data_8YVW # _entry.id 8YVW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8YVW pdb_00008yvw 10.2210/pdb8yvw/pdb WWPDB D_1300042544 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8YVW _pdbx_database_status.recvd_initial_deposition_date 2024-03-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email toyoda.mayuko.8w@kyoto-u.ac.jp _pdbx_contact_author.name_first Mayuko _pdbx_contact_author.name_last Toyoda _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5362-6352 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Toyoda, M.' 1 0000-0002-5362-6352 'Mizutani, K.' 2 0000-0002-1411-5429 'Mikami, B.' 3 0000-0003-0638-8619 'Wackett, L.P.' 4 0000-0002-3255-1101 'Esaki, N.' 5 0000-0001-6559-8355 'Kurihara, T.' 6 0000-0002-7777-1378 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Research for the crystal structure of L-azetidine-2-carboxylate hydrolase' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Toyoda, M.' 1 ? primary 'Jitsumori, K.' 2 ? primary 'Mikami, B.' 3 ? primary 'Mizutani, K.' 4 ? primary 'Esaki, N.' 5 ? primary 'Wackett, L.P.' 6 ? primary 'Kurihara, T.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '(S)-2-haloacid dehalogenase' 27145.578 1 3.8.1.2 D12N ? ? 2 non-polymer syn 'FORMIC ACID' 46.025 2 ? ? ? ? 3 non-polymer syn IMIDAZOLE 69.085 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 water nat water 18.015 485 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '2-haloalkanoic acid dehalogenase,Halocarboxylic acid halidohydrolase,L-2-haloacid dehalogenase,L-azetidine-2-carboxylate hydrolase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MQLTDFKALTFNCYGTLIDWETGIVNALQPLAKRTGKTFTSDELLEVFGRNESPQQTETPGALYQDILRAVYDRIAKEWG LEPDAAEREEFGTSVKNWPAFPDTVEALQYLKKHYKLVILSNIDRNEFKLSNAKLGVEFDHIITAQDVGSYKPNPNNFTY MIDALAKAGIEKKDILHTAESLYHDHIPANDAGLVSAWIYRRHGKEGYGATHVPSRMPNVDFRFNSMGEMAEAHKQALKG ; _entity_poly.pdbx_seq_one_letter_code_can ;MQLTDFKALTFNCYGTLIDWETGIVNALQPLAKRTGKTFTSDELLEVFGRNESPQQTETPGALYQDILRAVYDRIAKEWG LEPDAAEREEFGTSVKNWPAFPDTVEALQYLKKHYKLVILSNIDRNEFKLSNAKLGVEFDHIITAQDVGSYKPNPNNFTY MIDALAKAGIEKKDILHTAESLYHDHIPANDAGLVSAWIYRRHGKEGYGATHVPSRMPNVDFRFNSMGEMAEAHKQALKG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FORMIC ACID' FMT 3 IMIDAZOLE IMD 4 'MAGNESIUM ION' MG 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 LEU n 1 4 THR n 1 5 ASP n 1 6 PHE n 1 7 LYS n 1 8 ALA n 1 9 LEU n 1 10 THR n 1 11 PHE n 1 12 ASN n 1 13 CYS n 1 14 TYR n 1 15 GLY n 1 16 THR n 1 17 LEU n 1 18 ILE n 1 19 ASP n 1 20 TRP n 1 21 GLU n 1 22 THR n 1 23 GLY n 1 24 ILE n 1 25 VAL n 1 26 ASN n 1 27 ALA n 1 28 LEU n 1 29 GLN n 1 30 PRO n 1 31 LEU n 1 32 ALA n 1 33 LYS n 1 34 ARG n 1 35 THR n 1 36 GLY n 1 37 LYS n 1 38 THR n 1 39 PHE n 1 40 THR n 1 41 SER n 1 42 ASP n 1 43 GLU n 1 44 LEU n 1 45 LEU n 1 46 GLU n 1 47 VAL n 1 48 PHE n 1 49 GLY n 1 50 ARG n 1 51 ASN n 1 52 GLU n 1 53 SER n 1 54 PRO n 1 55 GLN n 1 56 GLN n 1 57 THR n 1 58 GLU n 1 59 THR n 1 60 PRO n 1 61 GLY n 1 62 ALA n 1 63 LEU n 1 64 TYR n 1 65 GLN n 1 66 ASP n 1 67 ILE n 1 68 LEU n 1 69 ARG n 1 70 ALA n 1 71 VAL n 1 72 TYR n 1 73 ASP n 1 74 ARG n 1 75 ILE n 1 76 ALA n 1 77 LYS n 1 78 GLU n 1 79 TRP n 1 80 GLY n 1 81 LEU n 1 82 GLU n 1 83 PRO n 1 84 ASP n 1 85 ALA n 1 86 ALA n 1 87 GLU n 1 88 ARG n 1 89 GLU n 1 90 GLU n 1 91 PHE n 1 92 GLY n 1 93 THR n 1 94 SER n 1 95 VAL n 1 96 LYS n 1 97 ASN n 1 98 TRP n 1 99 PRO n 1 100 ALA n 1 101 PHE n 1 102 PRO n 1 103 ASP n 1 104 THR n 1 105 VAL n 1 106 GLU n 1 107 ALA n 1 108 LEU n 1 109 GLN n 1 110 TYR n 1 111 LEU n 1 112 LYS n 1 113 LYS n 1 114 HIS n 1 115 TYR n 1 116 LYS n 1 117 LEU n 1 118 VAL n 1 119 ILE n 1 120 LEU n 1 121 SER n 1 122 ASN n 1 123 ILE n 1 124 ASP n 1 125 ARG n 1 126 ASN n 1 127 GLU n 1 128 PHE n 1 129 LYS n 1 130 LEU n 1 131 SER n 1 132 ASN n 1 133 ALA n 1 134 LYS n 1 135 LEU n 1 136 GLY n 1 137 VAL n 1 138 GLU n 1 139 PHE n 1 140 ASP n 1 141 HIS n 1 142 ILE n 1 143 ILE n 1 144 THR n 1 145 ALA n 1 146 GLN n 1 147 ASP n 1 148 VAL n 1 149 GLY n 1 150 SER n 1 151 TYR n 1 152 LYS n 1 153 PRO n 1 154 ASN n 1 155 PRO n 1 156 ASN n 1 157 ASN n 1 158 PHE n 1 159 THR n 1 160 TYR n 1 161 MET n 1 162 ILE n 1 163 ASP n 1 164 ALA n 1 165 LEU n 1 166 ALA n 1 167 LYS n 1 168 ALA n 1 169 GLY n 1 170 ILE n 1 171 GLU n 1 172 LYS n 1 173 LYS n 1 174 ASP n 1 175 ILE n 1 176 LEU n 1 177 HIS n 1 178 THR n 1 179 ALA n 1 180 GLU n 1 181 SER n 1 182 LEU n 1 183 TYR n 1 184 HIS n 1 185 ASP n 1 186 HIS n 1 187 ILE n 1 188 PRO n 1 189 ALA n 1 190 ASN n 1 191 ASP n 1 192 ALA n 1 193 GLY n 1 194 LEU n 1 195 VAL n 1 196 SER n 1 197 ALA n 1 198 TRP n 1 199 ILE n 1 200 TYR n 1 201 ARG n 1 202 ARG n 1 203 HIS n 1 204 GLY n 1 205 LYS n 1 206 GLU n 1 207 GLY n 1 208 TYR n 1 209 GLY n 1 210 ALA n 1 211 THR n 1 212 HIS n 1 213 VAL n 1 214 PRO n 1 215 SER n 1 216 ARG n 1 217 MET n 1 218 PRO n 1 219 ASN n 1 220 VAL n 1 221 ASP n 1 222 PHE n 1 223 ARG n 1 224 PHE n 1 225 ASN n 1 226 SER n 1 227 MET n 1 228 GLY n 1 229 GLU n 1 230 MET n 1 231 ALA n 1 232 GLU n 1 233 ALA n 1 234 HIS n 1 235 LYS n 1 236 GLN n 1 237 ALA n 1 238 LEU n 1 239 LYS n 1 240 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 240 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas sp. A2C' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 533317 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BLR _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IMD non-polymer . IMIDAZOLE ? 'C3 H5 N2 1' 69.085 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 TRP 98 98 98 TRP TRP A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 PRO 155 155 155 PRO PRO A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 MET 161 161 161 MET MET A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 TYR 183 183 183 TYR TYR A . n A 1 184 HIS 184 184 184 HIS HIS A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 HIS 186 186 186 HIS HIS A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 ASP 191 191 191 ASP ASP A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 TRP 198 198 198 TRP TRP A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 HIS 203 203 203 HIS HIS A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 TYR 208 208 208 TYR TYR A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 HIS 212 212 212 HIS HIS A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 ARG 216 216 216 ARG ARG A . n A 1 217 MET 217 217 217 MET MET A . n A 1 218 PRO 218 218 218 PRO PRO A . n A 1 219 ASN 219 219 219 ASN ASN A . n A 1 220 VAL 220 220 220 VAL VAL A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 PHE 222 222 222 PHE PHE A . n A 1 223 ARG 223 223 223 ARG ARG A . n A 1 224 PHE 224 224 224 PHE PHE A . n A 1 225 ASN 225 225 225 ASN ASN A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 MET 227 227 227 MET MET A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 MET 230 230 230 MET MET A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 HIS 234 234 234 HIS HIS A . n A 1 235 LYS 235 235 235 LYS LYS A . n A 1 236 GLN 236 236 236 GLN GLN A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 GLY 240 240 240 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FMT 1 301 301 FMT FMT A . C 2 FMT 1 302 302 FMT FMT A . D 3 IMD 1 303 401 IMD IMD A . E 4 MG 1 304 501 MG MG A . F 5 HOH 1 401 1281 HOH HOH A . F 5 HOH 2 402 1454 HOH HOH A . F 5 HOH 3 403 1159 HOH HOH A . F 5 HOH 4 404 1062 HOH HOH A . F 5 HOH 5 405 1463 HOH HOH A . F 5 HOH 6 406 1138 HOH HOH A . F 5 HOH 7 407 1285 HOH HOH A . F 5 HOH 8 408 1198 HOH HOH A . F 5 HOH 9 409 1298 HOH HOH A . F 5 HOH 10 410 1217 HOH HOH A . F 5 HOH 11 411 1432 HOH HOH A . F 5 HOH 12 412 1220 HOH HOH A . F 5 HOH 13 413 1186 HOH HOH A . F 5 HOH 14 414 1155 HOH HOH A . F 5 HOH 15 415 1091 HOH HOH A . F 5 HOH 16 416 1266 HOH HOH A . F 5 HOH 17 417 1051 HOH HOH A . F 5 HOH 18 418 1275 HOH HOH A . F 5 HOH 19 419 1136 HOH HOH A . F 5 HOH 20 420 1089 HOH HOH A . F 5 HOH 21 421 1501 HOH HOH A . F 5 HOH 22 422 1078 HOH HOH A . F 5 HOH 23 423 1010 HOH HOH A . F 5 HOH 24 424 1093 HOH HOH A . F 5 HOH 25 425 1231 HOH HOH A . F 5 HOH 26 426 1307 HOH HOH A . F 5 HOH 27 427 1527 HOH HOH A . F 5 HOH 28 428 1178 HOH HOH A . F 5 HOH 29 429 1018 HOH HOH A . F 5 HOH 30 430 1485 HOH HOH A . F 5 HOH 31 431 1030 HOH HOH A . F 5 HOH 32 432 1487 HOH HOH A . F 5 HOH 33 433 1137 HOH HOH A . F 5 HOH 34 434 1073 HOH HOH A . F 5 HOH 35 435 1111 HOH HOH A . F 5 HOH 36 436 1219 HOH HOH A . F 5 HOH 37 437 1510 HOH HOH A . F 5 HOH 38 438 1124 HOH HOH A . F 5 HOH 39 439 1158 HOH HOH A . F 5 HOH 40 440 1286 HOH HOH A . F 5 HOH 41 441 1357 HOH HOH A . F 5 HOH 42 442 1248 HOH HOH A . F 5 HOH 43 443 1181 HOH HOH A . F 5 HOH 44 444 1524 HOH HOH A . F 5 HOH 45 445 1404 HOH HOH A . F 5 HOH 46 446 1096 HOH HOH A . F 5 HOH 47 447 1156 HOH HOH A . F 5 HOH 48 448 1053 HOH HOH A . F 5 HOH 49 449 1473 HOH HOH A . F 5 HOH 50 450 1323 HOH HOH A . F 5 HOH 51 451 1019 HOH HOH A . F 5 HOH 52 452 1534 HOH HOH A . F 5 HOH 53 453 1223 HOH HOH A . F 5 HOH 54 454 1164 HOH HOH A . F 5 HOH 55 455 1288 HOH HOH A . F 5 HOH 56 456 1020 HOH HOH A . F 5 HOH 57 457 1582 HOH HOH A . F 5 HOH 58 458 1129 HOH HOH A . F 5 HOH 59 459 1218 HOH HOH A . F 5 HOH 60 460 1027 HOH HOH A . F 5 HOH 61 461 1193 HOH HOH A . F 5 HOH 62 462 1023 HOH HOH A . F 5 HOH 63 463 1247 HOH HOH A . F 5 HOH 64 464 1002 HOH HOH A . F 5 HOH 65 465 1022 HOH HOH A . F 5 HOH 66 466 1244 HOH HOH A . F 5 HOH 67 467 1117 HOH HOH A . F 5 HOH 68 468 1035 HOH HOH A . F 5 HOH 69 469 1226 HOH HOH A . F 5 HOH 70 470 1007 HOH HOH A . F 5 HOH 71 471 1142 HOH HOH A . F 5 HOH 72 472 1109 HOH HOH A . F 5 HOH 73 473 1052 HOH HOH A . F 5 HOH 74 474 1486 HOH HOH A . F 5 HOH 75 475 1071 HOH HOH A . F 5 HOH 76 476 1315 HOH HOH A . F 5 HOH 77 477 1190 HOH HOH A . F 5 HOH 78 478 1290 HOH HOH A . F 5 HOH 79 479 1482 HOH HOH A . F 5 HOH 80 480 1048 HOH HOH A . F 5 HOH 81 481 1320 HOH HOH A . F 5 HOH 82 482 1265 HOH HOH A . F 5 HOH 83 483 1047 HOH HOH A . F 5 HOH 84 484 1054 HOH HOH A . F 5 HOH 85 485 1139 HOH HOH A . F 5 HOH 86 486 1204 HOH HOH A . F 5 HOH 87 487 1039 HOH HOH A . F 5 HOH 88 488 1478 HOH HOH A . F 5 HOH 89 489 1476 HOH HOH A . F 5 HOH 90 490 1273 HOH HOH A . F 5 HOH 91 491 1133 HOH HOH A . F 5 HOH 92 492 1074 HOH HOH A . F 5 HOH 93 493 1224 HOH HOH A . F 5 HOH 94 494 1511 HOH HOH A . F 5 HOH 95 495 1024 HOH HOH A . F 5 HOH 96 496 1040 HOH HOH A . F 5 HOH 97 497 1058 HOH HOH A . F 5 HOH 98 498 1132 HOH HOH A . F 5 HOH 99 499 1021 HOH HOH A . F 5 HOH 100 500 1112 HOH HOH A . F 5 HOH 101 501 1213 HOH HOH A . F 5 HOH 102 502 1135 HOH HOH A . F 5 HOH 103 503 1279 HOH HOH A . F 5 HOH 104 504 1195 HOH HOH A . F 5 HOH 105 505 1126 HOH HOH A . F 5 HOH 106 506 1292 HOH HOH A . F 5 HOH 107 507 1262 HOH HOH A . F 5 HOH 108 508 1165 HOH HOH A . F 5 HOH 109 509 1026 HOH HOH A . F 5 HOH 110 510 1215 HOH HOH A . F 5 HOH 111 511 1097 HOH HOH A . F 5 HOH 112 512 1280 HOH HOH A . F 5 HOH 113 513 1067 HOH HOH A . F 5 HOH 114 514 1147 HOH HOH A . F 5 HOH 115 515 1271 HOH HOH A . F 5 HOH 116 516 1110 HOH HOH A . F 5 HOH 117 517 1121 HOH HOH A . F 5 HOH 118 518 1090 HOH HOH A . F 5 HOH 119 519 1065 HOH HOH A . F 5 HOH 120 520 1429 HOH HOH A . F 5 HOH 121 521 1144 HOH HOH A . F 5 HOH 122 522 1508 HOH HOH A . F 5 HOH 123 523 1015 HOH HOH A . F 5 HOH 124 524 1367 HOH HOH A . F 5 HOH 125 525 1122 HOH HOH A . F 5 HOH 126 526 1148 HOH HOH A . F 5 HOH 127 527 1316 HOH HOH A . F 5 HOH 128 528 1077 HOH HOH A . F 5 HOH 129 529 1012 HOH HOH A . F 5 HOH 130 530 1130 HOH HOH A . F 5 HOH 131 531 1278 HOH HOH A . F 5 HOH 132 532 1187 HOH HOH A . F 5 HOH 133 533 1041 HOH HOH A . F 5 HOH 134 534 1297 HOH HOH A . F 5 HOH 135 535 1086 HOH HOH A . F 5 HOH 136 536 1120 HOH HOH A . F 5 HOH 137 537 1045 HOH HOH A . F 5 HOH 138 538 1056 HOH HOH A . F 5 HOH 139 539 1426 HOH HOH A . F 5 HOH 140 540 1150 HOH HOH A . F 5 HOH 141 541 1100 HOH HOH A . F 5 HOH 142 542 1140 HOH HOH A . F 5 HOH 143 543 1242 HOH HOH A . F 5 HOH 144 544 1123 HOH HOH A . F 5 HOH 145 545 1267 HOH HOH A . F 5 HOH 146 546 1050 HOH HOH A . F 5 HOH 147 547 1162 HOH HOH A . F 5 HOH 148 548 1351 HOH HOH A . F 5 HOH 149 549 1177 HOH HOH A . F 5 HOH 150 550 1324 HOH HOH A . F 5 HOH 151 551 1025 HOH HOH A . F 5 HOH 152 552 1180 HOH HOH A . F 5 HOH 153 553 1008 HOH HOH A . F 5 HOH 154 554 1521 HOH HOH A . F 5 HOH 155 555 1098 HOH HOH A . F 5 HOH 156 556 1070 HOH HOH A . F 5 HOH 157 557 1003 HOH HOH A . F 5 HOH 158 558 1014 HOH HOH A . F 5 HOH 159 559 1354 HOH HOH A . F 5 HOH 160 560 1192 HOH HOH A . F 5 HOH 161 561 1063 HOH HOH A . F 5 HOH 162 562 1055 HOH HOH A . F 5 HOH 163 563 1168 HOH HOH A . F 5 HOH 164 564 1185 HOH HOH A . F 5 HOH 165 565 1477 HOH HOH A . F 5 HOH 166 566 1475 HOH HOH A . F 5 HOH 167 567 1046 HOH HOH A . F 5 HOH 168 568 1294 HOH HOH A . F 5 HOH 169 569 1034 HOH HOH A . F 5 HOH 170 570 1115 HOH HOH A . F 5 HOH 171 571 1269 HOH HOH A . F 5 HOH 172 572 1274 HOH HOH A . F 5 HOH 173 573 1166 HOH HOH A . F 5 HOH 174 574 1210 HOH HOH A . F 5 HOH 175 575 1240 HOH HOH A . F 5 HOH 176 576 1268 HOH HOH A . F 5 HOH 177 577 1017 HOH HOH A . F 5 HOH 178 578 1239 HOH HOH A . F 5 HOH 179 579 1107 HOH HOH A . F 5 HOH 180 580 1101 HOH HOH A . F 5 HOH 181 581 1066 HOH HOH A . F 5 HOH 182 582 1004 HOH HOH A . F 5 HOH 183 583 1103 HOH HOH A . F 5 HOH 184 584 1061 HOH HOH A . F 5 HOH 185 585 1282 HOH HOH A . F 5 HOH 186 586 1128 HOH HOH A . F 5 HOH 187 587 1104 HOH HOH A . F 5 HOH 188 588 1044 HOH HOH A . F 5 HOH 189 589 1146 HOH HOH A . F 5 HOH 190 590 1005 HOH HOH A . F 5 HOH 191 591 1472 HOH HOH A . F 5 HOH 192 592 1011 HOH HOH A . F 5 HOH 193 593 1057 HOH HOH A . F 5 HOH 194 594 1031 HOH HOH A . F 5 HOH 195 595 1586 HOH HOH A . F 5 HOH 196 596 1016 HOH HOH A . F 5 HOH 197 597 1407 HOH HOH A . F 5 HOH 198 598 1513 HOH HOH A . F 5 HOH 199 599 1013 HOH HOH A . F 5 HOH 200 600 1209 HOH HOH A . F 5 HOH 201 601 1250 HOH HOH A . F 5 HOH 202 602 1191 HOH HOH A . F 5 HOH 203 603 1335 HOH HOH A . F 5 HOH 204 604 1207 HOH HOH A . F 5 HOH 205 605 1331 HOH HOH A . F 5 HOH 206 606 1157 HOH HOH A . F 5 HOH 207 607 1474 HOH HOH A . F 5 HOH 208 608 1049 HOH HOH A . F 5 HOH 209 609 1525 HOH HOH A . F 5 HOH 210 610 1183 HOH HOH A . F 5 HOH 211 611 1028 HOH HOH A . F 5 HOH 212 612 1106 HOH HOH A . F 5 HOH 213 613 1095 HOH HOH A . F 5 HOH 214 614 1119 HOH HOH A . F 5 HOH 215 615 1519 HOH HOH A . F 5 HOH 216 616 1523 HOH HOH A . F 5 HOH 217 617 1042 HOH HOH A . F 5 HOH 218 618 1038 HOH HOH A . F 5 HOH 219 619 1182 HOH HOH A . F 5 HOH 220 620 1203 HOH HOH A . F 5 HOH 221 621 1322 HOH HOH A . F 5 HOH 222 622 1075 HOH HOH A . F 5 HOH 223 623 1131 HOH HOH A . F 5 HOH 224 624 1099 HOH HOH A . F 5 HOH 225 625 1092 HOH HOH A . F 5 HOH 226 626 1036 HOH HOH A . F 5 HOH 227 627 1422 HOH HOH A . F 5 HOH 228 628 1009 HOH HOH A . F 5 HOH 229 629 1196 HOH HOH A . F 5 HOH 230 630 1037 HOH HOH A . F 5 HOH 231 631 1249 HOH HOH A . F 5 HOH 232 632 1264 HOH HOH A . F 5 HOH 233 633 1154 HOH HOH A . F 5 HOH 234 634 1006 HOH HOH A . F 5 HOH 235 635 1202 HOH HOH A . F 5 HOH 236 636 1425 HOH HOH A . F 5 HOH 237 637 1583 HOH HOH A . F 5 HOH 238 638 1212 HOH HOH A . F 5 HOH 239 639 1311 HOH HOH A . F 5 HOH 240 640 1352 HOH HOH A . F 5 HOH 241 641 1449 HOH HOH A . F 5 HOH 242 642 1589 HOH HOH A . F 5 HOH 243 643 1064 HOH HOH A . F 5 HOH 244 644 1033 HOH HOH A . F 5 HOH 245 645 1575 HOH HOH A . F 5 HOH 246 646 1080 HOH HOH A . F 5 HOH 247 647 1199 HOH HOH A . F 5 HOH 248 648 1068 HOH HOH A . F 5 HOH 249 649 1310 HOH HOH A . F 5 HOH 250 650 1116 HOH HOH A . F 5 HOH 251 651 1134 HOH HOH A . F 5 HOH 252 652 1270 HOH HOH A . F 5 HOH 253 653 1043 HOH HOH A . F 5 HOH 254 654 1528 HOH HOH A . F 5 HOH 255 655 1460 HOH HOH A . F 5 HOH 256 656 1214 HOH HOH A . F 5 HOH 257 657 1401 HOH HOH A . F 5 HOH 258 658 1526 HOH HOH A . F 5 HOH 259 659 1076 HOH HOH A . F 5 HOH 260 660 1197 HOH HOH A . F 5 HOH 261 661 1229 HOH HOH A . F 5 HOH 262 662 1245 HOH HOH A . F 5 HOH 263 663 1291 HOH HOH A . F 5 HOH 264 664 1118 HOH HOH A . F 5 HOH 265 665 1113 HOH HOH A . F 5 HOH 266 666 1312 HOH HOH A . F 5 HOH 267 667 1161 HOH HOH A . F 5 HOH 268 668 1309 HOH HOH A . F 5 HOH 269 669 1216 HOH HOH A . F 5 HOH 270 670 1179 HOH HOH A . F 5 HOH 271 671 1001 HOH HOH A . F 5 HOH 272 672 1509 HOH HOH A . F 5 HOH 273 673 1296 HOH HOH A . F 5 HOH 274 674 1461 HOH HOH A . F 5 HOH 275 675 1313 HOH HOH A . F 5 HOH 276 676 1208 HOH HOH A . F 5 HOH 277 677 1145 HOH HOH A . F 5 HOH 278 678 1085 HOH HOH A . F 5 HOH 279 679 1295 HOH HOH A . F 5 HOH 280 680 1225 HOH HOH A . F 5 HOH 281 681 1108 HOH HOH A . F 5 HOH 282 682 1353 HOH HOH A . F 5 HOH 283 683 1538 HOH HOH A . F 5 HOH 284 684 1060 HOH HOH A . F 5 HOH 285 685 1174 HOH HOH A . F 5 HOH 286 686 1516 HOH HOH A . F 5 HOH 287 687 1105 HOH HOH A . F 5 HOH 288 688 1452 HOH HOH A . F 5 HOH 289 689 1465 HOH HOH A . F 5 HOH 290 690 1355 HOH HOH A . F 5 HOH 291 691 1114 HOH HOH A . F 5 HOH 292 692 1314 HOH HOH A . F 5 HOH 293 693 1536 HOH HOH A . F 5 HOH 294 694 1238 HOH HOH A . F 5 HOH 295 695 1503 HOH HOH A . F 5 HOH 296 696 1032 HOH HOH A . F 5 HOH 297 697 1581 HOH HOH A . F 5 HOH 298 698 1072 HOH HOH A . F 5 HOH 299 699 1102 HOH HOH A . F 5 HOH 300 700 1302 HOH HOH A . F 5 HOH 301 701 1084 HOH HOH A . F 5 HOH 302 702 1236 HOH HOH A . F 5 HOH 303 703 1261 HOH HOH A . F 5 HOH 304 704 1287 HOH HOH A . F 5 HOH 305 705 1149 HOH HOH A . F 5 HOH 306 706 1382 HOH HOH A . F 5 HOH 307 707 1284 HOH HOH A . F 5 HOH 308 708 1263 HOH HOH A . F 5 HOH 309 709 1233 HOH HOH A . F 5 HOH 310 710 1379 HOH HOH A . F 5 HOH 311 711 1385 HOH HOH A . F 5 HOH 312 712 1571 HOH HOH A . F 5 HOH 313 713 1467 HOH HOH A . F 5 HOH 314 714 1362 HOH HOH A . F 5 HOH 315 715 1206 HOH HOH A . F 5 HOH 316 716 1346 HOH HOH A . F 5 HOH 317 717 1211 HOH HOH A . F 5 HOH 318 718 1405 HOH HOH A . F 5 HOH 319 719 1471 HOH HOH A . F 5 HOH 320 720 1221 HOH HOH A . F 5 HOH 321 721 1326 HOH HOH A . F 5 HOH 322 722 1081 HOH HOH A . F 5 HOH 323 723 1402 HOH HOH A . F 5 HOH 324 724 1304 HOH HOH A . F 5 HOH 325 725 1356 HOH HOH A . F 5 HOH 326 726 1301 HOH HOH A . F 5 HOH 327 727 1079 HOH HOH A . F 5 HOH 328 728 1372 HOH HOH A . F 5 HOH 329 729 1457 HOH HOH A . F 5 HOH 330 730 1082 HOH HOH A . F 5 HOH 331 731 1276 HOH HOH A . F 5 HOH 332 732 1570 HOH HOH A . F 5 HOH 333 733 1319 HOH HOH A . F 5 HOH 334 734 1376 HOH HOH A . F 5 HOH 335 735 1151 HOH HOH A . F 5 HOH 336 736 1578 HOH HOH A . F 5 HOH 337 737 1430 HOH HOH A . F 5 HOH 338 738 1492 HOH HOH A . F 5 HOH 339 739 1341 HOH HOH A . F 5 HOH 340 740 1375 HOH HOH A . F 5 HOH 341 741 1483 HOH HOH A . F 5 HOH 342 742 1171 HOH HOH A . F 5 HOH 343 743 1160 HOH HOH A . F 5 HOH 344 744 1551 HOH HOH A . F 5 HOH 345 745 1283 HOH HOH A . F 5 HOH 346 746 1342 HOH HOH A . F 5 HOH 347 747 1205 HOH HOH A . F 5 HOH 348 748 1393 HOH HOH A . F 5 HOH 349 749 1469 HOH HOH A . F 5 HOH 350 750 1175 HOH HOH A . F 5 HOH 351 751 1184 HOH HOH A . F 5 HOH 352 752 1087 HOH HOH A . F 5 HOH 353 753 1254 HOH HOH A . F 5 HOH 354 754 1468 HOH HOH A . F 5 HOH 355 755 1380 HOH HOH A . F 5 HOH 356 756 1377 HOH HOH A . F 5 HOH 357 757 1591 HOH HOH A . F 5 HOH 358 758 1366 HOH HOH A . F 5 HOH 359 759 1496 HOH HOH A . F 5 HOH 360 760 1253 HOH HOH A . F 5 HOH 361 761 1395 HOH HOH A . F 5 HOH 362 762 1176 HOH HOH A . F 5 HOH 363 763 1361 HOH HOH A . F 5 HOH 364 764 1345 HOH HOH A . F 5 HOH 365 765 1545 HOH HOH A . F 5 HOH 366 766 1029 HOH HOH A . F 5 HOH 367 767 1228 HOH HOH A . F 5 HOH 368 768 1277 HOH HOH A . F 5 HOH 369 769 1398 HOH HOH A . F 5 HOH 370 770 1462 HOH HOH A . F 5 HOH 371 771 1308 HOH HOH A . F 5 HOH 372 772 1381 HOH HOH A . F 5 HOH 373 773 1403 HOH HOH A . F 5 HOH 374 774 1222 HOH HOH A . F 5 HOH 375 775 1241 HOH HOH A . F 5 HOH 376 776 1272 HOH HOH A . F 5 HOH 377 777 1059 HOH HOH A . F 5 HOH 378 778 1303 HOH HOH A . F 5 HOH 379 779 1574 HOH HOH A . F 5 HOH 380 780 1386 HOH HOH A . F 5 HOH 381 781 1260 HOH HOH A . F 5 HOH 382 782 1428 HOH HOH A . F 5 HOH 383 783 1392 HOH HOH A . F 5 HOH 384 784 1507 HOH HOH A . F 5 HOH 385 785 1232 HOH HOH A . F 5 HOH 386 786 1588 HOH HOH A . F 5 HOH 387 787 1374 HOH HOH A . F 5 HOH 388 788 1083 HOH HOH A . F 5 HOH 389 789 1363 HOH HOH A . F 5 HOH 390 790 1153 HOH HOH A . F 5 HOH 391 791 1306 HOH HOH A . F 5 HOH 392 792 1163 HOH HOH A . F 5 HOH 393 793 1167 HOH HOH A . F 5 HOH 394 794 1339 HOH HOH A . F 5 HOH 395 795 1252 HOH HOH A . F 5 HOH 396 796 1348 HOH HOH A . F 5 HOH 397 797 1584 HOH HOH A . F 5 HOH 398 798 1170 HOH HOH A . F 5 HOH 399 799 1389 HOH HOH A . F 5 HOH 400 800 1172 HOH HOH A . F 5 HOH 401 801 1251 HOH HOH A . F 5 HOH 402 802 1173 HOH HOH A . F 5 HOH 403 803 1431 HOH HOH A . F 5 HOH 404 804 1305 HOH HOH A . F 5 HOH 405 805 1500 HOH HOH A . F 5 HOH 406 806 1572 HOH HOH A . F 5 HOH 407 807 1371 HOH HOH A . F 5 HOH 408 808 1200 HOH HOH A . F 5 HOH 409 809 1502 HOH HOH A . F 5 HOH 410 810 1378 HOH HOH A . F 5 HOH 411 811 1455 HOH HOH A . F 5 HOH 412 812 1418 HOH HOH A . F 5 HOH 413 813 1328 HOH HOH A . F 5 HOH 414 814 1234 HOH HOH A . F 5 HOH 415 815 1590 HOH HOH A . F 5 HOH 416 816 1456 HOH HOH A . F 5 HOH 417 817 1573 HOH HOH A . F 5 HOH 418 818 1423 HOH HOH A . F 5 HOH 419 819 1576 HOH HOH A . F 5 HOH 420 820 1384 HOH HOH A . F 5 HOH 421 821 1359 HOH HOH A . F 5 HOH 422 822 1127 HOH HOH A . F 5 HOH 423 823 1169 HOH HOH A . F 5 HOH 424 824 1490 HOH HOH A . F 5 HOH 425 825 1495 HOH HOH A . F 5 HOH 426 826 1235 HOH HOH A . F 5 HOH 427 827 1125 HOH HOH A . F 5 HOH 428 828 1360 HOH HOH A . F 5 HOH 429 829 1141 HOH HOH A . F 5 HOH 430 830 1246 HOH HOH A . F 5 HOH 431 831 1518 HOH HOH A . F 5 HOH 432 832 1369 HOH HOH A . F 5 HOH 433 833 1255 HOH HOH A . F 5 HOH 434 834 1397 HOH HOH A . F 5 HOH 435 835 1227 HOH HOH A . F 5 HOH 436 836 1143 HOH HOH A . F 5 HOH 437 837 1152 HOH HOH A . F 5 HOH 438 838 1189 HOH HOH A . F 5 HOH 439 839 1188 HOH HOH A . F 5 HOH 440 840 1340 HOH HOH A . F 5 HOH 441 841 1094 HOH HOH A . F 5 HOH 442 842 1585 HOH HOH A . F 5 HOH 443 843 1579 HOH HOH A . F 5 HOH 444 844 1409 HOH HOH A . F 5 HOH 445 845 1497 HOH HOH A . F 5 HOH 446 846 1498 HOH HOH A . F 5 HOH 447 847 1325 HOH HOH A . F 5 HOH 448 848 1373 HOH HOH A . F 5 HOH 449 849 1464 HOH HOH A . F 5 HOH 450 850 1243 HOH HOH A . F 5 HOH 451 851 1391 HOH HOH A . F 5 HOH 452 852 1441 HOH HOH A . F 5 HOH 453 853 1506 HOH HOH A . F 5 HOH 454 854 1499 HOH HOH A . F 5 HOH 455 855 1504 HOH HOH A . F 5 HOH 456 856 1520 HOH HOH A . F 5 HOH 457 857 1338 HOH HOH A . F 5 HOH 458 858 1257 HOH HOH A . F 5 HOH 459 859 1370 HOH HOH A . F 5 HOH 460 860 1349 HOH HOH A . F 5 HOH 461 861 1383 HOH HOH A . F 5 HOH 462 862 1436 HOH HOH A . F 5 HOH 463 863 1201 HOH HOH A . F 5 HOH 464 864 1259 HOH HOH A . F 5 HOH 465 865 1258 HOH HOH A . F 5 HOH 466 866 1453 HOH HOH A . F 5 HOH 467 867 1444 HOH HOH A . F 5 HOH 468 868 1427 HOH HOH A . F 5 HOH 469 869 1522 HOH HOH A . F 5 HOH 470 870 1414 HOH HOH A . F 5 HOH 471 871 1387 HOH HOH A . F 5 HOH 472 872 1438 HOH HOH A . F 5 HOH 473 873 1458 HOH HOH A . F 5 HOH 474 874 1390 HOH HOH A . F 5 HOH 475 875 1580 HOH HOH A . F 5 HOH 476 876 1343 HOH HOH A . F 5 HOH 477 877 1256 HOH HOH A . F 5 HOH 478 878 1365 HOH HOH A . F 5 HOH 479 879 1466 HOH HOH A . F 5 HOH 480 880 1587 HOH HOH A . F 5 HOH 481 881 1517 HOH HOH A . F 5 HOH 482 882 1433 HOH HOH A . F 5 HOH 483 883 1408 HOH HOH A . F 5 HOH 484 884 1424 HOH HOH A . F 5 HOH 485 885 1406 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8YVW _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.176 _cell.length_a_esd ? _cell.length_b 71.361 _cell.length_b_esd ? _cell.length_c 72.349 _cell.length_c_esd ? _cell.volume 243564.828 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8YVW _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8YVW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG 3350, 0.1M magnesium formate, 0.1 M imidazole/HCl buffer, pH8.0, 5 mM L-azetidine-2-carboxylate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU JUPITER 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2009-03-08 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL38B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL38B1 _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 9.54 _reflns.entry_id 8YVW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.19 _reflns.d_resolution_low 39.52 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 76136 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 37.06 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.037 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.19 _reflns_shell.d_res_low 1.26 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.26 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 10019 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.3 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.334 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.946 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 78.7 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 13.63 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8YVW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.19 _refine.ls_d_res_low 20.38 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 76125 _refine.ls_number_reflns_R_free 3807 _refine.ls_number_reflns_R_work 72318 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.37 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1199 _refine.ls_R_factor_R_free 0.1450 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1186 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3SMV _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 12.5303 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1008 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.19 _refine_hist.d_res_low 20.38 _refine_hist.number_atoms_solvent 485 _refine_hist.number_atoms_total 2412 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1915 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0085 ? 2125 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.1331 ? 2898 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0945 ? 306 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0110 ? 384 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.0028 ? 827 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.19 1.20 . . 98 1849 67.28 . . . . 0.2388 . . . . . . . . . . . 0.2683 'X-RAY DIFFRACTION' 1.20 1.22 . . 107 2048 73.17 . . . . 0.2085 . . . . . . . . . . . 0.2247 'X-RAY DIFFRACTION' 1.22 1.23 . . 117 2208 79.81 . . . . 0.1565 . . . . . . . . . . . 0.2133 'X-RAY DIFFRACTION' 1.23 1.25 . . 128 2446 88.58 . . . . 0.1505 . . . . . . . . . . . 0.1963 'X-RAY DIFFRACTION' 1.25 1.27 . . 140 2662 95.24 . . . . 0.1307 . . . . . . . . . . . 0.1628 'X-RAY DIFFRACTION' 1.27 1.29 . . 142 2689 97.52 . . . . 0.1311 . . . . . . . . . . . 0.1834 'X-RAY DIFFRACTION' 1.29 1.31 . . 144 2726 97.35 . . . . 0.1181 . . . . . . . . . . . 0.1432 'X-RAY DIFFRACTION' 1.31 1.33 . . 142 2701 97.56 . . . . 0.1122 . . . . . . . . . . . 0.1481 'X-RAY DIFFRACTION' 1.33 1.36 . . 143 2714 97.44 . . . . 0.1068 . . . . . . . . . . . 0.1470 'X-RAY DIFFRACTION' 1.36 1.38 . . 143 2719 97.78 . . . . 0.1038 . . . . . . . . . . . 0.1362 'X-RAY DIFFRACTION' 1.38 1.41 . . 143 2714 98.01 . . . . 0.1093 . . . . . . . . . . . 0.1419 'X-RAY DIFFRACTION' 1.41 1.44 . . 143 2730 97.85 . . . . 0.1141 . . . . . . . . . . . 0.1427 'X-RAY DIFFRACTION' 1.44 1.48 . . 147 2782 98.22 . . . . 0.1168 . . . . . . . . . . . 0.1493 'X-RAY DIFFRACTION' 1.48 1.51 . . 143 2723 98.49 . . . . 0.1071 . . . . . . . . . . . 0.1438 'X-RAY DIFFRACTION' 1.51 1.55 . . 144 2742 98.60 . . . . 0.0899 . . . . . . . . . . . 0.1313 'X-RAY DIFFRACTION' 1.55 1.60 . . 146 2764 98.54 . . . . 0.0920 . . . . . . . . . . . 0.1321 'X-RAY DIFFRACTION' 1.60 1.65 . . 145 2765 98.68 . . . . 0.0921 . . . . . . . . . . . 0.1317 'X-RAY DIFFRACTION' 1.65 1.71 . . 146 2770 99.32 . . . . 0.0963 . . . . . . . . . . . 0.1295 'X-RAY DIFFRACTION' 1.71 1.78 . . 146 2781 98.95 . . . . 0.1021 . . . . . . . . . . . 0.1203 'X-RAY DIFFRACTION' 1.78 1.86 . . 147 2783 99.09 . . . . 0.1108 . . . . . . . . . . . 0.1415 'X-RAY DIFFRACTION' 1.86 1.96 . . 148 2812 99.13 . . . . 0.1249 . . . . . . . . . . . 0.1634 'X-RAY DIFFRACTION' 1.96 2.08 . . 147 2790 99.36 . . . . 0.1126 . . . . . . . . . . . 0.1650 'X-RAY DIFFRACTION' 2.08 2.24 . . 149 2835 99.53 . . . . 0.1148 . . . . . . . . . . . 0.1424 'X-RAY DIFFRACTION' 2.24 2.46 . . 149 2833 99.73 . . . . 0.1284 . . . . . . . . . . . 0.1399 'X-RAY DIFFRACTION' 2.46 2.82 . . 150 2845 99.47 . . . . 0.1267 . . . . . . . . . . . 0.1415 'X-RAY DIFFRACTION' 2.82 3.55 . . 151 2880 99.64 . . . . 0.1237 . . . . . . . . . . . 0.1408 'X-RAY DIFFRACTION' 3.55 20.38 . . 159 3007 99.28 . . . . 0.1220 . . . . . . . . . . . 0.1304 # _struct.entry_id 8YVW _struct.title 'Crystal structure of D12N mutant of L-azetidine-2-carboxylate hydrolase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8YVW _struct_keywords.text 'azetidine-2-carboxylate, dehalogenase, alpha/beta hydrolase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2Z3V8_9PSED _struct_ref.pdbx_db_accession B2Z3V8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQLTDFKALTFDCYGTLIDWETGIVNALQPLAKRTGKTFTSDELLEVFGRNESPQQTETPGALYQDILRAVYDRIAKEWG LEPDAAEREEFGTSVKNWPAFPDTVEALQYLKKHYKLVILSNIDRNEFKLSNAKLGVEFDHIITAQDVGSYKPNPNNFTY MIDALAKAGIEKKDILHTAESLYHDHIPANDAGLVSAWIYRRHGKEGYGATHVPSRMPNVDFRFNSMGEMAEAHKQALKG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8YVW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B2Z3V8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 240 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 240 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8YVW _struct_ref_seq_dif.mon_id ASN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 12 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code B2Z3V8 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 12 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 12 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 590 ? 1 MORE -1 ? 1 'SSA (A^2)' 10690 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 2 ? PHE A 6 ? GLN A 2 PHE A 6 5 ? 5 HELX_P HELX_P2 AA2 ASP A 19 ? LEU A 28 ? ASP A 19 LEU A 28 1 ? 10 HELX_P HELX_P3 AA3 LEU A 28 ? THR A 35 ? LEU A 28 THR A 35 1 ? 8 HELX_P HELX_P4 AA4 THR A 40 ? ARG A 50 ? THR A 40 ARG A 50 1 ? 11 HELX_P HELX_P5 AA5 ASN A 51 ? THR A 59 ? ASN A 51 THR A 59 1 ? 9 HELX_P HELX_P6 AA6 LEU A 63 ? TRP A 79 ? LEU A 63 TRP A 79 1 ? 17 HELX_P HELX_P7 AA7 ASP A 84 ? THR A 93 ? ASP A 84 THR A 93 1 ? 10 HELX_P HELX_P8 AA8 SER A 94 ? TRP A 98 ? SER A 94 TRP A 98 5 ? 5 HELX_P HELX_P9 AA9 ASP A 103 ? LYS A 113 ? ASP A 103 LYS A 113 1 ? 11 HELX_P HELX_P10 AB1 ASP A 124 ? ALA A 133 ? ASP A 124 ALA A 133 1 ? 10 HELX_P HELX_P11 AB2 ALA A 145 ? GLY A 149 ? ALA A 145 GLY A 149 1 ? 5 HELX_P HELX_P12 AB3 ASN A 154 ? ALA A 168 ? ASN A 154 ALA A 168 1 ? 15 HELX_P HELX_P13 AB4 GLU A 171 ? LYS A 173 ? GLU A 171 LYS A 173 5 ? 3 HELX_P HELX_P14 AB5 ASP A 185 ? ALA A 192 ? ASP A 185 ALA A 192 1 ? 8 HELX_P HELX_P15 AB6 SER A 226 ? LEU A 238 ? SER A 226 LEU A 238 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id GLU _struct_conn.ptnr1_label_seq_id 58 _struct_conn.ptnr1_label_atom_id OE2 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id E _struct_conn.ptnr2_label_comp_id MG _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id MG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id GLU _struct_conn.ptnr1_auth_seq_id 58 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id MG _struct_conn.ptnr2_auth_seq_id 304 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.106 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 152 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 152 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 153 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 153 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 14.54 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 141 ? THR A 144 ? HIS A 141 THR A 144 AA1 2 LYS A 116 ? SER A 121 ? LYS A 116 SER A 121 AA1 3 ALA A 8 ? PHE A 11 ? ALA A 8 PHE A 11 AA1 4 ILE A 175 ? ALA A 179 ? ILE A 175 ALA A 179 AA1 5 VAL A 195 ? ILE A 199 ? VAL A 195 ILE A 199 AA1 6 PHE A 222 ? PHE A 224 ? PHE A 222 PHE A 224 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 143 ? O ILE A 143 N ILE A 119 ? N ILE A 119 AA1 2 3 O LEU A 120 ? O LEU A 120 N PHE A 11 ? N PHE A 11 AA1 3 4 N THR A 10 ? N THR A 10 O THR A 178 ? O THR A 178 AA1 4 5 N HIS A 177 ? N HIS A 177 O ALA A 197 ? O ALA A 197 AA1 5 6 N TRP A 198 ? N TRP A 198 O PHE A 222 ? O PHE A 222 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id CYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 13 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -95.05 _pdbx_validate_torsion.psi -61.96 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 PHE _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 11 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASN _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 12 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 147.72 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # _pdbx_entry_details.entry_id 8YVW _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 870 ? 5.93 . 2 1 O ? A HOH 871 ? 6.00 . 3 1 O ? A HOH 872 ? 6.05 . 4 1 O ? A HOH 873 ? 6.07 . 5 1 O ? A HOH 874 ? 6.13 . 6 1 O ? A HOH 875 ? 6.48 . 7 1 O ? A HOH 876 ? 6.55 . 8 1 O ? A HOH 877 ? 6.62 . 9 1 O ? A HOH 878 ? 6.64 . 10 1 O ? A HOH 879 ? 6.67 . 11 1 O ? A HOH 880 ? 6.72 . 12 1 O ? A HOH 881 ? 6.88 . 13 1 O ? A HOH 882 ? 7.82 . 14 1 O ? A HOH 883 ? 7.90 . 15 1 O ? A HOH 884 ? 8.02 . 16 1 O ? A HOH 885 ? 9.49 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FMT C C N N 88 FMT O1 O N N 89 FMT O2 O N N 90 FMT H H N N 91 FMT HO2 H N N 92 GLN N N N N 93 GLN CA C N S 94 GLN C C N N 95 GLN O O N N 96 GLN CB C N N 97 GLN CG C N N 98 GLN CD C N N 99 GLN OE1 O N N 100 GLN NE2 N N N 101 GLN OXT O N N 102 GLN H H N N 103 GLN H2 H N N 104 GLN HA H N N 105 GLN HB2 H N N 106 GLN HB3 H N N 107 GLN HG2 H N N 108 GLN HG3 H N N 109 GLN HE21 H N N 110 GLN HE22 H N N 111 GLN HXT H N N 112 GLU N N N N 113 GLU CA C N S 114 GLU C C N N 115 GLU O O N N 116 GLU CB C N N 117 GLU CG C N N 118 GLU CD C N N 119 GLU OE1 O N N 120 GLU OE2 O N N 121 GLU OXT O N N 122 GLU H H N N 123 GLU H2 H N N 124 GLU HA H N N 125 GLU HB2 H N N 126 GLU HB3 H N N 127 GLU HG2 H N N 128 GLU HG3 H N N 129 GLU HE2 H N N 130 GLU HXT H N N 131 GLY N N N N 132 GLY CA C N N 133 GLY C C N N 134 GLY O O N N 135 GLY OXT O N N 136 GLY H H N N 137 GLY H2 H N N 138 GLY HA2 H N N 139 GLY HA3 H N N 140 GLY HXT H N N 141 HIS N N N N 142 HIS CA C N S 143 HIS C C N N 144 HIS O O N N 145 HIS CB C N N 146 HIS CG C Y N 147 HIS ND1 N Y N 148 HIS CD2 C Y N 149 HIS CE1 C Y N 150 HIS NE2 N Y N 151 HIS OXT O N N 152 HIS H H N N 153 HIS H2 H N N 154 HIS HA H N N 155 HIS HB2 H N N 156 HIS HB3 H N N 157 HIS HD1 H N N 158 HIS HD2 H N N 159 HIS HE1 H N N 160 HIS HE2 H N N 161 HIS HXT H N N 162 HOH O O N N 163 HOH H1 H N N 164 HOH H2 H N N 165 ILE N N N N 166 ILE CA C N S 167 ILE C C N N 168 ILE O O N N 169 ILE CB C N S 170 ILE CG1 C N N 171 ILE CG2 C N N 172 ILE CD1 C N N 173 ILE OXT O N N 174 ILE H H N N 175 ILE H2 H N N 176 ILE HA H N N 177 ILE HB H N N 178 ILE HG12 H N N 179 ILE HG13 H N N 180 ILE HG21 H N N 181 ILE HG22 H N N 182 ILE HG23 H N N 183 ILE HD11 H N N 184 ILE HD12 H N N 185 ILE HD13 H N N 186 ILE HXT H N N 187 IMD N1 N Y N 188 IMD C2 C Y N 189 IMD N3 N Y N 190 IMD C4 C Y N 191 IMD C5 C Y N 192 IMD HN1 H N N 193 IMD H2 H N N 194 IMD HN3 H N N 195 IMD H4 H N N 196 IMD H5 H N N 197 LEU N N N N 198 LEU CA C N S 199 LEU C C N N 200 LEU O O N N 201 LEU CB C N N 202 LEU CG C N N 203 LEU CD1 C N N 204 LEU CD2 C N N 205 LEU OXT O N N 206 LEU H H N N 207 LEU H2 H N N 208 LEU HA H N N 209 LEU HB2 H N N 210 LEU HB3 H N N 211 LEU HG H N N 212 LEU HD11 H N N 213 LEU HD12 H N N 214 LEU HD13 H N N 215 LEU HD21 H N N 216 LEU HD22 H N N 217 LEU HD23 H N N 218 LEU HXT H N N 219 LYS N N N N 220 LYS CA C N S 221 LYS C C N N 222 LYS O O N N 223 LYS CB C N N 224 LYS CG C N N 225 LYS CD C N N 226 LYS CE C N N 227 LYS NZ N N N 228 LYS OXT O N N 229 LYS H H N N 230 LYS H2 H N N 231 LYS HA H N N 232 LYS HB2 H N N 233 LYS HB3 H N N 234 LYS HG2 H N N 235 LYS HG3 H N N 236 LYS HD2 H N N 237 LYS HD3 H N N 238 LYS HE2 H N N 239 LYS HE3 H N N 240 LYS HZ1 H N N 241 LYS HZ2 H N N 242 LYS HZ3 H N N 243 LYS HXT H N N 244 MET N N N N 245 MET CA C N S 246 MET C C N N 247 MET O O N N 248 MET CB C N N 249 MET CG C N N 250 MET SD S N N 251 MET CE C N N 252 MET OXT O N N 253 MET H H N N 254 MET H2 H N N 255 MET HA H N N 256 MET HB2 H N N 257 MET HB3 H N N 258 MET HG2 H N N 259 MET HG3 H N N 260 MET HE1 H N N 261 MET HE2 H N N 262 MET HE3 H N N 263 MET HXT H N N 264 MG MG MG N N 265 PHE N N N N 266 PHE CA C N S 267 PHE C C N N 268 PHE O O N N 269 PHE CB C N N 270 PHE CG C Y N 271 PHE CD1 C Y N 272 PHE CD2 C Y N 273 PHE CE1 C Y N 274 PHE CE2 C Y N 275 PHE CZ C Y N 276 PHE OXT O N N 277 PHE H H N N 278 PHE H2 H N N 279 PHE HA H N N 280 PHE HB2 H N N 281 PHE HB3 H N N 282 PHE HD1 H N N 283 PHE HD2 H N N 284 PHE HE1 H N N 285 PHE HE2 H N N 286 PHE HZ H N N 287 PHE HXT H N N 288 PRO N N N N 289 PRO CA C N S 290 PRO C C N N 291 PRO O O N N 292 PRO CB C N N 293 PRO CG C N N 294 PRO CD C N N 295 PRO OXT O N N 296 PRO H H N N 297 PRO HA H N N 298 PRO HB2 H N N 299 PRO HB3 H N N 300 PRO HG2 H N N 301 PRO HG3 H N N 302 PRO HD2 H N N 303 PRO HD3 H N N 304 PRO HXT H N N 305 SER N N N N 306 SER CA C N S 307 SER C C N N 308 SER O O N N 309 SER CB C N N 310 SER OG O N N 311 SER OXT O N N 312 SER H H N N 313 SER H2 H N N 314 SER HA H N N 315 SER HB2 H N N 316 SER HB3 H N N 317 SER HG H N N 318 SER HXT H N N 319 THR N N N N 320 THR CA C N S 321 THR C C N N 322 THR O O N N 323 THR CB C N R 324 THR OG1 O N N 325 THR CG2 C N N 326 THR OXT O N N 327 THR H H N N 328 THR H2 H N N 329 THR HA H N N 330 THR HB H N N 331 THR HG1 H N N 332 THR HG21 H N N 333 THR HG22 H N N 334 THR HG23 H N N 335 THR HXT H N N 336 TRP N N N N 337 TRP CA C N S 338 TRP C C N N 339 TRP O O N N 340 TRP CB C N N 341 TRP CG C Y N 342 TRP CD1 C Y N 343 TRP CD2 C Y N 344 TRP NE1 N Y N 345 TRP CE2 C Y N 346 TRP CE3 C Y N 347 TRP CZ2 C Y N 348 TRP CZ3 C Y N 349 TRP CH2 C Y N 350 TRP OXT O N N 351 TRP H H N N 352 TRP H2 H N N 353 TRP HA H N N 354 TRP HB2 H N N 355 TRP HB3 H N N 356 TRP HD1 H N N 357 TRP HE1 H N N 358 TRP HE3 H N N 359 TRP HZ2 H N N 360 TRP HZ3 H N N 361 TRP HH2 H N N 362 TRP HXT H N N 363 TYR N N N N 364 TYR CA C N S 365 TYR C C N N 366 TYR O O N N 367 TYR CB C N N 368 TYR CG C Y N 369 TYR CD1 C Y N 370 TYR CD2 C Y N 371 TYR CE1 C Y N 372 TYR CE2 C Y N 373 TYR CZ C Y N 374 TYR OH O N N 375 TYR OXT O N N 376 TYR H H N N 377 TYR H2 H N N 378 TYR HA H N N 379 TYR HB2 H N N 380 TYR HB3 H N N 381 TYR HD1 H N N 382 TYR HD2 H N N 383 TYR HE1 H N N 384 TYR HE2 H N N 385 TYR HH H N N 386 TYR HXT H N N 387 VAL N N N N 388 VAL CA C N S 389 VAL C C N N 390 VAL O O N N 391 VAL CB C N N 392 VAL CG1 C N N 393 VAL CG2 C N N 394 VAL OXT O N N 395 VAL H H N N 396 VAL H2 H N N 397 VAL HA H N N 398 VAL HB H N N 399 VAL HG11 H N N 400 VAL HG12 H N N 401 VAL HG13 H N N 402 VAL HG21 H N N 403 VAL HG22 H N N 404 VAL HG23 H N N 405 VAL HXT H N N 406 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FMT C O1 doub N N 83 FMT C O2 sing N N 84 FMT C H sing N N 85 FMT O2 HO2 sing N N 86 GLN N CA sing N N 87 GLN N H sing N N 88 GLN N H2 sing N N 89 GLN CA C sing N N 90 GLN CA CB sing N N 91 GLN CA HA sing N N 92 GLN C O doub N N 93 GLN C OXT sing N N 94 GLN CB CG sing N N 95 GLN CB HB2 sing N N 96 GLN CB HB3 sing N N 97 GLN CG CD sing N N 98 GLN CG HG2 sing N N 99 GLN CG HG3 sing N N 100 GLN CD OE1 doub N N 101 GLN CD NE2 sing N N 102 GLN NE2 HE21 sing N N 103 GLN NE2 HE22 sing N N 104 GLN OXT HXT sing N N 105 GLU N CA sing N N 106 GLU N H sing N N 107 GLU N H2 sing N N 108 GLU CA C sing N N 109 GLU CA CB sing N N 110 GLU CA HA sing N N 111 GLU C O doub N N 112 GLU C OXT sing N N 113 GLU CB CG sing N N 114 GLU CB HB2 sing N N 115 GLU CB HB3 sing N N 116 GLU CG CD sing N N 117 GLU CG HG2 sing N N 118 GLU CG HG3 sing N N 119 GLU CD OE1 doub N N 120 GLU CD OE2 sing N N 121 GLU OE2 HE2 sing N N 122 GLU OXT HXT sing N N 123 GLY N CA sing N N 124 GLY N H sing N N 125 GLY N H2 sing N N 126 GLY CA C sing N N 127 GLY CA HA2 sing N N 128 GLY CA HA3 sing N N 129 GLY C O doub N N 130 GLY C OXT sing N N 131 GLY OXT HXT sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 HOH O H1 sing N N 154 HOH O H2 sing N N 155 ILE N CA sing N N 156 ILE N H sing N N 157 ILE N H2 sing N N 158 ILE CA C sing N N 159 ILE CA CB sing N N 160 ILE CA HA sing N N 161 ILE C O doub N N 162 ILE C OXT sing N N 163 ILE CB CG1 sing N N 164 ILE CB CG2 sing N N 165 ILE CB HB sing N N 166 ILE CG1 CD1 sing N N 167 ILE CG1 HG12 sing N N 168 ILE CG1 HG13 sing N N 169 ILE CG2 HG21 sing N N 170 ILE CG2 HG22 sing N N 171 ILE CG2 HG23 sing N N 172 ILE CD1 HD11 sing N N 173 ILE CD1 HD12 sing N N 174 ILE CD1 HD13 sing N N 175 ILE OXT HXT sing N N 176 IMD N1 C2 sing Y N 177 IMD N1 C5 sing Y N 178 IMD N1 HN1 sing N N 179 IMD C2 N3 doub Y N 180 IMD C2 H2 sing N N 181 IMD N3 C4 sing Y N 182 IMD N3 HN3 sing N N 183 IMD C4 C5 doub Y N 184 IMD C4 H4 sing N N 185 IMD C5 H5 sing N N 186 LEU N CA sing N N 187 LEU N H sing N N 188 LEU N H2 sing N N 189 LEU CA C sing N N 190 LEU CA CB sing N N 191 LEU CA HA sing N N 192 LEU C O doub N N 193 LEU C OXT sing N N 194 LEU CB CG sing N N 195 LEU CB HB2 sing N N 196 LEU CB HB3 sing N N 197 LEU CG CD1 sing N N 198 LEU CG CD2 sing N N 199 LEU CG HG sing N N 200 LEU CD1 HD11 sing N N 201 LEU CD1 HD12 sing N N 202 LEU CD1 HD13 sing N N 203 LEU CD2 HD21 sing N N 204 LEU CD2 HD22 sing N N 205 LEU CD2 HD23 sing N N 206 LEU OXT HXT sing N N 207 LYS N CA sing N N 208 LYS N H sing N N 209 LYS N H2 sing N N 210 LYS CA C sing N N 211 LYS CA CB sing N N 212 LYS CA HA sing N N 213 LYS C O doub N N 214 LYS C OXT sing N N 215 LYS CB CG sing N N 216 LYS CB HB2 sing N N 217 LYS CB HB3 sing N N 218 LYS CG CD sing N N 219 LYS CG HG2 sing N N 220 LYS CG HG3 sing N N 221 LYS CD CE sing N N 222 LYS CD HD2 sing N N 223 LYS CD HD3 sing N N 224 LYS CE NZ sing N N 225 LYS CE HE2 sing N N 226 LYS CE HE3 sing N N 227 LYS NZ HZ1 sing N N 228 LYS NZ HZ2 sing N N 229 LYS NZ HZ3 sing N N 230 LYS OXT HXT sing N N 231 MET N CA sing N N 232 MET N H sing N N 233 MET N H2 sing N N 234 MET CA C sing N N 235 MET CA CB sing N N 236 MET CA HA sing N N 237 MET C O doub N N 238 MET C OXT sing N N 239 MET CB CG sing N N 240 MET CB HB2 sing N N 241 MET CB HB3 sing N N 242 MET CG SD sing N N 243 MET CG HG2 sing N N 244 MET CG HG3 sing N N 245 MET SD CE sing N N 246 MET CE HE1 sing N N 247 MET CE HE2 sing N N 248 MET CE HE3 sing N N 249 MET OXT HXT sing N N 250 PHE N CA sing N N 251 PHE N H sing N N 252 PHE N H2 sing N N 253 PHE CA C sing N N 254 PHE CA CB sing N N 255 PHE CA HA sing N N 256 PHE C O doub N N 257 PHE C OXT sing N N 258 PHE CB CG sing N N 259 PHE CB HB2 sing N N 260 PHE CB HB3 sing N N 261 PHE CG CD1 doub Y N 262 PHE CG CD2 sing Y N 263 PHE CD1 CE1 sing Y N 264 PHE CD1 HD1 sing N N 265 PHE CD2 CE2 doub Y N 266 PHE CD2 HD2 sing N N 267 PHE CE1 CZ doub Y N 268 PHE CE1 HE1 sing N N 269 PHE CE2 CZ sing Y N 270 PHE CE2 HE2 sing N N 271 PHE CZ HZ sing N N 272 PHE OXT HXT sing N N 273 PRO N CA sing N N 274 PRO N CD sing N N 275 PRO N H sing N N 276 PRO CA C sing N N 277 PRO CA CB sing N N 278 PRO CA HA sing N N 279 PRO C O doub N N 280 PRO C OXT sing N N 281 PRO CB CG sing N N 282 PRO CB HB2 sing N N 283 PRO CB HB3 sing N N 284 PRO CG CD sing N N 285 PRO CG HG2 sing N N 286 PRO CG HG3 sing N N 287 PRO CD HD2 sing N N 288 PRO CD HD3 sing N N 289 PRO OXT HXT sing N N 290 SER N CA sing N N 291 SER N H sing N N 292 SER N H2 sing N N 293 SER CA C sing N N 294 SER CA CB sing N N 295 SER CA HA sing N N 296 SER C O doub N N 297 SER C OXT sing N N 298 SER CB OG sing N N 299 SER CB HB2 sing N N 300 SER CB HB3 sing N N 301 SER OG HG sing N N 302 SER OXT HXT sing N N 303 THR N CA sing N N 304 THR N H sing N N 305 THR N H2 sing N N 306 THR CA C sing N N 307 THR CA CB sing N N 308 THR CA HA sing N N 309 THR C O doub N N 310 THR C OXT sing N N 311 THR CB OG1 sing N N 312 THR CB CG2 sing N N 313 THR CB HB sing N N 314 THR OG1 HG1 sing N N 315 THR CG2 HG21 sing N N 316 THR CG2 HG22 sing N N 317 THR CG2 HG23 sing N N 318 THR OXT HXT sing N N 319 TRP N CA sing N N 320 TRP N H sing N N 321 TRP N H2 sing N N 322 TRP CA C sing N N 323 TRP CA CB sing N N 324 TRP CA HA sing N N 325 TRP C O doub N N 326 TRP C OXT sing N N 327 TRP CB CG sing N N 328 TRP CB HB2 sing N N 329 TRP CB HB3 sing N N 330 TRP CG CD1 doub Y N 331 TRP CG CD2 sing Y N 332 TRP CD1 NE1 sing Y N 333 TRP CD1 HD1 sing N N 334 TRP CD2 CE2 doub Y N 335 TRP CD2 CE3 sing Y N 336 TRP NE1 CE2 sing Y N 337 TRP NE1 HE1 sing N N 338 TRP CE2 CZ2 sing Y N 339 TRP CE3 CZ3 doub Y N 340 TRP CE3 HE3 sing N N 341 TRP CZ2 CH2 doub Y N 342 TRP CZ2 HZ2 sing N N 343 TRP CZ3 CH2 sing Y N 344 TRP CZ3 HZ3 sing N N 345 TRP CH2 HH2 sing N N 346 TRP OXT HXT sing N N 347 TYR N CA sing N N 348 TYR N H sing N N 349 TYR N H2 sing N N 350 TYR CA C sing N N 351 TYR CA CB sing N N 352 TYR CA HA sing N N 353 TYR C O doub N N 354 TYR C OXT sing N N 355 TYR CB CG sing N N 356 TYR CB HB2 sing N N 357 TYR CB HB3 sing N N 358 TYR CG CD1 doub Y N 359 TYR CG CD2 sing Y N 360 TYR CD1 CE1 sing Y N 361 TYR CD1 HD1 sing N N 362 TYR CD2 CE2 doub Y N 363 TYR CD2 HD2 sing N N 364 TYR CE1 CZ doub Y N 365 TYR CE1 HE1 sing N N 366 TYR CE2 CZ sing Y N 367 TYR CE2 HE2 sing N N 368 TYR CZ OH sing N N 369 TYR OH HH sing N N 370 TYR OXT HXT sing N N 371 VAL N CA sing N N 372 VAL N H sing N N 373 VAL N H2 sing N N 374 VAL CA C sing N N 375 VAL CA CB sing N N 376 VAL CA HA sing N N 377 VAL C O doub N N 378 VAL C OXT sing N N 379 VAL CB CG1 sing N N 380 VAL CB CG2 sing N N 381 VAL CB HB sing N N 382 VAL CG1 HG11 sing N N 383 VAL CG1 HG12 sing N N 384 VAL CG1 HG13 sing N N 385 VAL CG2 HG21 sing N N 386 VAL CG2 HG22 sing N N 387 VAL CG2 HG23 sing N N 388 VAL OXT HXT sing N N 389 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FMT _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FMT _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3smv _pdbx_initial_refinement_model.details 'Resion 19-99 was excluded.' # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 8YVW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.021197 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014013 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013822 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_