data_8X6J # _entry.id 8X6J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8X6J pdb_00008x6j 10.2210/pdb8x6j/pdb WWPDB D_1300042713 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-11-27 ? 2 'Structure model' 2 0 2025-04-02 ? # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Obsolete ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Author supporting evidence' 4 2 'Structure model' 'Data collection' 5 2 'Structure model' 'Derived calculations' 6 2 'Structure model' 'Non-polymer description' 7 2 'Structure model' Other 8 2 'Structure model' 'Polymer sequence' 9 2 'Structure model' 'Refinement description' 10 2 'Structure model' 'Source and taxonomy' 11 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' atom_sites 3 2 'Structure model' chem_comp 4 2 'Structure model' chem_comp_atom 5 2 'Structure model' chem_comp_bond 6 2 'Structure model' entity 7 2 'Structure model' entity_poly 8 2 'Structure model' entity_poly_seq 9 2 'Structure model' entity_src_gen 10 2 'Structure model' pdbx_contact_author 11 2 'Structure model' pdbx_database_PDB_obs_spr 12 2 'Structure model' pdbx_database_status 13 2 'Structure model' pdbx_entity_instance_feature 14 2 'Structure model' pdbx_entity_nonpoly 15 2 'Structure model' pdbx_entry_details 16 2 'Structure model' pdbx_initial_refinement_model 17 2 'Structure model' pdbx_modification_feature 18 2 'Structure model' pdbx_nonpoly_scheme 19 2 'Structure model' pdbx_poly_seq_scheme 20 2 'Structure model' pdbx_struct_assembly 21 2 'Structure model' pdbx_struct_assembly_prop 22 2 'Structure model' pdbx_struct_mod_residue 23 2 'Structure model' pdbx_struct_oper_list 24 2 'Structure model' pdbx_struct_sheet_hbond 25 2 'Structure model' pdbx_validate_close_contact 26 2 'Structure model' pdbx_validate_planes 27 2 'Structure model' pdbx_validate_symm_contact 28 2 'Structure model' pdbx_validate_torsion 29 2 'Structure model' refine 30 2 'Structure model' refine_hist 31 2 'Structure model' refine_ls_restr 32 2 'Structure model' refine_ls_shell 33 2 'Structure model' struct 34 2 'Structure model' struct_conf 35 2 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_sites.fract_transf_matrix[2][1]' 2 2 'Structure model' '_atom_sites.fract_transf_matrix[3][2]' 3 2 'Structure model' '_chem_comp.formula' 4 2 'Structure model' '_chem_comp.formula_weight' 5 2 'Structure model' '_chem_comp.id' 6 2 'Structure model' '_chem_comp.mon_nstd_flag' 7 2 'Structure model' '_chem_comp.name' 8 2 'Structure model' '_chem_comp.type' 9 2 'Structure model' '_entity.formula_weight' 10 2 'Structure model' '_entity.pdbx_description' 11 2 'Structure model' '_entity.pdbx_number_of_molecules' 12 2 'Structure model' '_entity_poly.nstd_monomer' 13 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 14 2 'Structure model' '_entity_poly_seq.mon_id' 15 2 'Structure model' '_entity_src_gen.gene_src_strain' 16 2 'Structure model' '_pdbx_database_status.status_code' 17 2 'Structure model' '_pdbx_database_status.status_code_sf' 18 2 'Structure model' '_pdbx_entity_nonpoly.comp_id' 19 2 'Structure model' '_pdbx_entity_nonpoly.name' 20 2 'Structure model' '_pdbx_entry_details.has_protein_modification' 21 2 'Structure model' '_pdbx_poly_seq_scheme.mon_id' 22 2 'Structure model' '_pdbx_poly_seq_scheme.pdb_mon_id' 23 2 'Structure model' '_pdbx_struct_assembly.method_details' 24 2 'Structure model' '_pdbx_struct_oper_list.type' 25 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_seq_id' 26 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id' 27 2 'Structure model' '_pdbx_validate_close_contact.dist' 28 2 'Structure model' '_refine.B_iso_mean' 29 2 'Structure model' '_refine.aniso_B[1][1]' 30 2 'Structure model' '_refine.aniso_B[1][3]' 31 2 'Structure model' '_refine.aniso_B[2][2]' 32 2 'Structure model' '_refine.aniso_B[2][3]' 33 2 'Structure model' '_refine.aniso_B[3][3]' 34 2 'Structure model' '_refine.correlation_coeff_Fo_to_Fc' 35 2 'Structure model' '_refine.correlation_coeff_Fo_to_Fc_free' 36 2 'Structure model' '_refine.details' 37 2 'Structure model' '_refine.ls_R_factor_R_free' 38 2 'Structure model' '_refine.ls_R_factor_R_work' 39 2 'Structure model' '_refine.ls_R_factor_all' 40 2 'Structure model' '_refine.ls_R_factor_obs' 41 2 'Structure model' '_refine.ls_d_res_high' 42 2 'Structure model' '_refine.ls_d_res_low' 43 2 'Structure model' '_refine.ls_number_reflns_R_work' 44 2 'Structure model' '_refine.ls_number_reflns_obs' 45 2 'Structure model' '_refine.ls_percent_reflns_R_free' 46 2 'Structure model' '_refine.ls_percent_reflns_obs' 47 2 'Structure model' '_refine.overall_SU_B' 48 2 'Structure model' '_refine.overall_SU_ML' 49 2 'Structure model' '_refine.pdbx_overall_ESU_R' 50 2 'Structure model' '_refine.pdbx_overall_ESU_R_Free' 51 2 'Structure model' '_refine.pdbx_stereochemistry_target_values' 52 2 'Structure model' '_refine.solvent_model_details' 53 2 'Structure model' '_refine_hist.cycle_id' 54 2 'Structure model' '_refine_hist.d_res_high' 55 2 'Structure model' '_refine_hist.d_res_low' 56 2 'Structure model' '_refine_hist.number_atoms_solvent' 57 2 'Structure model' '_refine_hist.number_atoms_total' 58 2 'Structure model' '_refine_hist.pdbx_number_atoms_ligand' 59 2 'Structure model' '_struct.title' 60 2 'Structure model' '_struct_conf.end_auth_comp_id' 61 2 'Structure model' '_struct_conf.end_auth_seq_id' 62 2 'Structure model' '_struct_conf.end_label_comp_id' 63 2 'Structure model' '_struct_conf.end_label_seq_id' 64 2 'Structure model' '_struct_conf.pdbx_PDB_helix_length' # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2025-04-02 _pdbx_database_PDB_obs_spr.pdb_id 9U46 _pdbx_database_PDB_obs_spr.replace_pdb_id 8X6J _pdbx_database_PDB_obs_spr.details 'Authors deceided to obsolete 8X6Jm, cancelling versioning.' # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8X6J _pdbx_database_status.recvd_initial_deposition_date 2023-11-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email hori.hiroyuki.my@ehime-u.ac.jp _pdbx_contact_author.name_first Hiroyuki _pdbx_contact_author.name_last Hori _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4180-8551 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fukumoto, S.' 1 ? 'Hasegawa, T.' 2 ? 'Ototake, M.' 3 ? 'Moriguchi, S.' 4 ? 'Namba, M.' 5 ? 'Yamagamai, R.' 6 ? 'Kawamura, T.' 7 ? 'Hirata, A.' 8 0000-0001-9941-3793 'Hori, H.' 9 0000-0003-4180-8551 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;The X-ray structure of N-terminal catalytic domain of Thermoplasma acidophilum tRNA methyltransferase Trm56 (Ta0931) in complex with S-adenosyl-L-methionine ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fukumoto, S.' 1 ? primary 'Hasegawa, T.' 2 ? primary 'Ototake, M.' 3 ? primary 'Moriguchi, S.' 4 ? primary 'Namba, M.' 5 ? primary 'Yamagamai, R.' 6 ? primary 'Kawamura, T.' 7 ? primary 'Hirata, A.' 8 0000-0001-9941-3793 primary 'Hori, H.' 9 0000-0003-4180-8551 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;tRNA (cytidine(56)-2'-O)-methyltransferase ; 17373.775 1 2.1.1.206 ? ? ? 2 non-polymer syn "5'-DEOXY-5'-METHYLTHIOADENOSINE" 297.334 1 ? ? ? ? 3 water nat water 18.015 53 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;tRNA ribose 2'-O-methyltransferase aTrm56 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MITVLRINHRPYRDKRITTHVALTARAFGASAILVDERDETLENTIRGVISNFGGSFSIKTG(CME)NWIQEFKHFQGIR VHLTMYGRRINDVIDEIRNSGKDVMVLVGSEKVPIEAYEIADYNVSVTNQPISEVSALAIFLDRYFQGKEFEFEF ; _entity_poly.pdbx_seq_one_letter_code_can ;MITVLRINHRPYRDKRITTHVALTARAFGASAILVDERDETLENTIRGVISNFGGSFSIKTGCNWIQEFKHFQGIRVHLT MYGRRINDVIDEIRNSGKDVMVLVGSEKVPIEAYEIADYNVSVTNQPISEVSALAIFLDRYFQGKEFEFEF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "5'-DEOXY-5'-METHYLTHIOADENOSINE" MTA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 THR n 1 4 VAL n 1 5 LEU n 1 6 ARG n 1 7 ILE n 1 8 ASN n 1 9 HIS n 1 10 ARG n 1 11 PRO n 1 12 TYR n 1 13 ARG n 1 14 ASP n 1 15 LYS n 1 16 ARG n 1 17 ILE n 1 18 THR n 1 19 THR n 1 20 HIS n 1 21 VAL n 1 22 ALA n 1 23 LEU n 1 24 THR n 1 25 ALA n 1 26 ARG n 1 27 ALA n 1 28 PHE n 1 29 GLY n 1 30 ALA n 1 31 SER n 1 32 ALA n 1 33 ILE n 1 34 LEU n 1 35 VAL n 1 36 ASP n 1 37 GLU n 1 38 ARG n 1 39 ASP n 1 40 GLU n 1 41 THR n 1 42 LEU n 1 43 GLU n 1 44 ASN n 1 45 THR n 1 46 ILE n 1 47 ARG n 1 48 GLY n 1 49 VAL n 1 50 ILE n 1 51 SER n 1 52 ASN n 1 53 PHE n 1 54 GLY n 1 55 GLY n 1 56 SER n 1 57 PHE n 1 58 SER n 1 59 ILE n 1 60 LYS n 1 61 THR n 1 62 GLY n 1 63 CME n 1 64 ASN n 1 65 TRP n 1 66 ILE n 1 67 GLN n 1 68 GLU n 1 69 PHE n 1 70 LYS n 1 71 HIS n 1 72 PHE n 1 73 GLN n 1 74 GLY n 1 75 ILE n 1 76 ARG n 1 77 VAL n 1 78 HIS n 1 79 LEU n 1 80 THR n 1 81 MET n 1 82 TYR n 1 83 GLY n 1 84 ARG n 1 85 ARG n 1 86 ILE n 1 87 ASN n 1 88 ASP n 1 89 VAL n 1 90 ILE n 1 91 ASP n 1 92 GLU n 1 93 ILE n 1 94 ARG n 1 95 ASN n 1 96 SER n 1 97 GLY n 1 98 LYS n 1 99 ASP n 1 100 VAL n 1 101 MET n 1 102 VAL n 1 103 LEU n 1 104 VAL n 1 105 GLY n 1 106 SER n 1 107 GLU n 1 108 LYS n 1 109 VAL n 1 110 PRO n 1 111 ILE n 1 112 GLU n 1 113 ALA n 1 114 TYR n 1 115 GLU n 1 116 ILE n 1 117 ALA n 1 118 ASP n 1 119 TYR n 1 120 ASN n 1 121 VAL n 1 122 SER n 1 123 VAL n 1 124 THR n 1 125 ASN n 1 126 GLN n 1 127 PRO n 1 128 ILE n 1 129 SER n 1 130 GLU n 1 131 VAL n 1 132 SER n 1 133 ALA n 1 134 LEU n 1 135 ALA n 1 136 ILE n 1 137 PHE n 1 138 LEU n 1 139 ASP n 1 140 ARG n 1 141 TYR n 1 142 PHE n 1 143 GLN n 1 144 GLY n 1 145 LYS n 1 146 GLU n 1 147 PHE n 1 148 GLU n 1 149 PHE n 1 150 GLU n 1 151 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 151 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Ta0931 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 1728' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermoplasma acidophilum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2303 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant Rosetta2 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' ? 'C5 H11 N O3 S2' 197.276 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MTA non-polymer . "5'-DEOXY-5'-METHYLTHIOADENOSINE" ? 'C11 H15 N5 O3 S' 297.334 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 CME 63 63 63 CME CYS A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 PHE 151 151 151 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MTA 1 201 1 MTA SAM A . C 3 HOH 1 301 42 HOH HOH A . C 3 HOH 2 302 41 HOH HOH A . C 3 HOH 3 303 46 HOH HOH A . C 3 HOH 4 304 37 HOH HOH A . C 3 HOH 5 305 17 HOH HOH A . C 3 HOH 6 306 39 HOH HOH A . C 3 HOH 7 307 36 HOH HOH A . C 3 HOH 8 308 22 HOH HOH A . C 3 HOH 9 309 6 HOH HOH A . C 3 HOH 10 310 38 HOH HOH A . C 3 HOH 11 311 18 HOH HOH A . C 3 HOH 12 312 45 HOH HOH A . C 3 HOH 13 313 34 HOH HOH A . C 3 HOH 14 314 4 HOH HOH A . C 3 HOH 15 315 20 HOH HOH A . C 3 HOH 16 316 40 HOH HOH A . C 3 HOH 17 317 2 HOH HOH A . C 3 HOH 18 318 5 HOH HOH A . C 3 HOH 19 319 15 HOH HOH A . C 3 HOH 20 320 11 HOH HOH A . C 3 HOH 21 321 14 HOH HOH A . C 3 HOH 22 322 31 HOH HOH A . C 3 HOH 23 323 1 HOH HOH A . C 3 HOH 24 324 28 HOH HOH A . C 3 HOH 25 325 47 HOH HOH A . C 3 HOH 26 326 10 HOH HOH A . C 3 HOH 27 327 8 HOH HOH A . C 3 HOH 28 328 21 HOH HOH A . C 3 HOH 29 329 24 HOH HOH A . C 3 HOH 30 330 44 HOH HOH A . C 3 HOH 31 331 27 HOH HOH A . C 3 HOH 32 332 35 HOH HOH A . C 3 HOH 33 333 53 HOH HOH A . C 3 HOH 34 334 16 HOH HOH A . C 3 HOH 35 335 9 HOH HOH A . C 3 HOH 36 336 13 HOH HOH A . C 3 HOH 37 337 12 HOH HOH A . C 3 HOH 38 338 30 HOH HOH A . C 3 HOH 39 339 25 HOH HOH A . C 3 HOH 40 340 7 HOH HOH A . C 3 HOH 41 341 32 HOH HOH A . C 3 HOH 42 342 3 HOH HOH A . C 3 HOH 43 343 43 HOH HOH A . C 3 HOH 44 344 26 HOH HOH A . C 3 HOH 45 345 29 HOH HOH A . C 3 HOH 46 346 48 HOH HOH A . C 3 HOH 47 347 19 HOH HOH A . C 3 HOH 48 348 51 HOH HOH A . C 3 HOH 49 349 23 HOH HOH A . C 3 HOH 50 350 50 HOH HOH A . C 3 HOH 51 351 49 HOH HOH A . C 3 HOH 52 352 33 HOH HOH A . C 3 HOH 53 353 52 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0352 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8X6J _cell.details ? _cell.formula_units_Z ? _cell.length_a 46.700 _cell.length_a_esd ? _cell.length_b 71.400 _cell.length_b_esd ? _cell.length_c 86.990 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8X6J _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8X6J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.32 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3350, Bis-Tris' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-02-05 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL41XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL41XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8X6J _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.99 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10269 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.42 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.261 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.25 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.99 2.11 ? ? ? ? ? ? 1618 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.794 ? ? 1 1 0.973 ? ? ? ? 0.7609999999999999 ? ? ? ? ? ? ? ? ? 2.11 2.26 ? ? ? ? ? ? 1539 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.66 ? ? 2 1 0.986 ? ? ? ? 0.632 ? ? ? ? ? ? ? ? ? 2.26 2.44 ? ? ? ? ? ? 1419 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.5670000000000001 ? ? 3 1 0.992 ? ? ? ? 0.544 ? ? ? ? ? ? ? ? ? 2.44 2.67 ? ? ? ? ? ? 1340 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.48 ? ? 4 1 0.9940000000000001 ? ? ? ? 0.46 ? ? ? ? ? ? ? ? ? 2.67 2.98 ? ? ? ? ? ? 1201 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.364 ? ? 5 1 0.996 ? ? ? ? 0.35 ? ? ? ? ? ? ? ? ? 2.98 3.44 ? ? ? ? ? ? 1065 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.253 ? ? 6 1 0.997 ? ? ? ? 0.243 ? ? ? ? ? ? ? ? ? 3.44 4.21 ? ? ? ? ? ? 925 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.171 ? ? 7 1 0.995 ? ? ? ? 0.16399999999999998 ? ? ? ? ? ? ? ? ? 4.21 5.93 ? ? ? ? ? ? 723 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.10300000000000001 ? ? 8 1 0.998 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -0.006 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -0.011 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 0.017 _refine.B_iso_max ? _refine.B_iso_mean 20.454 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.951 _refine.correlation_coeff_Fo_to_Fc_free 0.934 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8X6J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.992 _refine.ls_d_res_low 43.495 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10269 _refine.ls_number_reflns_R_free 514 _refine.ls_number_reflns_R_work 9755 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.757 _refine.ls_percent_reflns_R_free 5.005 _refine.ls_R_factor_all 0.180 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2269 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1774 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2yy8 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.191 _refine.pdbx_overall_ESU_R_Free 0.168 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.864 _refine.overall_SU_ML 0.109 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.992 _refine_hist.d_res_low 43.495 _refine_hist.number_atoms_solvent 53 _refine_hist.number_atoms_total 1295 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1218 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.012 1266 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 1152 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.538 1.639 1709 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.537 1.552 2671 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.975 5.000 150 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 26.882 10.000 12 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.219 10.000 217 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.120 10.000 64 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.070 0.200 191 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1446 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 271 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.236 0.200 254 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.194 0.200 1132 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.185 0.200 648 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.080 0.200 700 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.211 0.200 53 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.006 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.235 0.200 15 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.172 0.200 70 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.218 0.200 13 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 1.860 1.906 603 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.858 1.906 603 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.858 2.847 752 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.856 2.851 753 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.203 2.403 663 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.201 2.406 664 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 4.655 3.426 957 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.652 3.429 958 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.641 28.788 1444 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 6.638 28.782 1444 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.992 2.043 750 . 36 691 96.9333 . 0.210 . . 0.206 . . . . . 0.180 . . . . . 20 . 0.974 0.941 0.301 'X-RAY DIFFRACTION' 2.043 2.099 725 . 37 688 100.0000 . 0.192 . . 0.188 . . . . . 0.165 . . . . . 20 . 0.978 0.948 0.292 'X-RAY DIFFRACTION' 2.099 2.160 710 . 35 675 100.0000 . 0.181 . . 0.180 . . . . . 0.155 . . . . . 20 . 0.979 0.976 0.199 'X-RAY DIFFRACTION' 2.160 2.226 690 . 35 655 100.0000 . 0.179 . . 0.174 . . . . . 0.157 . . . . . 20 . 0.981 0.943 0.303 'X-RAY DIFFRACTION' 2.226 2.299 675 . 33 642 100.0000 . 0.169 . . 0.168 . . . . . 0.152 . . . . . 20 . 0.982 0.981 0.184 'X-RAY DIFFRACTION' 2.299 2.379 644 . 33 611 100.0000 . 0.170 . . 0.168 . . . . . 0.152 . . . . . 20 . 0.982 0.970 0.204 'X-RAY DIFFRACTION' 2.379 2.469 620 . 31 589 100.0000 . 0.178 . . 0.174 . . . . . 0.158 . . . . . 20 . 0.980 0.965 0.238 'X-RAY DIFFRACTION' 2.469 2.569 598 . 30 568 100.0000 . 0.192 . . 0.187 . . . . . 0.172 . . . . . 20 . 0.977 0.947 0.278 'X-RAY DIFFRACTION' 2.569 2.683 581 . 29 552 100.0000 . 0.194 . . 0.190 . . . . . 0.179 . . . . . 20 . 0.979 0.936 0.299 'X-RAY DIFFRACTION' 2.683 2.814 565 . 28 537 100.0000 . 0.176 . . 0.172 . . . . . 0.165 . . . . . 20 . 0.982 0.960 0.241 'X-RAY DIFFRACTION' 2.814 2.965 514 . 26 488 100.0000 . 0.176 . . 0.172 . . . . . 0.168 . . . . . 20 . 0.983 0.965 0.262 'X-RAY DIFFRACTION' 2.965 3.144 512 . 25 486 99.8047 . 0.182 . . 0.179 . . . . . 0.179 . . . . . 20 . 0.983 0.971 0.225 'X-RAY DIFFRACTION' 3.144 3.360 476 . 24 452 100.0000 . 0.198 . . 0.197 . . . . . 0.202 . . . . . 20 . 0.977 0.975 0.218 'X-RAY DIFFRACTION' 3.360 3.627 444 . 22 422 100.0000 . 0.188 . . 0.185 . . . . . 0.198 . . . . . 20 . 0.980 0.967 0.233 'X-RAY DIFFRACTION' 3.627 3.971 414 . 21 393 100.0000 . 0.164 . . 0.162 . . . . . 0.180 . . . . . 20 . 0.985 0.978 0.215 'X-RAY DIFFRACTION' 3.971 4.435 367 . 18 349 100.0000 . 0.162 . . 0.161 . . . . . 0.182 . . . . . 20 . 0.985 0.980 0.173 'X-RAY DIFFRACTION' 4.435 5.112 346 . 17 329 100.0000 . 0.164 . . 0.161 . . . . . 0.191 . . . . . 20 . 0.988 0.984 0.215 'X-RAY DIFFRACTION' 5.112 6.239 285 . 15 270 100.0000 . 0.217 . . 0.216 . . . . . 0.246 . . . . . 20 . 0.981 0.958 0.242 'X-RAY DIFFRACTION' 6.239 8.734 233 . 11 222 100.0000 . 0.164 . . 0.164 . . . . . 0.180 . . . . . 20 . 0.982 0.986 0.165 'X-RAY DIFFRACTION' 8.734 43.495 145 . 8 136 99.3103 . 0.160 . . 0.161 . . . . . 0.198 . . . . . 20 . 0.967 0.950 0.149 # _struct.entry_id 8X6J _struct.title ;The X-ray structure of N-terminal catalytic domain of Thermoplasma acidophilum tRNA methyltransferase Trm56 (Ta0931) in complex with 5'-Methylthioadenosine ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8X6J _struct_keywords.text ;2'-O methylation, SPOUT superfamily, Archaea, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRM56_THEAC _struct_ref.pdbx_db_accession Q9HJN6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MITVLRINHRPYRDKRITTHVALTARAFGASAILVDERDETLENTIRGVISNFGGSFSIKTGCNWIQEFKHFQGIRVHLT MYGRRINDVIDEIRNSGKDVMVLVGSEKVPIEAYEIADYNVSVTNQPISEVSALAIFLDRYFQGKEFEFEF ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8X6J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HJN6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 151 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 151 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0 0.0 0.0 0.0 0.0 1.0 0.0 0.0 0.0 0.0 1.0 0.0 2 'point symmetry operation' 3_655 -x+1,y,-z+1/2 -1.0 0.0 0.0 46.7000000000 0.0 1.0 0.0 0.0 0.0 0.0 -1.0 43.4950000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 14 ? PHE A 28 ? ASP A 14 PHE A 28 1 ? 15 HELX_P HELX_P2 AA2 ASP A 39 ? GLY A 54 ? ASP A 39 GLY A 54 1 ? 16 HELX_P HELX_P3 AA3 ASN A 64 ? PHE A 72 ? ASN A 64 PHE A 72 1 ? 9 HELX_P HELX_P4 AA4 ILE A 86 ? SER A 96 ? ILE A 86 SER A 96 1 ? 11 HELX_P HELX_P5 AA5 PRO A 110 ? ALA A 117 ? PRO A 110 ALA A 117 1 ? 8 HELX_P HELX_P6 AA6 SER A 129 ? PHE A 142 ? SER A 129 PHE A 142 1 ? 14 HELX_P HELX_P7 AA7 GLY A 144 ? PHE A 149 ? GLY A 144 PHE A 149 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLY 62 C ? ? ? 1_555 A CME 63 N ? ? A GLY 62 A CME 63 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A CME 63 C ? ? ? 1_555 A ASN 64 N ? ? A CME 63 A ASN 64 1_555 ? ? ? ? ? ? ? 1.334 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CME _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 63 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id CME _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 63 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id CME _pdbx_modification_feature.type Beta-mercaptoethanol _pdbx_modification_feature.category 'Named protein modification' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 58 ? THR A 61 ? SER A 58 THR A 61 AA1 2 ALA A 32 ? VAL A 35 ? ALA A 32 VAL A 35 AA1 3 ILE A 2 ? ARG A 6 ? ILE A 2 ARG A 6 AA1 4 VAL A 100 ? VAL A 104 ? VAL A 100 VAL A 104 AA1 5 ILE A 75 ? LEU A 79 ? ILE A 75 LEU A 79 AA1 6 TYR A 119 ? SER A 122 ? TYR A 119 SER A 122 AA1 7 ARG A 84 ? ARG A 85 ? ARG A 84 ARG A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 60 ? O LYS A 60 N VAL A 35 ? N VAL A 35 AA1 2 3 O LEU A 34 ? O LEU A 34 N VAL A 4 ? N VAL A 4 AA1 3 4 N LEU A 5 ? N LEU A 5 O VAL A 102 ? O VAL A 102 AA1 4 5 O MET A 101 ? O MET A 101 N VAL A 77 ? N VAL A 77 AA1 5 6 N HIS A 78 ? N HIS A 78 O VAL A 121 ? O VAL A 121 AA1 6 7 O ASN A 120 ? O ASN A 120 N ARG A 84 ? N ARG A 84 # _pdbx_entry_details.entry_id 8X6J _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 76 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OD2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 118 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 13 ? ? -136.43 -41.70 2 1 GLU A 107 ? ? 71.14 -41.31 3 1 THR A 124 ? ? 64.58 160.82 4 1 ILE A 128 ? ? -128.08 -158.32 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 6 ? ? 0.278 'SIDE CHAIN' 2 1 ARG A 10 ? ? 0.105 'SIDE CHAIN' 3 1 ARG A 13 ? ? 0.095 'SIDE CHAIN' 4 1 ARG A 38 ? ? 0.221 'SIDE CHAIN' 5 1 ARG A 76 ? ? 0.083 'SIDE CHAIN' 6 1 ARG A 84 ? ? 0.148 'SIDE CHAIN' # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CME _pdbx_struct_mod_residue.label_seq_id 63 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CME _pdbx_struct_mod_residue.auth_seq_id 63 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CME N N N N 74 CME CA C N R 75 CME CB C N N 76 CME SG S N N 77 CME SD S N N 78 CME CE C N N 79 CME CZ C N N 80 CME OH O N N 81 CME C C N N 82 CME O O N N 83 CME OXT O N N 84 CME H H N N 85 CME H2 H N N 86 CME HA H N N 87 CME HB2 H N N 88 CME HB3 H N N 89 CME HE2 H N N 90 CME HE3 H N N 91 CME HZ2 H N N 92 CME HZ3 H N N 93 CME HH H N N 94 CME HXT H N N 95 GLN N N N N 96 GLN CA C N S 97 GLN C C N N 98 GLN O O N N 99 GLN CB C N N 100 GLN CG C N N 101 GLN CD C N N 102 GLN OE1 O N N 103 GLN NE2 N N N 104 GLN OXT O N N 105 GLN H H N N 106 GLN H2 H N N 107 GLN HA H N N 108 GLN HB2 H N N 109 GLN HB3 H N N 110 GLN HG2 H N N 111 GLN HG3 H N N 112 GLN HE21 H N N 113 GLN HE22 H N N 114 GLN HXT H N N 115 GLU N N N N 116 GLU CA C N S 117 GLU C C N N 118 GLU O O N N 119 GLU CB C N N 120 GLU CG C N N 121 GLU CD C N N 122 GLU OE1 O N N 123 GLU OE2 O N N 124 GLU OXT O N N 125 GLU H H N N 126 GLU H2 H N N 127 GLU HA H N N 128 GLU HB2 H N N 129 GLU HB3 H N N 130 GLU HG2 H N N 131 GLU HG3 H N N 132 GLU HE2 H N N 133 GLU HXT H N N 134 GLY N N N N 135 GLY CA C N N 136 GLY C C N N 137 GLY O O N N 138 GLY OXT O N N 139 GLY H H N N 140 GLY H2 H N N 141 GLY HA2 H N N 142 GLY HA3 H N N 143 GLY HXT H N N 144 HIS N N N N 145 HIS CA C N S 146 HIS C C N N 147 HIS O O N N 148 HIS CB C N N 149 HIS CG C Y N 150 HIS ND1 N Y N 151 HIS CD2 C Y N 152 HIS CE1 C Y N 153 HIS NE2 N Y N 154 HIS OXT O N N 155 HIS H H N N 156 HIS H2 H N N 157 HIS HA H N N 158 HIS HB2 H N N 159 HIS HB3 H N N 160 HIS HD1 H N N 161 HIS HD2 H N N 162 HIS HE1 H N N 163 HIS HE2 H N N 164 HIS HXT H N N 165 HOH O O N N 166 HOH H1 H N N 167 HOH H2 H N N 168 ILE N N N N 169 ILE CA C N S 170 ILE C C N N 171 ILE O O N N 172 ILE CB C N S 173 ILE CG1 C N N 174 ILE CG2 C N N 175 ILE CD1 C N N 176 ILE OXT O N N 177 ILE H H N N 178 ILE H2 H N N 179 ILE HA H N N 180 ILE HB H N N 181 ILE HG12 H N N 182 ILE HG13 H N N 183 ILE HG21 H N N 184 ILE HG22 H N N 185 ILE HG23 H N N 186 ILE HD11 H N N 187 ILE HD12 H N N 188 ILE HD13 H N N 189 ILE HXT H N N 190 LEU N N N N 191 LEU CA C N S 192 LEU C C N N 193 LEU O O N N 194 LEU CB C N N 195 LEU CG C N N 196 LEU CD1 C N N 197 LEU CD2 C N N 198 LEU OXT O N N 199 LEU H H N N 200 LEU H2 H N N 201 LEU HA H N N 202 LEU HB2 H N N 203 LEU HB3 H N N 204 LEU HG H N N 205 LEU HD11 H N N 206 LEU HD12 H N N 207 LEU HD13 H N N 208 LEU HD21 H N N 209 LEU HD22 H N N 210 LEU HD23 H N N 211 LEU HXT H N N 212 LYS N N N N 213 LYS CA C N S 214 LYS C C N N 215 LYS O O N N 216 LYS CB C N N 217 LYS CG C N N 218 LYS CD C N N 219 LYS CE C N N 220 LYS NZ N N N 221 LYS OXT O N N 222 LYS H H N N 223 LYS H2 H N N 224 LYS HA H N N 225 LYS HB2 H N N 226 LYS HB3 H N N 227 LYS HG2 H N N 228 LYS HG3 H N N 229 LYS HD2 H N N 230 LYS HD3 H N N 231 LYS HE2 H N N 232 LYS HE3 H N N 233 LYS HZ1 H N N 234 LYS HZ2 H N N 235 LYS HZ3 H N N 236 LYS HXT H N N 237 MET N N N N 238 MET CA C N S 239 MET C C N N 240 MET O O N N 241 MET CB C N N 242 MET CG C N N 243 MET SD S N N 244 MET CE C N N 245 MET OXT O N N 246 MET H H N N 247 MET H2 H N N 248 MET HA H N N 249 MET HB2 H N N 250 MET HB3 H N N 251 MET HG2 H N N 252 MET HG3 H N N 253 MET HE1 H N N 254 MET HE2 H N N 255 MET HE3 H N N 256 MET HXT H N N 257 MTA CS C N N 258 MTA "S5'" S N N 259 MTA "C5'" C N N 260 MTA "C4'" C N S 261 MTA "O4'" O N N 262 MTA "C2'" C N R 263 MTA "O2'" O N N 264 MTA "C3'" C N S 265 MTA "O3'" O N N 266 MTA "C1'" C N R 267 MTA N9 N Y N 268 MTA C8 C Y N 269 MTA N7 N Y N 270 MTA C5 C Y N 271 MTA C6 C Y N 272 MTA N6 N N N 273 MTA N1 N Y N 274 MTA C2 C Y N 275 MTA N3 N Y N 276 MTA C4 C Y N 277 MTA HCS1 H N N 278 MTA HCS2 H N N 279 MTA HCS3 H N N 280 MTA "H5'1" H N N 281 MTA "H5'2" H N N 282 MTA "H4'" H N N 283 MTA "H2'" H N N 284 MTA "HO2'" H N N 285 MTA "H3'" H N N 286 MTA H3T H N N 287 MTA "H1'" H N N 288 MTA H8 H N N 289 MTA H61 H N N 290 MTA H62 H N N 291 MTA H2 H N N 292 PHE N N N N 293 PHE CA C N S 294 PHE C C N N 295 PHE O O N N 296 PHE CB C N N 297 PHE CG C Y N 298 PHE CD1 C Y N 299 PHE CD2 C Y N 300 PHE CE1 C Y N 301 PHE CE2 C Y N 302 PHE CZ C Y N 303 PHE OXT O N N 304 PHE H H N N 305 PHE H2 H N N 306 PHE HA H N N 307 PHE HB2 H N N 308 PHE HB3 H N N 309 PHE HD1 H N N 310 PHE HD2 H N N 311 PHE HE1 H N N 312 PHE HE2 H N N 313 PHE HZ H N N 314 PHE HXT H N N 315 PRO N N N N 316 PRO CA C N S 317 PRO C C N N 318 PRO O O N N 319 PRO CB C N N 320 PRO CG C N N 321 PRO CD C N N 322 PRO OXT O N N 323 PRO H H N N 324 PRO HA H N N 325 PRO HB2 H N N 326 PRO HB3 H N N 327 PRO HG2 H N N 328 PRO HG3 H N N 329 PRO HD2 H N N 330 PRO HD3 H N N 331 PRO HXT H N N 332 SER N N N N 333 SER CA C N S 334 SER C C N N 335 SER O O N N 336 SER CB C N N 337 SER OG O N N 338 SER OXT O N N 339 SER H H N N 340 SER H2 H N N 341 SER HA H N N 342 SER HB2 H N N 343 SER HB3 H N N 344 SER HG H N N 345 SER HXT H N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TRP N N N N 364 TRP CA C N S 365 TRP C C N N 366 TRP O O N N 367 TRP CB C N N 368 TRP CG C Y N 369 TRP CD1 C Y N 370 TRP CD2 C Y N 371 TRP NE1 N Y N 372 TRP CE2 C Y N 373 TRP CE3 C Y N 374 TRP CZ2 C Y N 375 TRP CZ3 C Y N 376 TRP CH2 C Y N 377 TRP OXT O N N 378 TRP H H N N 379 TRP H2 H N N 380 TRP HA H N N 381 TRP HB2 H N N 382 TRP HB3 H N N 383 TRP HD1 H N N 384 TRP HE1 H N N 385 TRP HE3 H N N 386 TRP HZ2 H N N 387 TRP HZ3 H N N 388 TRP HH2 H N N 389 TRP HXT H N N 390 TYR N N N N 391 TYR CA C N S 392 TYR C C N N 393 TYR O O N N 394 TYR CB C N N 395 TYR CG C Y N 396 TYR CD1 C Y N 397 TYR CD2 C Y N 398 TYR CE1 C Y N 399 TYR CE2 C Y N 400 TYR CZ C Y N 401 TYR OH O N N 402 TYR OXT O N N 403 TYR H H N N 404 TYR H2 H N N 405 TYR HA H N N 406 TYR HB2 H N N 407 TYR HB3 H N N 408 TYR HD1 H N N 409 TYR HD2 H N N 410 TYR HE1 H N N 411 TYR HE2 H N N 412 TYR HH H N N 413 TYR HXT H N N 414 VAL N N N N 415 VAL CA C N S 416 VAL C C N N 417 VAL O O N N 418 VAL CB C N N 419 VAL CG1 C N N 420 VAL CG2 C N N 421 VAL OXT O N N 422 VAL H H N N 423 VAL H2 H N N 424 VAL HA H N N 425 VAL HB H N N 426 VAL HG11 H N N 427 VAL HG12 H N N 428 VAL HG13 H N N 429 VAL HG21 H N N 430 VAL HG22 H N N 431 VAL HG23 H N N 432 VAL HXT H N N 433 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CME N CA sing N N 70 CME N H sing N N 71 CME N H2 sing N N 72 CME CA CB sing N N 73 CME CA C sing N N 74 CME CA HA sing N N 75 CME CB SG sing N N 76 CME CB HB2 sing N N 77 CME CB HB3 sing N N 78 CME SG SD sing N N 79 CME SD CE sing N N 80 CME CE CZ sing N N 81 CME CE HE2 sing N N 82 CME CE HE3 sing N N 83 CME CZ OH sing N N 84 CME CZ HZ2 sing N N 85 CME CZ HZ3 sing N N 86 CME OH HH sing N N 87 CME C O doub N N 88 CME C OXT sing N N 89 CME OXT HXT sing N N 90 GLN N CA sing N N 91 GLN N H sing N N 92 GLN N H2 sing N N 93 GLN CA C sing N N 94 GLN CA CB sing N N 95 GLN CA HA sing N N 96 GLN C O doub N N 97 GLN C OXT sing N N 98 GLN CB CG sing N N 99 GLN CB HB2 sing N N 100 GLN CB HB3 sing N N 101 GLN CG CD sing N N 102 GLN CG HG2 sing N N 103 GLN CG HG3 sing N N 104 GLN CD OE1 doub N N 105 GLN CD NE2 sing N N 106 GLN NE2 HE21 sing N N 107 GLN NE2 HE22 sing N N 108 GLN OXT HXT sing N N 109 GLU N CA sing N N 110 GLU N H sing N N 111 GLU N H2 sing N N 112 GLU CA C sing N N 113 GLU CA CB sing N N 114 GLU CA HA sing N N 115 GLU C O doub N N 116 GLU C OXT sing N N 117 GLU CB CG sing N N 118 GLU CB HB2 sing N N 119 GLU CB HB3 sing N N 120 GLU CG CD sing N N 121 GLU CG HG2 sing N N 122 GLU CG HG3 sing N N 123 GLU CD OE1 doub N N 124 GLU CD OE2 sing N N 125 GLU OE2 HE2 sing N N 126 GLU OXT HXT sing N N 127 GLY N CA sing N N 128 GLY N H sing N N 129 GLY N H2 sing N N 130 GLY CA C sing N N 131 GLY CA HA2 sing N N 132 GLY CA HA3 sing N N 133 GLY C O doub N N 134 GLY C OXT sing N N 135 GLY OXT HXT sing N N 136 HIS N CA sing N N 137 HIS N H sing N N 138 HIS N H2 sing N N 139 HIS CA C sing N N 140 HIS CA CB sing N N 141 HIS CA HA sing N N 142 HIS C O doub N N 143 HIS C OXT sing N N 144 HIS CB CG sing N N 145 HIS CB HB2 sing N N 146 HIS CB HB3 sing N N 147 HIS CG ND1 sing Y N 148 HIS CG CD2 doub Y N 149 HIS ND1 CE1 doub Y N 150 HIS ND1 HD1 sing N N 151 HIS CD2 NE2 sing Y N 152 HIS CD2 HD2 sing N N 153 HIS CE1 NE2 sing Y N 154 HIS CE1 HE1 sing N N 155 HIS NE2 HE2 sing N N 156 HIS OXT HXT sing N N 157 HOH O H1 sing N N 158 HOH O H2 sing N N 159 ILE N CA sing N N 160 ILE N H sing N N 161 ILE N H2 sing N N 162 ILE CA C sing N N 163 ILE CA CB sing N N 164 ILE CA HA sing N N 165 ILE C O doub N N 166 ILE C OXT sing N N 167 ILE CB CG1 sing N N 168 ILE CB CG2 sing N N 169 ILE CB HB sing N N 170 ILE CG1 CD1 sing N N 171 ILE CG1 HG12 sing N N 172 ILE CG1 HG13 sing N N 173 ILE CG2 HG21 sing N N 174 ILE CG2 HG22 sing N N 175 ILE CG2 HG23 sing N N 176 ILE CD1 HD11 sing N N 177 ILE CD1 HD12 sing N N 178 ILE CD1 HD13 sing N N 179 ILE OXT HXT sing N N 180 LEU N CA sing N N 181 LEU N H sing N N 182 LEU N H2 sing N N 183 LEU CA C sing N N 184 LEU CA CB sing N N 185 LEU CA HA sing N N 186 LEU C O doub N N 187 LEU C OXT sing N N 188 LEU CB CG sing N N 189 LEU CB HB2 sing N N 190 LEU CB HB3 sing N N 191 LEU CG CD1 sing N N 192 LEU CG CD2 sing N N 193 LEU CG HG sing N N 194 LEU CD1 HD11 sing N N 195 LEU CD1 HD12 sing N N 196 LEU CD1 HD13 sing N N 197 LEU CD2 HD21 sing N N 198 LEU CD2 HD22 sing N N 199 LEU CD2 HD23 sing N N 200 LEU OXT HXT sing N N 201 LYS N CA sing N N 202 LYS N H sing N N 203 LYS N H2 sing N N 204 LYS CA C sing N N 205 LYS CA CB sing N N 206 LYS CA HA sing N N 207 LYS C O doub N N 208 LYS C OXT sing N N 209 LYS CB CG sing N N 210 LYS CB HB2 sing N N 211 LYS CB HB3 sing N N 212 LYS CG CD sing N N 213 LYS CG HG2 sing N N 214 LYS CG HG3 sing N N 215 LYS CD CE sing N N 216 LYS CD HD2 sing N N 217 LYS CD HD3 sing N N 218 LYS CE NZ sing N N 219 LYS CE HE2 sing N N 220 LYS CE HE3 sing N N 221 LYS NZ HZ1 sing N N 222 LYS NZ HZ2 sing N N 223 LYS NZ HZ3 sing N N 224 LYS OXT HXT sing N N 225 MET N CA sing N N 226 MET N H sing N N 227 MET N H2 sing N N 228 MET CA C sing N N 229 MET CA CB sing N N 230 MET CA HA sing N N 231 MET C O doub N N 232 MET C OXT sing N N 233 MET CB CG sing N N 234 MET CB HB2 sing N N 235 MET CB HB3 sing N N 236 MET CG SD sing N N 237 MET CG HG2 sing N N 238 MET CG HG3 sing N N 239 MET SD CE sing N N 240 MET CE HE1 sing N N 241 MET CE HE2 sing N N 242 MET CE HE3 sing N N 243 MET OXT HXT sing N N 244 MTA CS "S5'" sing N N 245 MTA CS HCS1 sing N N 246 MTA CS HCS2 sing N N 247 MTA CS HCS3 sing N N 248 MTA "S5'" "C5'" sing N N 249 MTA "C5'" "C4'" sing N N 250 MTA "C5'" "H5'1" sing N N 251 MTA "C5'" "H5'2" sing N N 252 MTA "C4'" "O4'" sing N N 253 MTA "C4'" "C3'" sing N N 254 MTA "C4'" "H4'" sing N N 255 MTA "O4'" "C1'" sing N N 256 MTA "C2'" "O2'" sing N N 257 MTA "C2'" "C3'" sing N N 258 MTA "C2'" "C1'" sing N N 259 MTA "C2'" "H2'" sing N N 260 MTA "O2'" "HO2'" sing N N 261 MTA "C3'" "O3'" sing N N 262 MTA "C3'" "H3'" sing N N 263 MTA "O3'" H3T sing N N 264 MTA "C1'" N9 sing N N 265 MTA "C1'" "H1'" sing N N 266 MTA N9 C8 sing Y N 267 MTA N9 C4 sing Y N 268 MTA C8 N7 doub Y N 269 MTA C8 H8 sing N N 270 MTA N7 C5 sing Y N 271 MTA C5 C6 sing Y N 272 MTA C5 C4 doub Y N 273 MTA C6 N6 sing N N 274 MTA C6 N1 doub Y N 275 MTA N6 H61 sing N N 276 MTA N6 H62 sing N N 277 MTA N1 C2 sing Y N 278 MTA C2 N3 doub Y N 279 MTA C2 H2 sing N N 280 MTA N3 C4 sing Y N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PRO N CA sing N N 305 PRO N CD sing N N 306 PRO N H sing N N 307 PRO CA C sing N N 308 PRO CA CB sing N N 309 PRO CA HA sing N N 310 PRO C O doub N N 311 PRO C OXT sing N N 312 PRO CB CG sing N N 313 PRO CB HB2 sing N N 314 PRO CB HB3 sing N N 315 PRO CG CD sing N N 316 PRO CG HG2 sing N N 317 PRO CG HG3 sing N N 318 PRO CD HD2 sing N N 319 PRO CD HD3 sing N N 320 PRO OXT HXT sing N N 321 SER N CA sing N N 322 SER N H sing N N 323 SER N H2 sing N N 324 SER CA C sing N N 325 SER CA CB sing N N 326 SER CA HA sing N N 327 SER C O doub N N 328 SER C OXT sing N N 329 SER CB OG sing N N 330 SER CB HB2 sing N N 331 SER CB HB3 sing N N 332 SER OG HG sing N N 333 SER OXT HXT sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TRP N CA sing N N 351 TRP N H sing N N 352 TRP N H2 sing N N 353 TRP CA C sing N N 354 TRP CA CB sing N N 355 TRP CA HA sing N N 356 TRP C O doub N N 357 TRP C OXT sing N N 358 TRP CB CG sing N N 359 TRP CB HB2 sing N N 360 TRP CB HB3 sing N N 361 TRP CG CD1 doub Y N 362 TRP CG CD2 sing Y N 363 TRP CD1 NE1 sing Y N 364 TRP CD1 HD1 sing N N 365 TRP CD2 CE2 doub Y N 366 TRP CD2 CE3 sing Y N 367 TRP NE1 CE2 sing Y N 368 TRP NE1 HE1 sing N N 369 TRP CE2 CZ2 sing Y N 370 TRP CE3 CZ3 doub Y N 371 TRP CE3 HE3 sing N N 372 TRP CZ2 CH2 doub Y N 373 TRP CZ2 HZ2 sing N N 374 TRP CZ3 CH2 sing Y N 375 TRP CZ3 HZ3 sing N N 376 TRP CH2 HH2 sing N N 377 TRP OXT HXT sing N N 378 TYR N CA sing N N 379 TYR N H sing N N 380 TYR N H2 sing N N 381 TYR CA C sing N N 382 TYR CA CB sing N N 383 TYR CA HA sing N N 384 TYR C O doub N N 385 TYR C OXT sing N N 386 TYR CB CG sing N N 387 TYR CB HB2 sing N N 388 TYR CB HB3 sing N N 389 TYR CG CD1 doub Y N 390 TYR CG CD2 sing Y N 391 TYR CD1 CE1 sing Y N 392 TYR CD1 HD1 sing N N 393 TYR CD2 CE2 doub Y N 394 TYR CD2 HD2 sing N N 395 TYR CE1 CZ doub Y N 396 TYR CE1 HE1 sing N N 397 TYR CE2 CZ sing Y N 398 TYR CE2 HE2 sing N N 399 TYR CZ OH sing N N 400 TYR OH HH sing N N 401 TYR OXT HXT sing N N 402 VAL N CA sing N N 403 VAL N H sing N N 404 VAL N H2 sing N N 405 VAL CA C sing N N 406 VAL CA CB sing N N 407 VAL CA HA sing N N 408 VAL C O doub N N 409 VAL C OXT sing N N 410 VAL CB CG1 sing N N 411 VAL CB CG2 sing N N 412 VAL CB HB sing N N 413 VAL CG1 HG11 sing N N 414 VAL CG1 HG12 sing N N 415 VAL CG1 HG13 sing N N 416 VAL CG2 HG21 sing N N 417 VAL CG2 HG22 sing N N 418 VAL CG2 HG23 sing N N 419 VAL OXT HXT sing N N 420 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2yy8 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8X6J _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.021413 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014006 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011496 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #