data_8ZXO # _entry.id 8ZXO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8ZXO pdb_00008zxo 10.2210/pdb8zxo/pdb WWPDB D_1300048618 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-02-19 ? 2 'Structure model' 2 0 2026-03-04 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Polymer sequence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' entity_poly # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8ZXO _pdbx_database_status.recvd_initial_deposition_date 2024-06-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 fuzhifei@fjmu.edu.cn Zhifei Fu ? 'principal investigator/group leader' 0000-0002-6307-1733 3 abing0811@xmu.edu.cn Qingbing Zheng ? 'principal investigator/group leader' 0000-0002-7516-9965 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Li, Y.' 1 ? 'Li, M.' 2 ? 'Fan, S.' 3 ? 'Zheng, Q.' 4 ? 'Li, S.' 5 ? 'Fu, Z.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Methods _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1548-7105 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 22 _citation.language ? _citation.page_first 1288 _citation.page_last 1298 _citation.title 'A highly stable monomeric red fluorescent protein for advanced microscopy.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41592-025-02676-5 _citation.pdbx_database_id_PubMed 40247125 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xiong, H.' 1 ? primary 'Chang, Q.' 2 ? primary 'Ding, J.' 3 ? primary 'Wang, S.' 4 ? primary 'Zhang, W.' 5 ? primary 'Li, Y.' 6 ? primary 'Wu, Y.' 7 ? primary 'Lin, P.' 8 ? primary 'Yang, C.' 9 ? primary 'Liu, M.' 10 ? primary 'Fang, G.' 11 ? primary 'Yang, Y.' 12 ? primary 'Xie, J.' 13 ? primary 'Qi, D.' 14 ? primary 'Jiang, T.' 15 ? primary 'Fu, W.' 16 ? primary 'Hu, F.' 17 ? primary 'Chen, Y.' 18 ? primary 'Yue, R.' 19 ? primary 'Li, Y.' 20 ? primary 'Cui, Y.' 21 0000-0002-8861-8416 primary 'Li, M.' 22 ? primary 'Fan, S.' 23 ? primary 'Yang, Y.' 24 0000-0002-7738-1329 primary 'Xu, Y.' 25 ? primary 'Li, D.' 26 0000-0001-6787-5125 primary 'Zhang, F.' 27 ? primary 'Zhao, H.' 28 0000-0002-2961-0086 primary 'Wu, C.' 29 0009-0004-2599-7019 primary 'Zheng, Q.' 30 0000-0002-7516-9965 primary 'Piatkevich, K.D.' 31 0000-0002-7777-9468 primary 'Fu, Z.' 32 0000-0002-6307-1733 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'red fluorescent protein mScarletH' 26374.740 1 ? ? ? ? 2 water nat water 18.015 173 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQF(NRQ)SRAFTKHPA DIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVL KGDIKHALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFXSRAFTKHPADIPD YYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDI KHALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 SER n 1 4 LYS n 1 5 GLY n 1 6 GLU n 1 7 ALA n 1 8 VAL n 1 9 ILE n 1 10 LYS n 1 11 GLU n 1 12 PHE n 1 13 MET n 1 14 ARG n 1 15 PHE n 1 16 LYS n 1 17 VAL n 1 18 HIS n 1 19 MET n 1 20 GLU n 1 21 GLY n 1 22 SER n 1 23 MET n 1 24 ASN n 1 25 GLY n 1 26 HIS n 1 27 GLU n 1 28 PHE n 1 29 GLU n 1 30 ILE n 1 31 GLU n 1 32 GLY n 1 33 GLU n 1 34 GLY n 1 35 GLU n 1 36 GLY n 1 37 ARG n 1 38 PRO n 1 39 TYR n 1 40 GLU n 1 41 GLY n 1 42 THR n 1 43 GLN n 1 44 THR n 1 45 ALA n 1 46 LYS n 1 47 LEU n 1 48 LYS n 1 49 VAL n 1 50 THR n 1 51 LYS n 1 52 GLY n 1 53 GLY n 1 54 PRO n 1 55 LEU n 1 56 PRO n 1 57 PHE n 1 58 SER n 1 59 TRP n 1 60 ASP n 1 61 ILE n 1 62 LEU n 1 63 SER n 1 64 PRO n 1 65 GLN n 1 66 PHE n 1 67 NRQ n 1 68 SER n 1 69 ARG n 1 70 ALA n 1 71 PHE n 1 72 THR n 1 73 LYS n 1 74 HIS n 1 75 PRO n 1 76 ALA n 1 77 ASP n 1 78 ILE n 1 79 PRO n 1 80 ASP n 1 81 TYR n 1 82 TYR n 1 83 LYS n 1 84 GLN n 1 85 SER n 1 86 PHE n 1 87 PRO n 1 88 GLU n 1 89 GLY n 1 90 PHE n 1 91 LYS n 1 92 TRP n 1 93 GLU n 1 94 ARG n 1 95 VAL n 1 96 MET n 1 97 ASN n 1 98 PHE n 1 99 GLU n 1 100 ASP n 1 101 GLY n 1 102 GLY n 1 103 ALA n 1 104 VAL n 1 105 THR n 1 106 VAL n 1 107 THR n 1 108 GLN n 1 109 ASP n 1 110 THR n 1 111 SER n 1 112 LEU n 1 113 GLU n 1 114 ASP n 1 115 GLY n 1 116 THR n 1 117 LEU n 1 118 ILE n 1 119 TYR n 1 120 LYS n 1 121 VAL n 1 122 LYS n 1 123 LEU n 1 124 ARG n 1 125 GLY n 1 126 THR n 1 127 ASN n 1 128 PHE n 1 129 PRO n 1 130 PRO n 1 131 ASP n 1 132 GLY n 1 133 PRO n 1 134 VAL n 1 135 MET n 1 136 GLN n 1 137 LYS n 1 138 LYS n 1 139 THR n 1 140 MET n 1 141 GLY n 1 142 TRP n 1 143 GLU n 1 144 ALA n 1 145 SER n 1 146 THR n 1 147 GLU n 1 148 ARG n 1 149 LEU n 1 150 TYR n 1 151 PRO n 1 152 GLU n 1 153 ASP n 1 154 GLY n 1 155 VAL n 1 156 LEU n 1 157 LYS n 1 158 GLY n 1 159 ASP n 1 160 ILE n 1 161 LYS n 1 162 HIS n 1 163 ALA n 1 164 LEU n 1 165 ARG n 1 166 LEU n 1 167 LYS n 1 168 ASP n 1 169 GLY n 1 170 GLY n 1 171 ARG n 1 172 TYR n 1 173 LEU n 1 174 ALA n 1 175 ASP n 1 176 PHE n 1 177 LYS n 1 178 THR n 1 179 THR n 1 180 TYR n 1 181 LYS n 1 182 ALA n 1 183 LYS n 1 184 LYS n 1 185 PRO n 1 186 VAL n 1 187 GLN n 1 188 MET n 1 189 PRO n 1 190 GLY n 1 191 ALA n 1 192 TYR n 1 193 ASN n 1 194 VAL n 1 195 ASP n 1 196 ARG n 1 197 LYS n 1 198 LEU n 1 199 ASP n 1 200 ILE n 1 201 THR n 1 202 SER n 1 203 HIS n 1 204 ASN n 1 205 GLU n 1 206 ASP n 1 207 TYR n 1 208 THR n 1 209 VAL n 1 210 VAL n 1 211 GLU n 1 212 GLN n 1 213 TYR n 1 214 GLU n 1 215 ARG n 1 216 SER n 1 217 GLU n 1 218 GLY n 1 219 ARG n 1 220 HIS n 1 221 SER n 1 222 THR n 1 223 GLY n 1 224 GLY n 1 225 MET n 1 226 ASP n 1 227 GLU n 1 228 LEU n 1 229 TYR n 1 230 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 230 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Discosoma sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 86600 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NRQ 'L-peptide linking' n '{(4Z)-4-(4-hydroxybenzylidene)-2-[3-(methylthio)propanimidoyl]-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 'CHROMOPHORE (MET-TYR-GLY)' 'C16 H17 N3 O4 S' 347.389 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 VAL 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 LYS 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 NRQ 67 67 67 NRQ NRQ A . n A 1 68 SER 68 70 70 SER SER A . n A 1 69 ARG 69 71 71 ARG ARG A . n A 1 70 ALA 70 72 72 ALA ALA A . n A 1 71 PHE 71 73 73 PHE PHE A . n A 1 72 THR 72 74 74 THR THR A . n A 1 73 LYS 73 75 75 LYS LYS A . n A 1 74 HIS 74 76 76 HIS HIS A . n A 1 75 PRO 75 77 77 PRO PRO A . n A 1 76 ALA 76 78 78 ALA ALA A . n A 1 77 ASP 77 79 79 ASP ASP A . n A 1 78 ILE 78 80 80 ILE ILE A . n A 1 79 PRO 79 81 81 PRO PRO A . n A 1 80 ASP 80 82 82 ASP ASP A . n A 1 81 TYR 81 83 83 TYR TYR A . n A 1 82 TYR 82 84 84 TYR TYR A . n A 1 83 LYS 83 85 85 LYS LYS A . n A 1 84 GLN 84 86 86 GLN GLN A . n A 1 85 SER 85 87 87 SER SER A . n A 1 86 PHE 86 88 88 PHE PHE A . n A 1 87 PRO 87 89 89 PRO PRO A . n A 1 88 GLU 88 90 90 GLU GLU A . n A 1 89 GLY 89 91 91 GLY GLY A . n A 1 90 PHE 90 92 92 PHE PHE A . n A 1 91 LYS 91 93 93 LYS LYS A . n A 1 92 TRP 92 94 94 TRP TRP A . n A 1 93 GLU 93 95 95 GLU GLU A . n A 1 94 ARG 94 96 96 ARG ARG A . n A 1 95 VAL 95 97 97 VAL VAL A . n A 1 96 MET 96 98 98 MET MET A . n A 1 97 ASN 97 99 99 ASN ASN A . n A 1 98 PHE 98 100 100 PHE PHE A . n A 1 99 GLU 99 101 101 GLU GLU A . n A 1 100 ASP 100 102 102 ASP ASP A . n A 1 101 GLY 101 103 103 GLY GLY A . n A 1 102 GLY 102 104 104 GLY GLY A . n A 1 103 ALA 103 105 105 ALA ALA A . n A 1 104 VAL 104 106 106 VAL VAL A . n A 1 105 THR 105 107 107 THR THR A . n A 1 106 VAL 106 108 108 VAL VAL A . n A 1 107 THR 107 109 109 THR THR A . n A 1 108 GLN 108 110 110 GLN GLN A . n A 1 109 ASP 109 111 111 ASP ASP A . n A 1 110 THR 110 112 112 THR THR A . n A 1 111 SER 111 113 113 SER SER A . n A 1 112 LEU 112 114 114 LEU LEU A . n A 1 113 GLU 113 115 115 GLU GLU A . n A 1 114 ASP 114 116 116 ASP ASP A . n A 1 115 GLY 115 117 117 GLY GLY A . n A 1 116 THR 116 118 118 THR THR A . n A 1 117 LEU 117 119 119 LEU LEU A . n A 1 118 ILE 118 120 120 ILE ILE A . n A 1 119 TYR 119 121 121 TYR TYR A . n A 1 120 LYS 120 122 122 LYS LYS A . n A 1 121 VAL 121 123 123 VAL VAL A . n A 1 122 LYS 122 124 124 LYS LYS A . n A 1 123 LEU 123 125 125 LEU LEU A . n A 1 124 ARG 124 126 126 ARG ARG A . n A 1 125 GLY 125 127 127 GLY GLY A . n A 1 126 THR 126 128 128 THR THR A . n A 1 127 ASN 127 129 129 ASN ASN A . n A 1 128 PHE 128 130 130 PHE PHE A . n A 1 129 PRO 129 131 131 PRO PRO A . n A 1 130 PRO 130 132 132 PRO PRO A . n A 1 131 ASP 131 133 133 ASP ASP A . n A 1 132 GLY 132 134 134 GLY GLY A . n A 1 133 PRO 133 135 135 PRO PRO A . n A 1 134 VAL 134 136 136 VAL VAL A . n A 1 135 MET 135 137 137 MET MET A . n A 1 136 GLN 136 138 138 GLN GLN A . n A 1 137 LYS 137 139 139 LYS LYS A . n A 1 138 LYS 138 140 140 LYS LYS A . n A 1 139 THR 139 141 141 THR THR A . n A 1 140 MET 140 142 142 MET MET A . n A 1 141 GLY 141 143 143 GLY GLY A . n A 1 142 TRP 142 144 144 TRP TRP A . n A 1 143 GLU 143 145 145 GLU GLU A . n A 1 144 ALA 144 146 146 ALA ALA A . n A 1 145 SER 145 147 147 SER SER A . n A 1 146 THR 146 148 148 THR THR A . n A 1 147 GLU 147 149 149 GLU GLU A . n A 1 148 ARG 148 150 150 ARG ARG A . n A 1 149 LEU 149 151 151 LEU LEU A . n A 1 150 TYR 150 152 152 TYR TYR A . n A 1 151 PRO 151 153 153 PRO PRO A . n A 1 152 GLU 152 154 154 GLU GLU A . n A 1 153 ASP 153 155 155 ASP ASP A . n A 1 154 GLY 154 156 156 GLY GLY A . n A 1 155 VAL 155 157 157 VAL VAL A . n A 1 156 LEU 156 158 158 LEU LEU A . n A 1 157 LYS 157 159 159 LYS LYS A . n A 1 158 GLY 158 160 160 GLY GLY A . n A 1 159 ASP 159 161 161 ASP ASP A . n A 1 160 ILE 160 162 162 ILE ILE A . n A 1 161 LYS 161 163 163 LYS LYS A . n A 1 162 HIS 162 164 164 HIS HIS A . n A 1 163 ALA 163 165 165 ALA ALA A . n A 1 164 LEU 164 166 166 LEU LEU A . n A 1 165 ARG 165 167 167 ARG ARG A . n A 1 166 LEU 166 168 168 LEU LEU A . n A 1 167 LYS 167 169 169 LYS LYS A . n A 1 168 ASP 168 170 170 ASP ASP A . n A 1 169 GLY 169 171 171 GLY GLY A . n A 1 170 GLY 170 172 172 GLY GLY A . n A 1 171 ARG 171 173 173 ARG ARG A . n A 1 172 TYR 172 174 174 TYR TYR A . n A 1 173 LEU 173 175 175 LEU LEU A . n A 1 174 ALA 174 176 176 ALA ALA A . n A 1 175 ASP 175 177 177 ASP ASP A . n A 1 176 PHE 176 178 178 PHE PHE A . n A 1 177 LYS 177 179 179 LYS LYS A . n A 1 178 THR 178 180 180 THR THR A . n A 1 179 THR 179 181 181 THR THR A . n A 1 180 TYR 180 182 182 TYR TYR A . n A 1 181 LYS 181 183 183 LYS LYS A . n A 1 182 ALA 182 184 184 ALA ALA A . n A 1 183 LYS 183 185 185 LYS LYS A . n A 1 184 LYS 184 186 186 LYS LYS A . n A 1 185 PRO 185 187 187 PRO PRO A . n A 1 186 VAL 186 188 188 VAL VAL A . n A 1 187 GLN 187 189 189 GLN GLN A . n A 1 188 MET 188 190 190 MET MET A . n A 1 189 PRO 189 191 191 PRO PRO A . n A 1 190 GLY 190 192 192 GLY GLY A . n A 1 191 ALA 191 193 193 ALA ALA A . n A 1 192 TYR 192 194 194 TYR TYR A . n A 1 193 ASN 193 195 195 ASN ASN A . n A 1 194 VAL 194 196 196 VAL VAL A . n A 1 195 ASP 195 197 197 ASP ASP A . n A 1 196 ARG 196 198 198 ARG ARG A . n A 1 197 LYS 197 199 199 LYS LYS A . n A 1 198 LEU 198 200 200 LEU LEU A . n A 1 199 ASP 199 201 201 ASP ASP A . n A 1 200 ILE 200 202 202 ILE ILE A . n A 1 201 THR 201 203 203 THR THR A . n A 1 202 SER 202 204 204 SER SER A . n A 1 203 HIS 203 205 205 HIS HIS A . n A 1 204 ASN 204 206 206 ASN ASN A . n A 1 205 GLU 205 207 207 GLU GLU A . n A 1 206 ASP 206 208 208 ASP ASP A . n A 1 207 TYR 207 209 209 TYR TYR A . n A 1 208 THR 208 210 210 THR THR A . n A 1 209 VAL 209 211 211 VAL VAL A . n A 1 210 VAL 210 212 212 VAL VAL A . n A 1 211 GLU 211 213 213 GLU GLU A . n A 1 212 GLN 212 214 214 GLN GLN A . n A 1 213 TYR 213 215 215 TYR TYR A . n A 1 214 GLU 214 216 216 GLU GLU A . n A 1 215 ARG 215 217 217 ARG ARG A . n A 1 216 SER 216 218 218 SER SER A . n A 1 217 GLU 217 219 219 GLU GLU A . n A 1 218 GLY 218 220 220 GLY GLY A . n A 1 219 ARG 219 221 221 ARG ARG A . n A 1 220 HIS 220 222 222 HIS HIS A . n A 1 221 SER 221 223 223 SER SER A . n A 1 222 THR 222 224 224 THR THR A . n A 1 223 GLY 223 225 225 GLY GLY A . n A 1 224 GLY 224 226 ? ? ? A . n A 1 225 MET 225 227 ? ? ? A . n A 1 226 ASP 226 228 ? ? ? A . n A 1 227 GLU 227 229 ? ? ? A . n A 1 228 LEU 228 230 ? ? ? A . n A 1 229 TYR 229 231 ? ? ? A . n A 1 230 LYS 230 232 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NRQ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NRQ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 14 HOH HOH A . B 2 HOH 2 302 125 HOH HOH A . B 2 HOH 3 303 100 HOH HOH A . B 2 HOH 4 304 196 HOH HOH A . B 2 HOH 5 305 51 HOH HOH A . B 2 HOH 6 306 49 HOH HOH A . B 2 HOH 7 307 112 HOH HOH A . B 2 HOH 8 308 89 HOH HOH A . B 2 HOH 9 309 163 HOH HOH A . B 2 HOH 10 310 99 HOH HOH A . B 2 HOH 11 311 135 HOH HOH A . B 2 HOH 12 312 16 HOH HOH A . B 2 HOH 13 313 45 HOH HOH A . B 2 HOH 14 314 203 HOH HOH A . B 2 HOH 15 315 58 HOH HOH A . B 2 HOH 16 316 164 HOH HOH A . B 2 HOH 17 317 66 HOH HOH A . B 2 HOH 18 318 56 HOH HOH A . B 2 HOH 19 319 139 HOH HOH A . B 2 HOH 20 320 71 HOH HOH A . B 2 HOH 21 321 9 HOH HOH A . B 2 HOH 22 322 165 HOH HOH A . B 2 HOH 23 323 73 HOH HOH A . B 2 HOH 24 324 98 HOH HOH A . B 2 HOH 25 325 5 HOH HOH A . B 2 HOH 26 326 147 HOH HOH A . B 2 HOH 27 327 198 HOH HOH A . B 2 HOH 28 328 138 HOH HOH A . B 2 HOH 29 329 8 HOH HOH A . B 2 HOH 30 330 136 HOH HOH A . B 2 HOH 31 331 34 HOH HOH A . B 2 HOH 32 332 63 HOH HOH A . B 2 HOH 33 333 6 HOH HOH A . B 2 HOH 34 334 54 HOH HOH A . B 2 HOH 35 335 172 HOH HOH A . B 2 HOH 36 336 57 HOH HOH A . B 2 HOH 37 337 33 HOH HOH A . B 2 HOH 38 338 74 HOH HOH A . B 2 HOH 39 339 1 HOH HOH A . B 2 HOH 40 340 84 HOH HOH A . B 2 HOH 41 341 182 HOH HOH A . B 2 HOH 42 342 38 HOH HOH A . B 2 HOH 43 343 111 HOH HOH A . B 2 HOH 44 344 170 HOH HOH A . B 2 HOH 45 345 80 HOH HOH A . B 2 HOH 46 346 171 HOH HOH A . B 2 HOH 47 347 29 HOH HOH A . B 2 HOH 48 348 95 HOH HOH A . B 2 HOH 49 349 4 HOH HOH A . B 2 HOH 50 350 175 HOH HOH A . B 2 HOH 51 351 79 HOH HOH A . B 2 HOH 52 352 157 HOH HOH A . B 2 HOH 53 353 94 HOH HOH A . B 2 HOH 54 354 28 HOH HOH A . B 2 HOH 55 355 59 HOH HOH A . B 2 HOH 56 356 114 HOH HOH A . B 2 HOH 57 357 20 HOH HOH A . B 2 HOH 58 358 91 HOH HOH A . B 2 HOH 59 359 18 HOH HOH A . B 2 HOH 60 360 48 HOH HOH A . B 2 HOH 61 361 39 HOH HOH A . B 2 HOH 62 362 2 HOH HOH A . B 2 HOH 63 363 216 HOH HOH A . B 2 HOH 64 364 197 HOH HOH A . B 2 HOH 65 365 127 HOH HOH A . B 2 HOH 66 366 36 HOH HOH A . B 2 HOH 67 367 108 HOH HOH A . B 2 HOH 68 368 107 HOH HOH A . B 2 HOH 69 369 78 HOH HOH A . B 2 HOH 70 370 19 HOH HOH A . B 2 HOH 71 371 96 HOH HOH A . B 2 HOH 72 372 64 HOH HOH A . B 2 HOH 73 373 3 HOH HOH A . B 2 HOH 74 374 37 HOH HOH A . B 2 HOH 75 375 32 HOH HOH A . B 2 HOH 76 376 109 HOH HOH A . B 2 HOH 77 377 61 HOH HOH A . B 2 HOH 78 378 117 HOH HOH A . B 2 HOH 79 379 52 HOH HOH A . B 2 HOH 80 380 115 HOH HOH A . B 2 HOH 81 381 85 HOH HOH A . B 2 HOH 82 382 13 HOH HOH A . B 2 HOH 83 383 69 HOH HOH A . B 2 HOH 84 384 116 HOH HOH A . B 2 HOH 85 385 10 HOH HOH A . B 2 HOH 86 386 17 HOH HOH A . B 2 HOH 87 387 47 HOH HOH A . B 2 HOH 88 388 205 HOH HOH A . B 2 HOH 89 389 83 HOH HOH A . B 2 HOH 90 390 24 HOH HOH A . B 2 HOH 91 391 137 HOH HOH A . B 2 HOH 92 392 92 HOH HOH A . B 2 HOH 93 393 25 HOH HOH A . B 2 HOH 94 394 144 HOH HOH A . B 2 HOH 95 395 43 HOH HOH A . B 2 HOH 96 396 35 HOH HOH A . B 2 HOH 97 397 30 HOH HOH A . B 2 HOH 98 398 7 HOH HOH A . B 2 HOH 99 399 15 HOH HOH A . B 2 HOH 100 400 77 HOH HOH A . B 2 HOH 101 401 148 HOH HOH A . B 2 HOH 102 402 68 HOH HOH A . B 2 HOH 103 403 67 HOH HOH A . B 2 HOH 104 404 192 HOH HOH A . B 2 HOH 105 405 21 HOH HOH A . B 2 HOH 106 406 41 HOH HOH A . B 2 HOH 107 407 162 HOH HOH A . B 2 HOH 108 408 26 HOH HOH A . B 2 HOH 109 409 72 HOH HOH A . B 2 HOH 110 410 23 HOH HOH A . B 2 HOH 111 411 46 HOH HOH A . B 2 HOH 112 412 133 HOH HOH A . B 2 HOH 113 413 50 HOH HOH A . B 2 HOH 114 414 218 HOH HOH A . B 2 HOH 115 415 195 HOH HOH A . B 2 HOH 116 416 76 HOH HOH A . B 2 HOH 117 417 12 HOH HOH A . B 2 HOH 118 418 87 HOH HOH A . B 2 HOH 119 419 101 HOH HOH A . B 2 HOH 120 420 53 HOH HOH A . B 2 HOH 121 421 110 HOH HOH A . B 2 HOH 122 422 202 HOH HOH A . B 2 HOH 123 423 184 HOH HOH A . B 2 HOH 124 424 60 HOH HOH A . B 2 HOH 125 425 44 HOH HOH A . B 2 HOH 126 426 93 HOH HOH A . B 2 HOH 127 427 185 HOH HOH A . B 2 HOH 128 428 55 HOH HOH A . B 2 HOH 129 429 187 HOH HOH A . B 2 HOH 130 430 119 HOH HOH A . B 2 HOH 131 431 146 HOH HOH A . B 2 HOH 132 432 27 HOH HOH A . B 2 HOH 133 433 42 HOH HOH A . B 2 HOH 134 434 103 HOH HOH A . B 2 HOH 135 435 204 HOH HOH A . B 2 HOH 136 436 183 HOH HOH A . B 2 HOH 137 437 120 HOH HOH A . B 2 HOH 138 438 201 HOH HOH A . B 2 HOH 139 439 222 HOH HOH A . B 2 HOH 140 440 22 HOH HOH A . B 2 HOH 141 441 105 HOH HOH A . B 2 HOH 142 442 62 HOH HOH A . B 2 HOH 143 443 70 HOH HOH A . B 2 HOH 144 444 160 HOH HOH A . B 2 HOH 145 445 219 HOH HOH A . B 2 HOH 146 446 88 HOH HOH A . B 2 HOH 147 447 155 HOH HOH A . B 2 HOH 148 448 161 HOH HOH A . B 2 HOH 149 449 220 HOH HOH A . B 2 HOH 150 450 40 HOH HOH A . B 2 HOH 151 451 152 HOH HOH A . B 2 HOH 152 452 150 HOH HOH A . B 2 HOH 153 453 130 HOH HOH A . B 2 HOH 154 454 90 HOH HOH A . B 2 HOH 155 455 81 HOH HOH A . B 2 HOH 156 456 167 HOH HOH A . B 2 HOH 157 457 140 HOH HOH A . B 2 HOH 158 458 132 HOH HOH A . B 2 HOH 159 459 178 HOH HOH A . B 2 HOH 160 460 211 HOH HOH A . B 2 HOH 161 461 141 HOH HOH A . B 2 HOH 162 462 97 HOH HOH A . B 2 HOH 163 463 113 HOH HOH A . B 2 HOH 164 464 159 HOH HOH A . B 2 HOH 165 465 173 HOH HOH A . B 2 HOH 166 466 131 HOH HOH A . B 2 HOH 167 467 179 HOH HOH A . B 2 HOH 168 468 142 HOH HOH A . B 2 HOH 169 469 128 HOH HOH A . B 2 HOH 170 470 190 HOH HOH A . B 2 HOH 171 471 86 HOH HOH A . B 2 HOH 172 472 104 HOH HOH A . B 2 HOH 173 473 188 HOH HOH A . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id THR _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 107 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id CG2 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id THR _pdbx_unobs_or_zero_occ_atoms.label_seq_id 105 _pdbx_unobs_or_zero_occ_atoms.label_atom_id CG2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13-2998 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13-2998 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 102.10 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8ZXO _cell.details ? _cell.formula_units_Z ? _cell.length_a 84.715 _cell.length_a_esd ? _cell.length_b 45.351 _cell.length_b_esd ? _cell.length_c 58.658 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8ZXO _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8ZXO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.0M Ammonium sulfate,0.1M tris8.5' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-06-04 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8ZXO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.816 _reflns.d_resolution_low 57.36 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19465 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.206 _reflns.pdbx_Rpim_I_all 0.120 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.975 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.167 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.82 _reflns_shell.d_res_low 1.91 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2846 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.7 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.511 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.5 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8ZXO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.816 _refine.ls_d_res_low 41.42 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19451 _refine.ls_number_reflns_R_free 3558 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.13 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1880 _refine.ls_R_factor_R_free 0.2261 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1838 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.816 _refine_hist.d_res_low 41.42 _refine_hist.number_atoms_solvent 173 _refine_hist.number_atoms_total 1925 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1752 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _refine_ls_shell.R_factor_R_free 0.3352 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2888 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.d_res_high 1.816 _refine_ls_shell.d_res_low 1.881 _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 1942 _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.percent_reflns_obs 98.72 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? # _struct.entry_id 8ZXO _struct.title 'Structure of the red fluorescent protein mScarlet-H at pH8.5' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8ZXO _struct_keywords.text 'red fluorescent protein, mScarlet-H, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8ZXO _struct_ref.pdbx_db_accession 8ZXO _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8ZXO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 230 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8ZXO _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 232 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 232 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 58 ? PHE A 66 ? SER A 58 PHE A 66 5 ? 9 HELX_P HELX_P2 AA2 SER A 68 ? THR A 72 ? SER A 70 THR A 74 5 ? 5 HELX_P HELX_P3 AA3 ASP A 80 ? SER A 85 ? ASP A 82 SER A 87 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A PHE 66 C ? ? ? 1_555 A NRQ 67 N1 ? ? A PHE 66 A NRQ 67 1_555 ? ? ? ? ? ? ? 1.426 ? ? covale2 covale both ? A NRQ 67 C3 ? ? ? 1_555 A SER 68 N ? ? A NRQ 67 A SER 70 1_555 ? ? ? ? ? ? ? 1.425 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id NRQ _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 67 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id NRQ _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 67 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id 'MET, TYR, GLY' _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id NRQ _pdbx_modification_feature.type None _pdbx_modification_feature.category Chromophore/chromophore-like # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 53 A . ? GLY 53 A PRO 54 A ? PRO 54 A 1 -6.66 2 PHE 86 A . ? PHE 88 A PRO 87 A ? PRO 89 A 1 8.09 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 13 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel AA1 12 13 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 139 ? TRP A 142 ? THR A 141 TRP A 144 AA1 2 VAL A 155 ? LEU A 166 ? VAL A 157 LEU A 168 AA1 3 ARG A 171 ? ALA A 182 ? ARG A 173 ALA A 184 AA1 4 PHE A 90 ? PHE A 98 ? PHE A 92 PHE A 100 AA1 5 ALA A 103 ? GLU A 113 ? ALA A 105 GLU A 115 AA1 6 THR A 116 ? THR A 126 ? THR A 118 THR A 128 AA1 7 MET A 13 ? MET A 23 ? MET A 13 MET A 23 AA1 8 HIS A 26 ? ARG A 37 ? HIS A 26 ARG A 37 AA1 9 THR A 42 ? LYS A 51 ? THR A 42 LYS A 51 AA1 10 VAL A 209 ? ARG A 219 ? VAL A 211 ARG A 221 AA1 11 TYR A 192 ? HIS A 203 ? TYR A 194 HIS A 205 AA1 12 SER A 145 ? GLU A 152 ? SER A 147 GLU A 154 AA1 13 VAL A 155 ? LEU A 166 ? VAL A 157 LEU A 168 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 141 ? N GLY A 143 O ARG A 165 ? O ARG A 167 AA1 2 3 N HIS A 162 ? N HIS A 164 O ALA A 174 ? O ALA A 176 AA1 3 4 O LYS A 181 ? O LYS A 183 N LYS A 91 ? N LYS A 93 AA1 4 5 N ARG A 94 ? N ARG A 96 O VAL A 106 ? O VAL A 108 AA1 5 6 N SER A 111 ? N SER A 113 O ILE A 118 ? O ILE A 120 AA1 6 7 O GLY A 125 ? O GLY A 127 N SER A 22 ? N SER A 22 AA1 7 8 N MET A 19 ? N MET A 19 O ILE A 30 ? O ILE A 30 AA1 8 9 N GLU A 33 ? N GLU A 33 O LYS A 46 ? O LYS A 46 AA1 9 10 N LEU A 47 ? N LEU A 47 O VAL A 210 ? O VAL A 212 AA1 10 11 O ARG A 219 ? O ARG A 221 N ASN A 193 ? N ASN A 195 AA1 11 12 O TYR A 192 ? O TYR A 194 N LEU A 149 ? N LEU A 151 AA1 12 13 N ARG A 148 ? N ARG A 150 O ASP A 159 ? O ASP A 161 # _pdbx_entry_details.entry_id 8ZXO _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 56 ? ? -86.05 34.10 2 1 PHE A 73 ? ? -107.52 42.20 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 344 ? B HOH . 2 1 A HOH 465 ? B HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A VAL 2 ? A VAL 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A LYS 4 ? A LYS 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A GLY 226 ? A GLY 224 8 1 Y 1 A MET 227 ? A MET 225 9 1 Y 1 A ASP 228 ? A ASP 226 10 1 Y 1 A GLU 229 ? A GLU 227 11 1 Y 1 A LEU 230 ? A LEU 228 12 1 Y 1 A TYR 231 ? A TYR 229 13 1 Y 1 A LYS 232 ? A LYS 230 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 NRQ N1 N N N 236 NRQ CE C N N 237 NRQ SD S N N 238 NRQ CG1 C N N 239 NRQ CB1 C N N 240 NRQ CA1 C N N 241 NRQ C1 C N N 242 NRQ N2 N N N 243 NRQ OH O N N 244 NRQ CD2 C Y N 245 NRQ CE2 C Y N 246 NRQ CZ C Y N 247 NRQ CE1 C Y N 248 NRQ CD1 C Y N 249 NRQ CG2 C Y N 250 NRQ CB2 C N N 251 NRQ CA2 C N N 252 NRQ C2 C N N 253 NRQ O2 O N N 254 NRQ N3 N N N 255 NRQ CA3 C N N 256 NRQ C3 C N N 257 NRQ O3 O N N 258 NRQ OXT O N N 259 NRQ H H N N 260 NRQ HE1A H N N 261 NRQ HE2A H N N 262 NRQ HE3 H N N 263 NRQ HG11 H N N 264 NRQ HG12 H N N 265 NRQ HB11 H N N 266 NRQ HB12 H N N 267 NRQ HOH H N N 268 NRQ HD2 H N N 269 NRQ HE2 H N N 270 NRQ HE1 H N N 271 NRQ HD1 H N N 272 NRQ HB2 H N N 273 NRQ HA31 H N N 274 NRQ HA32 H N N 275 NRQ HXT H N N 276 PHE N N N N 277 PHE CA C N S 278 PHE C C N N 279 PHE O O N N 280 PHE CB C N N 281 PHE CG C Y N 282 PHE CD1 C Y N 283 PHE CD2 C Y N 284 PHE CE1 C Y N 285 PHE CE2 C Y N 286 PHE CZ C Y N 287 PHE OXT O N N 288 PHE H H N N 289 PHE H2 H N N 290 PHE HA H N N 291 PHE HB2 H N N 292 PHE HB3 H N N 293 PHE HD1 H N N 294 PHE HD2 H N N 295 PHE HE1 H N N 296 PHE HE2 H N N 297 PHE HZ H N N 298 PHE HXT H N N 299 PRO N N N N 300 PRO CA C N S 301 PRO C C N N 302 PRO O O N N 303 PRO CB C N N 304 PRO CG C N N 305 PRO CD C N N 306 PRO OXT O N N 307 PRO H H N N 308 PRO HA H N N 309 PRO HB2 H N N 310 PRO HB3 H N N 311 PRO HG2 H N N 312 PRO HG3 H N N 313 PRO HD2 H N N 314 PRO HD3 H N N 315 PRO HXT H N N 316 SER N N N N 317 SER CA C N S 318 SER C C N N 319 SER O O N N 320 SER CB C N N 321 SER OG O N N 322 SER OXT O N N 323 SER H H N N 324 SER H2 H N N 325 SER HA H N N 326 SER HB2 H N N 327 SER HB3 H N N 328 SER HG H N N 329 SER HXT H N N 330 THR N N N N 331 THR CA C N S 332 THR C C N N 333 THR O O N N 334 THR CB C N R 335 THR OG1 O N N 336 THR CG2 C N N 337 THR OXT O N N 338 THR H H N N 339 THR H2 H N N 340 THR HA H N N 341 THR HB H N N 342 THR HG1 H N N 343 THR HG21 H N N 344 THR HG22 H N N 345 THR HG23 H N N 346 THR HXT H N N 347 TRP N N N N 348 TRP CA C N S 349 TRP C C N N 350 TRP O O N N 351 TRP CB C N N 352 TRP CG C Y N 353 TRP CD1 C Y N 354 TRP CD2 C Y N 355 TRP NE1 N Y N 356 TRP CE2 C Y N 357 TRP CE3 C Y N 358 TRP CZ2 C Y N 359 TRP CZ3 C Y N 360 TRP CH2 C Y N 361 TRP OXT O N N 362 TRP H H N N 363 TRP H2 H N N 364 TRP HA H N N 365 TRP HB2 H N N 366 TRP HB3 H N N 367 TRP HD1 H N N 368 TRP HE1 H N N 369 TRP HE3 H N N 370 TRP HZ2 H N N 371 TRP HZ3 H N N 372 TRP HH2 H N N 373 TRP HXT H N N 374 TYR N N N N 375 TYR CA C N S 376 TYR C C N N 377 TYR O O N N 378 TYR CB C N N 379 TYR CG C Y N 380 TYR CD1 C Y N 381 TYR CD2 C Y N 382 TYR CE1 C Y N 383 TYR CE2 C Y N 384 TYR CZ C Y N 385 TYR OH O N N 386 TYR OXT O N N 387 TYR H H N N 388 TYR H2 H N N 389 TYR HA H N N 390 TYR HB2 H N N 391 TYR HB3 H N N 392 TYR HD1 H N N 393 TYR HD2 H N N 394 TYR HE1 H N N 395 TYR HE2 H N N 396 TYR HH H N N 397 TYR HXT H N N 398 VAL N N N N 399 VAL CA C N S 400 VAL C C N N 401 VAL O O N N 402 VAL CB C N N 403 VAL CG1 C N N 404 VAL CG2 C N N 405 VAL OXT O N N 406 VAL H H N N 407 VAL H2 H N N 408 VAL HA H N N 409 VAL HB H N N 410 VAL HG11 H N N 411 VAL HG12 H N N 412 VAL HG13 H N N 413 VAL HG21 H N N 414 VAL HG22 H N N 415 VAL HG23 H N N 416 VAL HXT H N N 417 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 NRQ OXT C3 sing N N 224 NRQ CE SD sing N N 225 NRQ SD CG1 sing N N 226 NRQ CG1 CB1 sing N N 227 NRQ C3 O3 doub N N 228 NRQ C3 CA3 sing N N 229 NRQ O2 C2 doub N N 230 NRQ C2 CA2 sing N N 231 NRQ C2 N3 sing N N 232 NRQ CA2 CB2 doub N N 233 NRQ CA2 N2 sing N N 234 NRQ CB2 CG2 sing N N 235 NRQ CD2 CG2 doub Y N 236 NRQ CD2 CE2 sing Y N 237 NRQ N3 C1 sing N N 238 NRQ N3 CA3 sing N N 239 NRQ CG2 CD1 sing Y N 240 NRQ CE2 CZ doub Y N 241 NRQ N2 C1 doub N N 242 NRQ C1 CA1 sing N N 243 NRQ CZ OH sing N N 244 NRQ CZ CE1 sing Y N 245 NRQ CA1 CB1 sing N N 246 NRQ CA1 N1 doub N N 247 NRQ CD1 CE1 doub Y N 248 NRQ N1 H sing N N 249 NRQ CE HE1A sing N N 250 NRQ CE HE2A sing N N 251 NRQ CE HE3 sing N N 252 NRQ CG1 HG11 sing N Z 253 NRQ CG1 HG12 sing N N 254 NRQ CB1 HB11 sing N N 255 NRQ CB1 HB12 sing N N 256 NRQ OH HOH sing N N 257 NRQ CD2 HD2 sing N N 258 NRQ CE2 HE2 sing N N 259 NRQ CE1 HE1 sing N N 260 NRQ CD1 HD1 sing N N 261 NRQ CB2 HB2 sing N N 262 NRQ CA3 HA31 sing N N 263 NRQ CA3 HA32 sing N N 264 NRQ OXT HXT sing N N 265 PHE N CA sing N N 266 PHE N H sing N N 267 PHE N H2 sing N N 268 PHE CA C sing N N 269 PHE CA CB sing N N 270 PHE CA HA sing N N 271 PHE C O doub N N 272 PHE C OXT sing N N 273 PHE CB CG sing N N 274 PHE CB HB2 sing N N 275 PHE CB HB3 sing N N 276 PHE CG CD1 doub Y N 277 PHE CG CD2 sing Y N 278 PHE CD1 CE1 sing Y N 279 PHE CD1 HD1 sing N N 280 PHE CD2 CE2 doub Y N 281 PHE CD2 HD2 sing N N 282 PHE CE1 CZ doub Y N 283 PHE CE1 HE1 sing N N 284 PHE CE2 CZ sing Y N 285 PHE CE2 HE2 sing N N 286 PHE CZ HZ sing N N 287 PHE OXT HXT sing N N 288 PRO N CA sing N N 289 PRO N CD sing N N 290 PRO N H sing N N 291 PRO CA C sing N N 292 PRO CA CB sing N N 293 PRO CA HA sing N N 294 PRO C O doub N N 295 PRO C OXT sing N N 296 PRO CB CG sing N N 297 PRO CB HB2 sing N N 298 PRO CB HB3 sing N N 299 PRO CG CD sing N N 300 PRO CG HG2 sing N N 301 PRO CG HG3 sing N N 302 PRO CD HD2 sing N N 303 PRO CD HD3 sing N N 304 PRO OXT HXT sing N N 305 SER N CA sing N N 306 SER N H sing N N 307 SER N H2 sing N N 308 SER CA C sing N N 309 SER CA CB sing N N 310 SER CA HA sing N N 311 SER C O doub N N 312 SER C OXT sing N N 313 SER CB OG sing N N 314 SER CB HB2 sing N N 315 SER CB HB3 sing N N 316 SER OG HG sing N N 317 SER OXT HXT sing N N 318 THR N CA sing N N 319 THR N H sing N N 320 THR N H2 sing N N 321 THR CA C sing N N 322 THR CA CB sing N N 323 THR CA HA sing N N 324 THR C O doub N N 325 THR C OXT sing N N 326 THR CB OG1 sing N N 327 THR CB CG2 sing N N 328 THR CB HB sing N N 329 THR OG1 HG1 sing N N 330 THR CG2 HG21 sing N N 331 THR CG2 HG22 sing N N 332 THR CG2 HG23 sing N N 333 THR OXT HXT sing N N 334 TRP N CA sing N N 335 TRP N H sing N N 336 TRP N H2 sing N N 337 TRP CA C sing N N 338 TRP CA CB sing N N 339 TRP CA HA sing N N 340 TRP C O doub N N 341 TRP C OXT sing N N 342 TRP CB CG sing N N 343 TRP CB HB2 sing N N 344 TRP CB HB3 sing N N 345 TRP CG CD1 doub Y N 346 TRP CG CD2 sing Y N 347 TRP CD1 NE1 sing Y N 348 TRP CD1 HD1 sing N N 349 TRP CD2 CE2 doub Y N 350 TRP CD2 CE3 sing Y N 351 TRP NE1 CE2 sing Y N 352 TRP NE1 HE1 sing N N 353 TRP CE2 CZ2 sing Y N 354 TRP CE3 CZ3 doub Y N 355 TRP CE3 HE3 sing N N 356 TRP CZ2 CH2 doub Y N 357 TRP CZ2 HZ2 sing N N 358 TRP CZ3 CH2 sing Y N 359 TRP CZ3 HZ3 sing N N 360 TRP CH2 HH2 sing N N 361 TRP OXT HXT sing N N 362 TYR N CA sing N N 363 TYR N H sing N N 364 TYR N H2 sing N N 365 TYR CA C sing N N 366 TYR CA CB sing N N 367 TYR CA HA sing N N 368 TYR C O doub N N 369 TYR C OXT sing N N 370 TYR CB CG sing N N 371 TYR CB HB2 sing N N 372 TYR CB HB3 sing N N 373 TYR CG CD1 doub Y N 374 TYR CG CD2 sing Y N 375 TYR CD1 CE1 sing Y N 376 TYR CD1 HD1 sing N N 377 TYR CD2 CE2 doub Y N 378 TYR CD2 HD2 sing N N 379 TYR CE1 CZ doub Y N 380 TYR CE1 HE1 sing N N 381 TYR CE2 CZ sing Y N 382 TYR CE2 HE2 sing N N 383 TYR CZ OH sing N N 384 TYR OH HH sing N N 385 TYR OXT HXT sing N N 386 VAL N CA sing N N 387 VAL N H sing N N 388 VAL N H2 sing N N 389 VAL CA C sing N N 390 VAL CA CB sing N N 391 VAL CA HA sing N N 392 VAL C O doub N N 393 VAL C OXT sing N N 394 VAL CB CG1 sing N N 395 VAL CB CG2 sing N N 396 VAL CB HB sing N N 397 VAL CG1 HG11 sing N N 398 VAL CG1 HG12 sing N N 399 VAL CG1 HG13 sing N N 400 VAL CG2 HG21 sing N N 401 VAL CG2 HG22 sing N N 402 VAL CG2 HG23 sing N N 403 VAL OXT HXT sing N N 404 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 32201235 1 'Other government' ? 2022J01287 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5LK4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8ZXO _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011804 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002530 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022050 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017435 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #