data_8XLC # _entry.id 8XLC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8XLC pdb_00008xlc 10.2210/pdb8xlc/pdb WWPDB D_1300043715 ? ? BMRB 36634 ? 10.13018/BMR36634 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8XLC _pdbx_database_status.recvd_initial_deposition_date 2023-12-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Clamda1 domain of human immunoglobulin' _pdbx_database_related.db_id 36634 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email kkatonmr@ims.ac.jp _pdbx_contact_author.name_first Koichi _pdbx_contact_author.name_last Kato _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7187-9612 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yanaka, S.' 1 ? 'Kodama, A.' 2 ? 'Miyanoiri, Y.' 3 ? 'Kato, K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Int.Immunol. _citation.journal_id_ASTM INIMEN _citation.journal_id_CSD 0759 _citation.journal_id_ISSN 1460-2377 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 36 _citation.language ? _citation.page_first 405 _citation.page_last 412 _citation.title 'Identification of potential C1-binding sites in the immunoglobulin CL domains.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/intimm/dxae017 _citation.pdbx_database_id_PubMed 38564192 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yanaka, S.' 1 0000-0002-3513-5701 primary 'Kodama, A.' 2 ? primary 'Nishiguchi, S.' 3 ? primary 'Fujita, R.' 4 ? primary 'Shen, J.' 5 ? primary 'Boonsri, P.' 6 ? primary 'Sung, D.' 7 ? primary 'Isono, Y.' 8 ? primary 'Yagi, H.' 9 ? primary 'Miyanoiri, Y.' 10 ? primary 'Uchihashi, T.' 11 ? primary 'Kato, K.' 12 0000-0001-7187-9612 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Immunoglobulin lambda constant 2' _entity.formula_weight 12026.254 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Ig lambda chain C region Kern,Ig lambda chain C region NIG-64,Ig lambda chain C region SH,Ig lambda chain C region X,Ig lambda-2 chain C region ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKS HRSYSCQVTHEGSTVEKTVAPTESSENLYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKS HRSYSCQVTHEGSTVEKTVAPTESSENLYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 PRO n 1 3 LYS n 1 4 ALA n 1 5 ALA n 1 6 PRO n 1 7 SER n 1 8 VAL n 1 9 THR n 1 10 LEU n 1 11 PHE n 1 12 PRO n 1 13 PRO n 1 14 SER n 1 15 SER n 1 16 GLU n 1 17 GLU n 1 18 LEU n 1 19 GLN n 1 20 ALA n 1 21 ASN n 1 22 LYS n 1 23 ALA n 1 24 THR n 1 25 LEU n 1 26 VAL n 1 27 CYS n 1 28 LEU n 1 29 ILE n 1 30 SER n 1 31 ASP n 1 32 PHE n 1 33 TYR n 1 34 PRO n 1 35 GLY n 1 36 ALA n 1 37 VAL n 1 38 THR n 1 39 VAL n 1 40 ALA n 1 41 TRP n 1 42 LYS n 1 43 ALA n 1 44 ASP n 1 45 SER n 1 46 SER n 1 47 PRO n 1 48 VAL n 1 49 LYS n 1 50 ALA n 1 51 GLY n 1 52 VAL n 1 53 GLU n 1 54 THR n 1 55 THR n 1 56 THR n 1 57 PRO n 1 58 SER n 1 59 LYS n 1 60 GLN n 1 61 SER n 1 62 ASN n 1 63 ASN n 1 64 LYS n 1 65 TYR n 1 66 ALA n 1 67 ALA n 1 68 SER n 1 69 SER n 1 70 TYR n 1 71 LEU n 1 72 SER n 1 73 LEU n 1 74 THR n 1 75 PRO n 1 76 GLU n 1 77 GLN n 1 78 TRP n 1 79 LYS n 1 80 SER n 1 81 HIS n 1 82 ARG n 1 83 SER n 1 84 TYR n 1 85 SER n 1 86 CYS n 1 87 GLN n 1 88 VAL n 1 89 THR n 1 90 HIS n 1 91 GLU n 1 92 GLY n 1 93 SER n 1 94 THR n 1 95 VAL n 1 96 GLU n 1 97 LYS n 1 98 THR n 1 99 VAL n 1 100 ALA n 1 101 PRO n 1 102 THR n 1 103 GLU n 1 104 SER n 1 105 SER n 1 106 GLU n 1 107 ASN n 1 108 LEU n 1 109 TYR n 1 110 PHE n 1 111 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 111 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene IGLC2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 GLN 111 111 111 GLN GLN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8XLC _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8XLC _struct.title 'Clamda1 domain of human immunoglobulin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8XLC _struct_keywords.text 'STRUCTURE FROM CYANA 3.98.15, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IGLC2_HUMAN _struct_ref.pdbx_db_accession P0DOY2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKS HRSYSCQVTHEGSTVEKTVAPTE ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8XLC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0DOY2 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8XLC SER A 104 ? UNP P0DOY2 ? ? 'expression tag' 104 1 1 8XLC SER A 105 ? UNP P0DOY2 ? ? 'expression tag' 105 2 1 8XLC GLU A 106 ? UNP P0DOY2 ? ? 'expression tag' 106 3 1 8XLC ASN A 107 ? UNP P0DOY2 ? ? 'expression tag' 107 4 1 8XLC LEU A 108 ? UNP P0DOY2 ? ? 'expression tag' 108 5 1 8XLC TYR A 109 ? UNP P0DOY2 ? ? 'expression tag' 109 6 1 8XLC PHE A 110 ? UNP P0DOY2 ? ? 'expression tag' 110 7 1 8XLC GLN A 111 ? UNP P0DOY2 ? ? 'expression tag' 111 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 14 ? ALA A 20 ? SER A 14 ALA A 20 1 ? 7 HELX_P HELX_P2 AA2 PRO A 75 ? HIS A 81 ? PRO A 75 HIS A 81 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 27 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 86 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 27 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 86 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.110 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 27 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 86 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 27 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 86 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 9 ? LEU A 10 ? THR A 9 LEU A 10 AA1 2 ALA A 23 ? ILE A 29 ? ALA A 23 ILE A 29 AA1 3 TYR A 65 ? LEU A 73 ? TYR A 65 LEU A 73 AA1 4 SER A 58 ? LYS A 59 ? SER A 58 LYS A 59 AA2 1 SER A 46 ? PRO A 47 ? SER A 46 PRO A 47 AA2 2 ALA A 40 ? ALA A 43 ? ALA A 40 ALA A 43 AA2 3 SER A 85 ? GLN A 87 ? SER A 85 GLN A 87 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 9 ? N THR A 9 O LEU A 28 ? O LEU A 28 AA1 2 3 N LEU A 25 ? N LEU A 25 O LEU A 71 ? O LEU A 71 AA1 3 4 O ALA A 66 ? O ALA A 66 N SER A 58 ? N SER A 58 AA2 1 2 O SER A 46 ? O SER A 46 N ALA A 43 ? N ALA A 43 AA2 2 3 N ALA A 40 ? N ALA A 40 O GLN A 87 ? O GLN A 87 # _pdbx_entry_details.entry_id 8XLC _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -69.74 -171.66 2 1 PRO A 13 ? ? -69.75 -176.28 3 1 ALA A 23 ? ? 178.82 115.12 4 1 TYR A 33 ? ? -40.99 160.69 5 1 PRO A 34 ? ? -69.80 70.16 6 1 ASP A 44 ? ? 50.27 -100.15 7 1 GLU A 53 ? ? -154.30 71.18 8 1 PRO A 57 ? ? -69.81 -177.07 9 1 GLU A 103 ? ? -143.69 37.27 10 1 SER A 104 ? ? -174.41 138.45 11 2 PRO A 2 ? ? -69.73 -171.50 12 2 PRO A 13 ? ? -69.71 -177.58 13 2 ALA A 23 ? ? -174.80 113.42 14 2 ASP A 31 ? ? 48.10 71.70 15 2 TYR A 33 ? ? -40.97 160.84 16 2 PRO A 34 ? ? -69.80 70.03 17 2 ASP A 44 ? ? 43.42 -97.98 18 2 GLU A 53 ? ? -156.82 70.29 19 2 SER A 104 ? ? -176.25 136.15 20 3 PRO A 2 ? ? -69.75 -175.04 21 3 PRO A 13 ? ? -69.77 -176.59 22 3 ALA A 23 ? ? -174.44 116.66 23 3 TYR A 33 ? ? -40.89 160.85 24 3 PRO A 34 ? ? -69.74 69.90 25 3 ASP A 44 ? ? 44.13 -98.24 26 3 PRO A 57 ? ? -69.74 -178.87 27 3 GLU A 103 ? ? -60.84 -172.58 28 3 SER A 104 ? ? -94.82 37.12 29 3 ASN A 107 ? ? 63.26 60.18 30 4 PRO A 2 ? ? -69.76 -175.64 31 4 PRO A 13 ? ? -69.81 -178.81 32 4 ALA A 23 ? ? -175.81 115.94 33 4 ASP A 31 ? ? 47.85 75.23 34 4 TYR A 33 ? ? -41.08 160.88 35 4 PRO A 34 ? ? -69.65 69.68 36 4 ASP A 44 ? ? 49.57 -99.78 37 4 GLU A 53 ? ? -152.00 73.44 38 4 ASN A 107 ? ? -176.32 105.72 39 5 PRO A 2 ? ? -69.76 -176.12 40 5 PRO A 13 ? ? -69.77 -179.76 41 5 ALA A 23 ? ? 178.96 115.34 42 5 ASP A 31 ? ? 48.85 73.51 43 5 TYR A 33 ? ? -41.12 161.01 44 5 PRO A 34 ? ? -69.74 70.08 45 5 ASP A 44 ? ? 43.81 -98.35 46 5 GLU A 106 ? ? -54.49 -71.42 47 6 PRO A 2 ? ? -69.79 -175.59 48 6 PRO A 13 ? ? -69.75 -178.61 49 6 ALA A 23 ? ? -176.96 115.31 50 6 TYR A 33 ? ? -41.08 160.95 51 6 PRO A 34 ? ? -69.74 70.01 52 6 ASP A 44 ? ? 44.63 -96.65 53 6 GLU A 53 ? ? -151.20 67.28 54 6 SER A 104 ? ? -51.28 107.19 55 6 GLU A 106 ? ? -59.57 -173.45 56 7 PRO A 2 ? ? -69.80 -171.45 57 7 PRO A 13 ? ? -69.80 -179.17 58 7 ALA A 23 ? ? -175.21 113.07 59 7 ASP A 31 ? ? 47.32 77.60 60 7 TYR A 33 ? ? -41.25 161.21 61 7 PRO A 34 ? ? -69.78 70.26 62 7 ASP A 44 ? ? 53.50 -97.73 63 7 PRO A 57 ? ? -69.76 -175.18 64 7 GLU A 106 ? ? -52.91 -71.71 65 8 PRO A 2 ? ? -69.76 -171.01 66 8 PRO A 13 ? ? -69.73 -175.11 67 8 ALA A 23 ? ? 177.85 112.53 68 8 ASP A 31 ? ? 47.67 71.02 69 8 TYR A 33 ? ? -41.12 161.00 70 8 PRO A 34 ? ? -69.76 69.99 71 8 ASP A 44 ? ? 43.51 -97.94 72 8 PRO A 57 ? ? -69.71 -174.85 73 8 GLU A 103 ? ? -58.55 -176.00 74 9 PRO A 2 ? ? -69.78 -171.46 75 9 PRO A 13 ? ? -69.80 -176.62 76 9 ALA A 23 ? ? 179.27 116.62 77 9 ASP A 31 ? ? 47.73 71.55 78 9 TYR A 33 ? ? -41.09 161.24 79 9 PRO A 34 ? ? -69.73 69.32 80 9 ASP A 44 ? ? 53.54 -99.40 81 9 SER A 104 ? ? -56.08 104.24 82 9 SER A 105 ? ? -144.23 36.93 83 10 PRO A 2 ? ? -69.75 -170.94 84 10 PRO A 13 ? ? -69.72 -176.85 85 10 ALA A 23 ? ? 175.82 114.08 86 10 PHE A 32 ? ? -120.25 -167.20 87 10 TYR A 33 ? ? -39.27 160.16 88 10 PRO A 34 ? ? -69.78 69.38 89 10 ASP A 44 ? ? 43.67 -98.37 90 10 LYS A 49 ? ? -39.48 -38.12 91 10 ALA A 50 ? ? 70.41 44.32 92 10 GLU A 53 ? ? -153.73 70.78 93 10 PRO A 57 ? ? -69.77 -174.86 94 10 SER A 104 ? ? -51.26 109.85 95 10 GLU A 106 ? ? -60.17 -171.86 96 10 PHE A 110 ? ? -61.77 -172.65 97 11 PRO A 2 ? ? -69.76 -171.59 98 11 PRO A 13 ? ? -69.76 -176.67 99 11 ALA A 23 ? ? 177.49 116.71 100 11 ASP A 31 ? ? 47.53 71.78 101 11 TYR A 33 ? ? -41.26 160.91 102 11 PRO A 34 ? ? -69.70 70.29 103 11 ASP A 44 ? ? 43.52 -98.58 104 11 PRO A 57 ? ? -69.68 -172.97 105 11 GLU A 106 ? ? -52.50 -71.44 106 12 PRO A 2 ? ? -69.76 -171.05 107 12 PRO A 13 ? ? -69.79 -174.04 108 12 ALA A 23 ? ? 178.70 110.28 109 12 TYR A 33 ? ? -40.79 160.64 110 12 PRO A 34 ? ? -69.77 70.22 111 12 ASP A 44 ? ? 43.59 -98.52 112 12 PRO A 57 ? ? -69.82 -176.21 113 12 SER A 104 ? ? -178.43 136.90 114 13 PRO A 2 ? ? -69.81 -170.84 115 13 PRO A 13 ? ? -69.81 -176.89 116 13 ALA A 23 ? ? -176.87 114.91 117 13 PHE A 32 ? ? -122.04 -167.20 118 13 TYR A 33 ? ? -39.38 160.24 119 13 PRO A 34 ? ? -69.74 69.08 120 13 ASP A 44 ? ? 42.87 -98.66 121 13 LYS A 49 ? ? -39.34 -38.46 122 13 ALA A 50 ? ? 70.36 41.32 123 13 PRO A 57 ? ? -69.72 -173.03 124 13 SER A 104 ? ? -179.08 134.21 125 14 PRO A 2 ? ? -69.74 -174.65 126 14 PRO A 13 ? ? -69.78 -176.77 127 14 ALA A 23 ? ? -179.94 115.00 128 14 ASP A 31 ? ? 39.87 75.77 129 14 TYR A 33 ? ? -40.89 160.57 130 14 PRO A 34 ? ? -69.78 70.39 131 14 ASP A 44 ? ? 44.09 -98.19 132 14 ALA A 50 ? ? 71.52 41.15 133 14 SER A 104 ? ? -179.14 126.83 134 14 ASN A 107 ? ? -176.57 106.31 135 15 PRO A 2 ? ? -69.84 -171.47 136 15 PRO A 13 ? ? -69.72 -174.94 137 15 ALA A 23 ? ? -176.12 105.27 138 15 ASP A 31 ? ? 40.34 72.33 139 15 TYR A 33 ? ? -40.70 160.21 140 15 PRO A 34 ? ? -69.77 70.57 141 15 ASP A 44 ? ? 44.42 -95.74 142 15 PRO A 57 ? ? -69.78 -175.31 143 15 SER A 104 ? ? -178.97 114.39 144 15 SER A 105 ? ? -140.27 57.75 145 15 GLU A 106 ? ? -56.74 -71.39 146 15 ASN A 107 ? ? -165.17 103.78 147 16 PRO A 2 ? ? -69.75 -170.81 148 16 PRO A 13 ? ? -69.82 -173.56 149 16 ALA A 23 ? ? -176.91 113.99 150 16 ASP A 31 ? ? 47.74 74.58 151 16 TYR A 33 ? ? -40.85 161.22 152 16 PRO A 34 ? ? -69.85 70.01 153 16 ASP A 44 ? ? 51.81 -98.84 154 16 LYS A 49 ? ? -39.35 -39.45 155 16 ALA A 50 ? ? 71.07 43.00 156 16 SER A 104 ? ? -52.24 105.40 157 17 PRO A 2 ? ? -69.71 -173.06 158 17 PRO A 13 ? ? -69.79 -176.19 159 17 ALA A 23 ? ? 179.06 107.11 160 17 ASP A 31 ? ? 48.66 74.31 161 17 TYR A 33 ? ? -40.83 160.77 162 17 PRO A 34 ? ? -69.80 69.91 163 17 ASP A 44 ? ? 43.12 -99.67 164 17 GLU A 53 ? ? -164.00 74.80 165 17 PRO A 57 ? ? -69.77 -177.25 166 17 THR A 102 ? ? -157.57 28.59 167 17 GLU A 103 ? ? -113.06 77.66 168 18 PRO A 2 ? ? -69.73 -171.71 169 18 PRO A 13 ? ? -69.75 -175.20 170 18 ALA A 23 ? ? -176.70 113.36 171 18 TYR A 33 ? ? -41.59 161.62 172 18 PRO A 34 ? ? -69.77 70.21 173 18 ASP A 44 ? ? 44.35 -97.12 174 18 SER A 104 ? ? -60.71 -168.69 175 18 GLU A 106 ? ? -58.59 -73.58 176 19 PRO A 2 ? ? -69.78 -175.00 177 19 PRO A 13 ? ? -69.74 -178.02 178 19 ALA A 23 ? ? 172.34 116.45 179 19 ASP A 31 ? ? 47.80 73.55 180 19 TYR A 33 ? ? -41.10 160.62 181 19 PRO A 34 ? ? -69.75 70.68 182 19 ASP A 44 ? ? 43.58 -98.82 183 19 LYS A 49 ? ? -39.93 -38.68 184 19 THR A 56 ? ? -48.36 150.41 185 19 GLU A 106 ? ? -51.99 -73.78 186 19 TYR A 109 ? ? -56.43 -178.73 187 20 PRO A 2 ? ? -69.75 -173.35 188 20 PRO A 13 ? ? -69.80 -179.48 189 20 ALA A 23 ? ? 177.25 115.18 190 20 TYR A 33 ? ? -38.42 158.05 191 20 PRO A 34 ? ? -69.73 71.09 192 20 ASP A 44 ? ? 53.07 -99.12 193 20 ALA A 50 ? ? 70.34 40.85 194 20 PRO A 57 ? ? -69.74 -175.45 195 20 SER A 104 ? ? -178.12 125.13 196 20 GLU A 106 ? ? -60.33 -173.09 # _pdbx_nmr_ensemble.entry_id 8XLC _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8XLC _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.6 mM [U-100% 13C; U-100% 15N] Clamda1 domain of human immunoglobulin, 5 mM NaPi, 50 mM sodium chloride, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label '13C, 15N' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Clamda1 domain of human immunoglobulin' 1.6 ? mM '[U-100% 13C; U-100% 15N]' 1 NaPi 5 ? mM none 1 'sodium chloride' 50 ? mM none # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'Not defined' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label condition_! _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D CBCA(CO)NH' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HNCO' 1 isotropic 10 1 1 '3D HN(CO)CA' 1 isotropic 9 1 1 '3D HNCACO' 1 isotropic 8 1 1 '3D 1H-13C NOESY' 1 isotropic 7 1 1 '3D 1H-15N NOESY' 1 isotropic 6 1 1 '3D 1H-15N TOCSY' 1 isotropic 12 1 1 '3D HBHA(CO)NH' 1 isotropic 11 1 1 '3D C(CO)NH' 1 isotropic 13 1 1 '3D CCH-TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 8XLC _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' 2 'structure calculation' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' 3 'chemical shift assignment' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' 4 'peak picking' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TRP N N N N 298 TRP CA C N S 299 TRP C C N N 300 TRP O O N N 301 TRP CB C N N 302 TRP CG C Y N 303 TRP CD1 C Y N 304 TRP CD2 C Y N 305 TRP NE1 N Y N 306 TRP CE2 C Y N 307 TRP CE3 C Y N 308 TRP CZ2 C Y N 309 TRP CZ3 C Y N 310 TRP CH2 C Y N 311 TRP OXT O N N 312 TRP H H N N 313 TRP H2 H N N 314 TRP HA H N N 315 TRP HB2 H N N 316 TRP HB3 H N N 317 TRP HD1 H N N 318 TRP HE1 H N N 319 TRP HE3 H N N 320 TRP HZ2 H N N 321 TRP HZ3 H N N 322 TRP HH2 H N N 323 TRP HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Education, Culture, Sports, Science and Technology (Japan)' Japan JP22H02755 1 'Japan Agency for Medical Research and Development (AMED)' Japan JP21ae0121020h0001 2 'Japan Agency for Medical Research and Development (AMED)' Japan JP21ae0121013h0301 3 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE NEO' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8XLC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #