N 381 THR OXT HXT sing N N 382 TRP N CA sing N N 383 TRP N H sing N N 384 TRP N H2 sing N N 385 TRP CA C sing N N 386 TRP CA CB sing N N 387 TRP CA HA sing N N 388 TRP C O doub N N 389 TRP C OXT sing N N 390 TRP CB CG sing N N 391 TRP CB HB2 sing N N 392 TRP CB HB3 sing N N 393 TRP CG CD1 doub Y N 394 TRP CG CD2 sing Y N 395 TRP CD1 NE1 sing Y N 396 TRP CD1 HD1 sing N N 397 TRP CD2 CE2 doub Y N 398 TRP CD2 CE3 sing Y N 399 TRP NE1 CE2 sing Y N 400 TRP NE1 HE1 sing N N 401 TRP CE2 CZ2 sing Y N 402 TRP CE3 CZ3 doub Y N 403 TRP CE3 HE3 sing N N 404 TRP CZ2 CH2 doub Y N 405 TRP CZ2 HZ2 sing N N 406 TRP CZ3 CH2 sing Y N 407 TRP CZ3 HZ3 sing N N 408 TRP CH2 HH2 sing N N 409 TRP OXT HXT sing N N 410 TYR N CA sing N N 411 TYR N H sing N N 412 TYR N H2 sing N N 413 TYR CA C sing N N 414 TYR CA CB sing N N 415 TYR CA HA sing N N 416 TYR C O doub N N 417 TYR C OXT sing N N 418 TYR CB CG sing N N 419 TYR CB HB2 sing N N 420 TYR CB HB3 sing N N 421 TYR CG CD1 doub Y N 422 TYR CG CD2 sing Y N 423 TYR CD1 CE1 sing Y N 424 TYR CD1 HD1 sing N N 425 TYR CD2 CE2 doub Y N 426 TYR CD2 HD2 sing N N 427 TYR CE1 CZ doub Y N 428 TYR CE1 HE1 sing N N 429 TYR CE2 CZ sing Y N 430 TYR CE2 HE2 sing N N 431 TYR CZ OH sing N N 432 TYR OH HH sing N N 433 TYR OXT HXT sing N N 434 U OP3 P sing N N 435 U OP3 HOP3 sing N N 436 U P OP1 doub N N 437 U P OP2 sing N N 438 U P "O5'" sing N N 439 U OP2 HOP2 sing N N 440 U "O5'" "C5'" sing N N 441 U "C5'" "C4'" sing N N 442 U "C5'" "H5'" sing N N 443 U "C5'" "H5''" sing N N 444 U "C4'" "O4'" sing N N 445 U "C4'" "C3'" sing N N 446 U "C4'" "H4'" sing N N 447 U "O4'" "C1'" sing N N 448 U "C3'" "O3'" sing N N 449 U "C3'" "C2'" sing N N 450 U "C3'" "H3'" sing N N 451 U "O3'" "HO3'" sing N N 452 U "C2'" "O2'" sing N N 453 U "C2'" "C1'" sing N N 454 U "C2'" "H2'" sing N N 455 U "O2'" "HO2'" sing N N 456 U "C1'" N1 sing N N 457 U "C1'" "H1'" sing N N 458 U N1 C2 sing N N 459 U N1 C6 sing N N 460 U C2 O2 doub N N 461 U C2 N3 sing N N 462 U N3 C4 sing N N 463 U N3 H3 sing N N 464 U C4 O4 doub N N 465 U C4 C5 sing N N 466 U C5 C6 doub N N 467 U C5 H5 sing N N 468 U C6 H6 sing N N 469 VAL N CA sing N N 470 VAL N H sing N N 471 VAL N H2 sing N N 472 VAL CA C sing N N 473 VAL CA CB sing N N 474 VAL CA HA sing N N 475 VAL C O doub N N 476 VAL C OXT sing N N 477 VAL CB CG1 sing N N 478 VAL CB CG2 sing N N 479 VAL CB HB sing N N 480 VAL CG1 HG11 sing N N 481 VAL CG1 HG12 sing N N 482 VAL CG1 HG13 sing N N 483 VAL CG2 HG21 sing N N 484 VAL CG2 HG22 sing N N 485 VAL CG2 HG23 sing N N 486 VAL OXT HXT sing N N 487 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 32090040 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2UP1 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8X0N _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.009872 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009872 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018070 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ # loop_ #