data_8XKJ # _entry.id 8XKJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8XKJ pdb_00008xkj 10.2210/pdb8xkj/pdb WWPDB D_1300043667 ? ? BMRB 36630 ? 10.13018/BMR36630 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8XKJ _pdbx_database_status.recvd_initial_deposition_date 2023-12-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Ckappa domain of human immunoglobulin' _pdbx_database_related.db_id 36630 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email kkatonmr@ims.ac.jp _pdbx_contact_author.name_first Koichi _pdbx_contact_author.name_last Kato _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7187-9612 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yanaka, S.' 1 0000-0002-3513-5701 'Kodama, A.' 2 0000-0002-0597-8628 'Miyanoiri, Y.' 3 0000-0001-6889-5160 'Kato, K.' 4 0000-0001-7187-9612 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Int.Immunol. _citation.journal_id_ASTM INIMEN _citation.journal_id_CSD 0759 _citation.journal_id_ISSN 1460-2377 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 36 _citation.language ? _citation.page_first 405 _citation.page_last 412 _citation.title 'Identification of potential C1-binding sites in the immunoglobulin CL domains.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/intimm/dxae017 _citation.pdbx_database_id_PubMed 38564192 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yanaka, S.' 1 0000-0002-3513-5701 primary 'Kodama, A.' 2 ? primary 'Nishiguchi, S.' 3 ? primary 'Fujita, R.' 4 ? primary 'Shen, J.' 5 ? primary 'Boonsri, P.' 6 ? primary 'Sung, D.' 7 ? primary 'Isono, Y.' 8 ? primary 'Yagi, H.' 9 ? primary 'Miyanoiri, Y.' 10 ? primary 'Uchihashi, T.' 11 ? primary 'Kato, K.' 12 0000-0001-7187-9612 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Immunoglobulin kappa light chain' _entity.formula_weight 12298.498 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Ckappa domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Immunoglobulin kappa light chain EU' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH KVYACEVTHQGLSSPVTKSFNRGESENLYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH KVYACEVTHQGLSSPVTKSFNRGESENLYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 ALA n 1 3 ALA n 1 4 PRO n 1 5 SER n 1 6 VAL n 1 7 PHE n 1 8 ILE n 1 9 PHE n 1 10 PRO n 1 11 PRO n 1 12 SER n 1 13 ASP n 1 14 GLU n 1 15 GLN n 1 16 LEU n 1 17 LYS n 1 18 SER n 1 19 GLY n 1 20 THR n 1 21 ALA n 1 22 SER n 1 23 VAL n 1 24 VAL n 1 25 CYS n 1 26 LEU n 1 27 LEU n 1 28 ASN n 1 29 ASN n 1 30 PHE n 1 31 TYR n 1 32 PRO n 1 33 ARG n 1 34 GLU n 1 35 ALA n 1 36 LYS n 1 37 VAL n 1 38 GLN n 1 39 TRP n 1 40 LYS n 1 41 VAL n 1 42 ASP n 1 43 ASN n 1 44 ALA n 1 45 LEU n 1 46 GLN n 1 47 SER n 1 48 GLY n 1 49 ASN n 1 50 SER n 1 51 GLN n 1 52 GLU n 1 53 SER n 1 54 VAL n 1 55 THR n 1 56 GLU n 1 57 GLN n 1 58 ASP n 1 59 SER n 1 60 LYS n 1 61 ASP n 1 62 SER n 1 63 THR n 1 64 TYR n 1 65 SER n 1 66 LEU n 1 67 SER n 1 68 SER n 1 69 THR n 1 70 LEU n 1 71 THR n 1 72 LEU n 1 73 SER n 1 74 LYS n 1 75 ALA n 1 76 ASP n 1 77 TYR n 1 78 GLU n 1 79 LYS n 1 80 HIS n 1 81 LYS n 1 82 VAL n 1 83 TYR n 1 84 ALA n 1 85 CYS n 1 86 GLU n 1 87 VAL n 1 88 THR n 1 89 HIS n 1 90 GLN n 1 91 GLY n 1 92 LEU n 1 93 SER n 1 94 SER n 1 95 PRO n 1 96 VAL n 1 97 THR n 1 98 LYS n 1 99 SER n 1 100 PHE n 1 101 ASN n 1 102 ARG n 1 103 GLY n 1 104 GLU n 1 105 SER n 1 106 GLU n 1 107 ASN n 1 108 LEU n 1 109 TYR n 1 110 PHE n 1 111 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 111 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 2 2 VAL VAL A . n A 1 2 ALA 2 3 3 ALA ALA A . n A 1 3 ALA 3 4 4 ALA ALA A . n A 1 4 PRO 4 5 5 PRO PRO A . n A 1 5 SER 5 6 6 SER SER A . n A 1 6 VAL 6 7 7 VAL VAL A . n A 1 7 PHE 7 8 8 PHE PHE A . n A 1 8 ILE 8 9 9 ILE ILE A . n A 1 9 PHE 9 10 10 PHE PHE A . n A 1 10 PRO 10 11 11 PRO PRO A . n A 1 11 PRO 11 12 12 PRO PRO A . n A 1 12 SER 12 13 13 SER SER A . n A 1 13 ASP 13 14 14 ASP ASP A . n A 1 14 GLU 14 15 15 GLU GLU A . n A 1 15 GLN 15 16 16 GLN GLN A . n A 1 16 LEU 16 17 17 LEU LEU A . n A 1 17 LYS 17 18 18 LYS LYS A . n A 1 18 SER 18 19 19 SER SER A . n A 1 19 GLY 19 20 20 GLY GLY A . n A 1 20 THR 20 21 21 THR THR A . n A 1 21 ALA 21 22 22 ALA ALA A . n A 1 22 SER 22 23 23 SER SER A . n A 1 23 VAL 23 24 24 VAL VAL A . n A 1 24 VAL 24 25 25 VAL VAL A . n A 1 25 CYS 25 26 26 CYS CYS A . n A 1 26 LEU 26 27 27 LEU LEU A . n A 1 27 LEU 27 28 28 LEU LEU A . n A 1 28 ASN 28 29 29 ASN ASN A . n A 1 29 ASN 29 30 30 ASN ASN A . n A 1 30 PHE 30 31 31 PHE PHE A . n A 1 31 TYR 31 32 32 TYR TYR A . n A 1 32 PRO 32 33 33 PRO PRO A . n A 1 33 ARG 33 34 34 ARG ARG A . n A 1 34 GLU 34 35 35 GLU GLU A . n A 1 35 ALA 35 36 36 ALA ALA A . n A 1 36 LYS 36 37 37 LYS LYS A . n A 1 37 VAL 37 38 38 VAL VAL A . n A 1 38 GLN 38 39 39 GLN GLN A . n A 1 39 TRP 39 40 40 TRP TRP A . n A 1 40 LYS 40 41 41 LYS LYS A . n A 1 41 VAL 41 42 42 VAL VAL A . n A 1 42 ASP 42 43 43 ASP ASP A . n A 1 43 ASN 43 44 44 ASN ASN A . n A 1 44 ALA 44 45 45 ALA ALA A . n A 1 45 LEU 45 46 46 LEU LEU A . n A 1 46 GLN 46 47 47 GLN GLN A . n A 1 47 SER 47 48 48 SER SER A . n A 1 48 GLY 48 49 49 GLY GLY A . n A 1 49 ASN 49 50 50 ASN ASN A . n A 1 50 SER 50 51 51 SER SER A . n A 1 51 GLN 51 52 52 GLN GLN A . n A 1 52 GLU 52 53 53 GLU GLU A . n A 1 53 SER 53 54 54 SER SER A . n A 1 54 VAL 54 55 55 VAL VAL A . n A 1 55 THR 55 56 56 THR THR A . n A 1 56 GLU 56 57 57 GLU GLU A . n A 1 57 GLN 57 58 58 GLN GLN A . n A 1 58 ASP 58 59 59 ASP ASP A . n A 1 59 SER 59 60 60 SER SER A . n A 1 60 LYS 60 61 61 LYS LYS A . n A 1 61 ASP 61 62 62 ASP ASP A . n A 1 62 SER 62 63 63 SER SER A . n A 1 63 THR 63 64 64 THR THR A . n A 1 64 TYR 64 65 65 TYR TYR A . n A 1 65 SER 65 66 66 SER SER A . n A 1 66 LEU 66 67 67 LEU LEU A . n A 1 67 SER 67 68 68 SER SER A . n A 1 68 SER 68 69 69 SER SER A . n A 1 69 THR 69 70 70 THR THR A . n A 1 70 LEU 70 71 71 LEU LEU A . n A 1 71 THR 71 72 72 THR THR A . n A 1 72 LEU 72 73 73 LEU LEU A . n A 1 73 SER 73 74 74 SER SER A . n A 1 74 LYS 74 75 75 LYS LYS A . n A 1 75 ALA 75 76 76 ALA ALA A . n A 1 76 ASP 76 77 77 ASP ASP A . n A 1 77 TYR 77 78 78 TYR TYR A . n A 1 78 GLU 78 79 79 GLU GLU A . n A 1 79 LYS 79 80 80 LYS LYS A . n A 1 80 HIS 80 81 81 HIS HIS A . n A 1 81 LYS 81 82 82 LYS LYS A . n A 1 82 VAL 82 83 83 VAL VAL A . n A 1 83 TYR 83 84 84 TYR TYR A . n A 1 84 ALA 84 85 85 ALA ALA A . n A 1 85 CYS 85 86 86 CYS CYS A . n A 1 86 GLU 86 87 87 GLU GLU A . n A 1 87 VAL 87 88 88 VAL VAL A . n A 1 88 THR 88 89 89 THR THR A . n A 1 89 HIS 89 90 90 HIS HIS A . n A 1 90 GLN 90 91 91 GLN GLN A . n A 1 91 GLY 91 92 92 GLY GLY A . n A 1 92 LEU 92 93 93 LEU LEU A . n A 1 93 SER 93 94 94 SER SER A . n A 1 94 SER 94 95 95 SER SER A . n A 1 95 PRO 95 96 96 PRO PRO A . n A 1 96 VAL 96 97 97 VAL VAL A . n A 1 97 THR 97 98 98 THR THR A . n A 1 98 LYS 98 99 99 LYS LYS A . n A 1 99 SER 99 100 100 SER SER A . n A 1 100 PHE 100 101 101 PHE PHE A . n A 1 101 ASN 101 102 102 ASN ASN A . n A 1 102 ARG 102 103 103 ARG ARG A . n A 1 103 GLY 103 104 104 GLY GLY A . n A 1 104 GLU 104 105 105 GLU GLU A . n A 1 105 SER 105 106 106 SER SER A . n A 1 106 GLU 106 107 107 GLU GLU A . n A 1 107 ASN 107 108 108 ASN ASN A . n A 1 108 LEU 108 109 109 LEU LEU A . n A 1 109 TYR 109 110 110 TYR TYR A . n A 1 110 PHE 110 111 111 PHE PHE A . n A 1 111 GLN 111 112 112 GLN GLN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8XKJ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8XKJ _struct.title 'Ckappa domain of human immunoglobulin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8XKJ _struct_keywords.text 'STRUCTURE FROM CYANA 3.98.15, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IGK_HUMAN _struct_ref.pdbx_db_accession P0DOX7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH KVYACEVTHQGLSSPVTKSFNRGE ; _struct_ref.pdbx_align_begin 110 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8XKJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0DOX7 _struct_ref_seq.db_align_beg 110 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 213 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8XKJ SER A 105 ? UNP P0DOX7 ? ? 'expression tag' 106 1 1 8XKJ GLU A 106 ? UNP P0DOX7 ? ? 'expression tag' 107 2 1 8XKJ ASN A 107 ? UNP P0DOX7 ? ? 'expression tag' 108 3 1 8XKJ LEU A 108 ? UNP P0DOX7 ? ? 'expression tag' 109 4 1 8XKJ TYR A 109 ? UNP P0DOX7 ? ? 'expression tag' 110 5 1 8XKJ PHE A 110 ? UNP P0DOX7 ? ? 'expression tag' 111 6 1 8XKJ GLN A 111 ? UNP P0DOX7 ? ? 'expression tag' 112 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 12 ? SER A 18 ? SER A 13 SER A 19 1 ? 7 HELX_P HELX_P2 AA2 LYS A 74 ? LYS A 79 ? LYS A 75 LYS A 80 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 25 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 85 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 26 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 86 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.758 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 25 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 85 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 26 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 86 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Non-standard linkage' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 6 ? PHE A 9 ? VAL A 7 PHE A 10 AA1 2 VAL A 24 ? LEU A 27 ? VAL A 25 LEU A 28 AA1 3 LEU A 66 ? THR A 69 ? LEU A 67 THR A 70 AA2 1 THR A 20 ? ALA A 21 ? THR A 21 ALA A 22 AA2 2 LEU A 72 ? SER A 73 ? LEU A 73 SER A 74 AA3 1 ALA A 44 ? LEU A 45 ? ALA A 45 LEU A 46 AA3 2 LYS A 36 ? VAL A 41 ? LYS A 37 VAL A 42 AA3 3 VAL A 82 ? THR A 88 ? VAL A 83 THR A 89 AA3 4 SER A 99 ? ASN A 101 ? SER A 100 ASN A 102 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 7 ? N PHE A 8 O LEU A 26 ? O LEU A 27 AA1 2 3 N LEU A 27 ? N LEU A 28 O LEU A 66 ? O LEU A 67 AA2 1 2 N ALA A 21 ? N ALA A 22 O LEU A 72 ? O LEU A 73 AA3 1 2 O ALA A 44 ? O ALA A 45 N VAL A 41 ? N VAL A 42 AA3 2 3 N GLN A 38 ? N GLN A 39 O GLU A 86 ? O GLU A 87 AA3 3 4 N TYR A 83 ? N TYR A 84 O PHE A 100 ? O PHE A 101 # _pdbx_entry_details.entry_id 8XKJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 5 ? ? -69.77 -169.65 2 1 ASN A 30 ? ? -39.91 111.65 3 1 GLU A 35 ? ? -93.57 32.02 4 1 ASN A 50 ? ? -96.54 34.96 5 1 ASP A 59 ? ? -57.53 -178.53 6 1 LYS A 82 ? ? -160.72 -30.11 7 1 HIS A 90 ? ? -179.92 -176.42 8 1 GLU A 107 ? ? -98.46 44.62 9 2 PRO A 5 ? ? -69.72 -169.27 10 2 GLU A 35 ? ? -93.18 32.04 11 2 ASN A 50 ? ? -96.42 35.25 12 2 ASP A 59 ? ? -57.68 -178.65 13 2 LYS A 82 ? ? -162.21 -30.93 14 2 HIS A 90 ? ? -178.76 -178.14 15 2 ASN A 108 ? ? -158.82 35.87 16 3 PRO A 5 ? ? -69.75 -166.83 17 3 TYR A 32 ? ? -89.38 -74.97 18 3 GLU A 35 ? ? -83.99 46.92 19 3 ASN A 50 ? ? -96.77 34.73 20 3 ASP A 59 ? ? -55.70 179.81 21 3 LYS A 82 ? ? -160.41 -30.48 22 3 HIS A 90 ? ? -170.68 -174.04 23 3 SER A 106 ? ? -57.46 175.63 24 3 GLU A 107 ? ? -89.57 49.30 25 3 ASN A 108 ? ? -147.91 36.32 26 3 PHE A 111 ? ? -52.12 -73.08 27 4 PRO A 5 ? ? -69.80 -170.16 28 4 GLU A 35 ? ? -91.76 34.18 29 4 ASN A 50 ? ? -97.21 34.62 30 4 GLN A 52 ? ? -165.19 119.62 31 4 ASP A 59 ? ? -59.11 178.81 32 4 LYS A 82 ? ? -160.28 -30.59 33 4 GLU A 107 ? ? -92.31 43.72 34 5 PRO A 5 ? ? -69.71 -170.32 35 5 ASN A 30 ? ? -39.64 111.65 36 5 GLU A 35 ? ? -91.42 38.44 37 5 ASN A 50 ? ? -96.98 33.99 38 5 GLN A 52 ? ? -167.93 119.37 39 5 ASP A 59 ? ? -57.95 -177.50 40 5 LYS A 82 ? ? -161.61 -30.04 41 5 HIS A 90 ? ? -179.34 -176.16 42 5 TYR A 110 ? ? -51.88 103.29 43 6 PRO A 5 ? ? -69.79 -171.49 44 6 ASN A 30 ? ? -39.83 108.74 45 6 GLU A 35 ? ? -92.96 42.52 46 6 ASN A 50 ? ? -97.01 34.25 47 6 GLN A 52 ? ? -167.23 119.07 48 6 ASP A 59 ? ? -57.61 -178.38 49 6 LYS A 82 ? ? -161.42 -31.01 50 6 HIS A 90 ? ? -173.68 -178.37 51 6 PRO A 96 ? ? -69.75 -87.27 52 7 PRO A 5 ? ? -69.73 -169.82 53 7 ASN A 30 ? ? -41.03 106.86 54 7 GLU A 35 ? ? -91.88 34.31 55 7 ASN A 50 ? ? -97.71 34.71 56 7 GLN A 52 ? ? -168.10 119.58 57 7 ASP A 59 ? ? -58.41 179.87 58 7 LYS A 82 ? ? -160.69 -31.00 59 7 HIS A 90 ? ? 179.21 -174.76 60 7 GLU A 107 ? ? -95.61 44.88 61 7 PHE A 111 ? ? -52.61 -74.27 62 8 PRO A 5 ? ? -69.76 -174.68 63 8 ASN A 30 ? ? -37.86 112.78 64 8 GLU A 35 ? ? -93.25 36.59 65 8 ASN A 50 ? ? -96.99 35.29 66 8 ASP A 59 ? ? -56.53 -178.44 67 8 LYS A 82 ? ? -163.94 -30.09 68 8 HIS A 90 ? ? -177.07 -175.91 69 9 PRO A 5 ? ? -69.73 -169.67 70 9 ASN A 30 ? ? -39.90 109.98 71 9 GLU A 35 ? ? -91.51 41.21 72 9 ASN A 50 ? ? -97.34 34.31 73 9 GLN A 52 ? ? -167.79 119.63 74 9 LYS A 82 ? ? -161.04 -30.27 75 9 HIS A 90 ? ? -176.96 -177.88 76 9 PRO A 96 ? ? -69.80 -86.78 77 9 GLU A 107 ? ? -53.61 175.92 78 10 PRO A 5 ? ? -69.78 -174.83 79 10 GLU A 35 ? ? -89.62 33.34 80 10 ASN A 50 ? ? -96.52 33.94 81 10 GLN A 52 ? ? -167.80 119.04 82 10 ASP A 59 ? ? -56.76 -179.04 83 10 LYS A 82 ? ? -159.46 -30.32 84 10 ASN A 108 ? ? -163.38 35.77 85 11 PRO A 5 ? ? -69.71 -171.05 86 11 ASN A 30 ? ? -39.59 110.05 87 11 TYR A 32 ? ? -89.04 -70.65 88 11 ASN A 50 ? ? -96.46 35.06 89 11 GLN A 52 ? ? -160.90 119.35 90 11 ASP A 59 ? ? -57.24 -179.86 91 11 LYS A 82 ? ? -160.27 -30.23 92 11 HIS A 90 ? ? -179.32 -177.99 93 11 PRO A 96 ? ? -69.81 -87.84 94 11 GLU A 107 ? ? -95.28 35.26 95 12 PRO A 5 ? ? -69.74 -172.75 96 12 ASN A 30 ? ? -39.63 107.09 97 12 GLU A 35 ? ? -93.82 33.44 98 12 ASN A 50 ? ? -96.00 35.57 99 12 ASP A 59 ? ? -56.69 -178.61 100 12 LYS A 82 ? ? -161.66 -30.89 101 12 HIS A 90 ? ? -177.26 -176.06 102 12 PRO A 96 ? ? -69.72 -86.45 103 12 SER A 106 ? ? -58.45 173.22 104 12 GLU A 107 ? ? -90.75 48.72 105 12 ASN A 108 ? ? -145.82 36.14 106 13 PRO A 5 ? ? -69.81 -171.21 107 13 ASN A 30 ? ? -40.61 107.20 108 13 GLU A 35 ? ? -92.69 32.72 109 13 ASN A 50 ? ? -97.73 34.16 110 13 GLN A 52 ? ? -167.86 119.84 111 13 ASP A 59 ? ? -58.88 179.03 112 13 LYS A 82 ? ? -162.22 -30.58 113 13 HIS A 90 ? ? 178.42 -173.90 114 13 GLU A 107 ? ? -92.99 44.36 115 14 PRO A 5 ? ? -69.72 -177.16 116 14 ASN A 30 ? ? -39.49 106.87 117 14 GLU A 35 ? ? -94.49 35.20 118 14 ASN A 50 ? ? -96.40 35.07 119 14 ASP A 59 ? ? -58.00 -179.77 120 14 LYS A 82 ? ? -160.50 -30.57 121 14 HIS A 90 ? ? -174.34 -176.96 122 14 PRO A 96 ? ? -69.74 -87.37 123 15 PRO A 5 ? ? -69.81 -169.01 124 15 ASN A 30 ? ? -39.85 108.13 125 15 GLU A 35 ? ? -95.26 34.42 126 15 ASN A 50 ? ? -96.06 34.49 127 15 GLN A 52 ? ? -167.31 119.16 128 15 LYS A 82 ? ? -164.30 -30.87 129 15 HIS A 90 ? ? -175.93 -177.11 130 15 GLU A 105 ? ? 67.78 137.56 131 15 ASN A 108 ? ? -148.23 50.75 132 16 PRO A 5 ? ? -69.71 -178.32 133 16 ASN A 30 ? ? -39.09 108.23 134 16 GLU A 35 ? ? -93.54 33.67 135 16 GLU A 57 ? ? -58.22 174.40 136 16 LYS A 82 ? ? -160.95 -29.52 137 16 HIS A 90 ? ? -172.00 -177.18 138 16 PRO A 96 ? ? -69.79 -87.62 139 17 PRO A 5 ? ? -69.75 -173.96 140 17 ASN A 30 ? ? -39.04 115.63 141 17 TYR A 32 ? ? -89.79 -70.67 142 17 GLU A 35 ? ? -86.47 32.45 143 17 ASN A 50 ? ? -95.81 36.46 144 17 GLN A 52 ? ? -167.81 117.91 145 17 ASP A 59 ? ? -56.04 -179.67 146 17 LYS A 82 ? ? -163.64 -31.01 147 17 HIS A 90 ? ? -178.98 -175.39 148 17 ASN A 108 ? ? -150.11 36.00 149 18 PRO A 5 ? ? -69.74 -173.02 150 18 ASN A 30 ? ? -39.78 109.61 151 18 GLU A 35 ? ? -92.43 42.44 152 18 ASN A 50 ? ? -96.33 35.43 153 18 LYS A 82 ? ? -158.76 -29.83 154 18 PRO A 96 ? ? -69.83 -86.90 155 18 SER A 106 ? ? -58.86 -173.95 156 18 GLU A 107 ? ? -57.26 -177.04 157 19 PRO A 5 ? ? -69.73 -166.91 158 19 ASN A 30 ? ? -40.62 108.14 159 19 GLU A 35 ? ? -90.31 37.50 160 19 ASP A 59 ? ? -56.98 -177.87 161 19 LYS A 82 ? ? -159.18 -30.87 162 19 PRO A 96 ? ? -69.79 -84.85 163 19 ASN A 108 ? ? -157.98 37.02 164 20 PRO A 5 ? ? -69.70 -169.65 165 20 ASN A 30 ? ? -44.30 108.81 166 20 TYR A 32 ? ? -87.96 -73.77 167 20 GLU A 35 ? ? -91.99 34.66 168 20 ASN A 50 ? ? -96.50 35.72 169 20 ASP A 59 ? ? -58.55 -177.36 170 20 LYS A 82 ? ? -160.89 -28.89 171 20 HIS A 90 ? ? -173.42 -178.04 172 20 PRO A 96 ? ? -69.76 -88.08 173 20 GLU A 107 ? ? -96.16 36.45 # _pdbx_nmr_ensemble.entry_id 8XKJ _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8XKJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0 mM [U-13C; U-15N] protein, 5 mM Napi, 50 mM sodium chloride, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label '15N, 13C' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 protein 1.0 ? mM '[U-13C; U-15N]' 1 Napi 5 ? mM none 1 'sodium chloride' 50 ? mM none # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'Not defined' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label 'condition 1' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D 1H-15N NOESY' 1 isotropic 3 1 1 '3D 1H-15N TOCSY' 1 isotropic 4 1 1 '3D 1H-13C NOESY' 1 isotropic 5 1 1 '3D C(CO)NH' 1 isotropic 6 1 1 '3D CBCA(CO)NH' 1 isotropic 7 1 1 '3D CBCANH' 1 isotropic 8 1 1 '3D HBHA(CO)NH' 1 isotropic 9 1 1 '3D HNCA' 1 isotropic 10 1 1 '3D HNCO' 1 isotropic 11 1 1 '3D HN(CO)CA' 1 isotropic 12 1 1 '3D HNCACO' 1 isotropic 14 1 1 '3D CCH-TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 8XKJ _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 'chemical shift assignment' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' 3 'structure calculation' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' 4 'peak picking' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TRP N N N N 298 TRP CA C N S 299 TRP C C N N 300 TRP O O N N 301 TRP CB C N N 302 TRP CG C Y N 303 TRP CD1 C Y N 304 TRP CD2 C Y N 305 TRP NE1 N Y N 306 TRP CE2 C Y N 307 TRP CE3 C Y N 308 TRP CZ2 C Y N 309 TRP CZ3 C Y N 310 TRP CH2 C Y N 311 TRP OXT O N N 312 TRP H H N N 313 TRP H2 H N N 314 TRP HA H N N 315 TRP HB2 H N N 316 TRP HB3 H N N 317 TRP HD1 H N N 318 TRP HE1 H N N 319 TRP HE3 H N N 320 TRP HZ2 H N N 321 TRP HZ3 H N N 322 TRP HH2 H N N 323 TRP HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Education, Culture, Sports, Science and Technology (Japan)' Japan JP22H02755 1 'Japan Agency for Medical Research and Development (AMED)' Japan JP21ae0121020h0001 2 'Japan Agency for Medical Research and Development (AMED)' Japan JP21ae0121013h0301 3 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANACE NEO' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8XKJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #