data_8A2J # _entry.id 8A2J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8A2J pdb_00008a2j 10.2210/pdb8a2j/pdb WWPDB D_1292123143 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-10-12 2 'Structure model' 1 1 2022-10-19 3 'Structure model' 1 2 2022-11-09 4 'Structure model' 1 3 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 4 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 7 4 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 8 4 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 9 4 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 10 4 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 11 4 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 12 4 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 13 4 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8A2J _pdbx_database_status.recvd_initial_deposition_date 2022-06-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 8A2I PDB . unspecified 8A2K PDB . unspecified 8A2H PDB . # _pdbx_contact_author.id 2 _pdbx_contact_author.email jiri.brynda@uochb.cas.cz _pdbx_contact_author.name_first Jiri _pdbx_contact_author.name_last Brynda _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3675-6769 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Vavrina, Z.' 1 0000-0002-6022-8918 'Brynda, J.' 2 0000-0003-3675-6769 'Rezacova, P.' 3 0000-0001-9626-346X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 14082 _citation.page_last 14103 _citation.title ;Design, Synthesis, and Biochemical and Biological Evaluation of Novel 7-Deazapurine Cyclic Dinucleotide Analogues as STING Receptor Agonists. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.2c01305 _citation.pdbx_database_id_PubMed 36201304 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vavrina, Z.' 1 ? primary 'Perlikova, P.' 2 ? primary 'Milisavljevic, N.' 3 ? primary 'Chevrier, F.' 4 ? primary 'Smola, M.' 5 ? primary 'Smith, J.' 6 ? primary 'Dejmek, M.' 7 ? primary 'Havlicek, V.' 8 ? primary 'Budesinsky, M.' 9 ? primary 'Liboska, R.' 10 ? primary 'Vanekova, L.' 11 ? primary 'Brynda, J.' 12 ? primary 'Boura, E.' 13 ? primary 'Rezacova, P.' 14 ? primary 'Hocek, M.' 15 ? primary 'Birkus, G.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Stimulator of interferon genes protein' 27097.514 2 ? ? ? ? 2 non-polymer syn ;2-azanyl-9-[(1~{R},6~{R},8~{R},9~{R},10~{S},15~{R},17~{R},18~{R})-8-[4-azanyl-5-(4-phenylphenyl)pyrrolo[2,3-d]pyrimidin-7-yl]-3,9,12,18-tetrakis(oxidanyl)-3,12-bis(oxidanylidene)-2,4,7,11,13,16-hexaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.2.1.0^{6,10}]octadecan-17-yl]-1~{H}-purin-6-one ; 825.615 1 ? ? ? ? 3 water nat water 18.015 92 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hSTING,Endoplasmic reticulum interferon stimulator,ERIS,Mediator of IRF3 activation,hMITA,Transmembrane protein 173' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPN IRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDI LADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDF S ; _entity_poly.pdbx_seq_one_letter_code_can ;SAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPN IRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDI LADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDF S ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;2-azanyl-9-[(1~{R},6~{R},8~{R},9~{R},10~{S},15~{R},17~{R},18~{R})-8-[4-azanyl-5-(4-phenylphenyl)pyrrolo[2,3-d]pyrimidin-7-yl]-3,9,12,18-tetrakis(oxidanyl)-3,12-bis(oxidanylidene)-2,4,7,11,13,16-hexaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.2.1.0^{6,10}]octadecan-17-yl]-1~{H}-purin-6-one ; KWO 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 PRO n 1 4 ALA n 1 5 GLU n 1 6 ILE n 1 7 SER n 1 8 ALA n 1 9 VAL n 1 10 CYS n 1 11 GLU n 1 12 LYS n 1 13 GLY n 1 14 ASN n 1 15 PHE n 1 16 ASN n 1 17 VAL n 1 18 ALA n 1 19 HIS n 1 20 GLY n 1 21 LEU n 1 22 ALA n 1 23 TRP n 1 24 SER n 1 25 TYR n 1 26 TYR n 1 27 ILE n 1 28 GLY n 1 29 TYR n 1 30 LEU n 1 31 ARG n 1 32 LEU n 1 33 ILE n 1 34 LEU n 1 35 PRO n 1 36 GLU n 1 37 LEU n 1 38 GLN n 1 39 ALA n 1 40 ARG n 1 41 ILE n 1 42 ARG n 1 43 THR n 1 44 TYR n 1 45 ASN n 1 46 GLN n 1 47 HIS n 1 48 TYR n 1 49 ASN n 1 50 ASN n 1 51 LEU n 1 52 LEU n 1 53 ARG n 1 54 GLY n 1 55 ALA n 1 56 VAL n 1 57 SER n 1 58 GLN n 1 59 ARG n 1 60 LEU n 1 61 TYR n 1 62 ILE n 1 63 LEU n 1 64 LEU n 1 65 PRO n 1 66 LEU n 1 67 ASP n 1 68 CYS n 1 69 GLY n 1 70 VAL n 1 71 PRO n 1 72 ASP n 1 73 ASN n 1 74 LEU n 1 75 SER n 1 76 MET n 1 77 ALA n 1 78 ASP n 1 79 PRO n 1 80 ASN n 1 81 ILE n 1 82 ARG n 1 83 PHE n 1 84 LEU n 1 85 ASP n 1 86 LYS n 1 87 LEU n 1 88 PRO n 1 89 GLN n 1 90 GLN n 1 91 THR n 1 92 GLY n 1 93 ASP n 1 94 ARG n 1 95 ALA n 1 96 GLY n 1 97 ILE n 1 98 LYS n 1 99 ASP n 1 100 ARG n 1 101 VAL n 1 102 TYR n 1 103 SER n 1 104 ASN n 1 105 SER n 1 106 ILE n 1 107 TYR n 1 108 GLU n 1 109 LEU n 1 110 LEU n 1 111 GLU n 1 112 ASN n 1 113 GLY n 1 114 GLN n 1 115 ARG n 1 116 ALA n 1 117 GLY n 1 118 THR n 1 119 CYS n 1 120 VAL n 1 121 LEU n 1 122 GLU n 1 123 TYR n 1 124 ALA n 1 125 THR n 1 126 PRO n 1 127 LEU n 1 128 GLN n 1 129 THR n 1 130 LEU n 1 131 PHE n 1 132 ALA n 1 133 MET n 1 134 SER n 1 135 GLN n 1 136 TYR n 1 137 SER n 1 138 GLN n 1 139 ALA n 1 140 GLY n 1 141 PHE n 1 142 SER n 1 143 ARG n 1 144 GLU n 1 145 ASP n 1 146 ARG n 1 147 LEU n 1 148 GLU n 1 149 GLN n 1 150 ALA n 1 151 LYS n 1 152 LEU n 1 153 PHE n 1 154 CYS n 1 155 ARG n 1 156 THR n 1 157 LEU n 1 158 GLU n 1 159 ASP n 1 160 ILE n 1 161 LEU n 1 162 ALA n 1 163 ASP n 1 164 ALA n 1 165 PRO n 1 166 GLU n 1 167 SER n 1 168 GLN n 1 169 ASN n 1 170 ASN n 1 171 CYS n 1 172 ARG n 1 173 LEU n 1 174 ILE n 1 175 ALA n 1 176 TYR n 1 177 GLN n 1 178 GLU n 1 179 PRO n 1 180 ALA n 1 181 ASP n 1 182 ASP n 1 183 SER n 1 184 SER n 1 185 PHE n 1 186 SER n 1 187 LEU n 1 188 SER n 1 189 GLN n 1 190 GLU n 1 191 VAL n 1 192 LEU n 1 193 ARG n 1 194 HIS n 1 195 LEU n 1 196 ARG n 1 197 GLN n 1 198 GLU n 1 199 GLU n 1 200 LYS n 1 201 GLU n 1 202 GLU n 1 203 VAL n 1 204 THR n 1 205 VAL n 1 206 GLY n 1 207 SER n 1 208 LEU n 1 209 LYS n 1 210 THR n 1 211 SER n 1 212 ALA n 1 213 VAL n 1 214 PRO n 1 215 SER n 1 216 THR n 1 217 SER n 1 218 THR n 1 219 MET n 1 220 SER n 1 221 GLN n 1 222 GLU n 1 223 PRO n 1 224 GLU n 1 225 LEU n 1 226 LEU n 1 227 ILE n 1 228 SER n 1 229 GLY n 1 230 MET n 1 231 GLU n 1 232 LYS n 1 233 PRO n 1 234 LEU n 1 235 PRO n 1 236 LEU n 1 237 ARG n 1 238 THR n 1 239 ASP n 1 240 PHE n 1 241 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 241 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'STING1, ERIS, MITA, STING, TMEM173' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 KWO non-polymer . ;2-azanyl-9-[(1~{R},6~{R},8~{R},9~{R},10~{S},15~{R},17~{R},18~{R})-8-[4-azanyl-5-(4-phenylphenyl)pyrrolo[2,3-d]pyrimidin-7-yl]-3,9,12,18-tetrakis(oxidanyl)-3,12-bis(oxidanylidene)-2,4,7,11,13,16-hexaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.2.1.0^{6,10}]octadecan-17-yl]-1~{H}-purin-6-one ; ;2-azanyl-9-[(1~{R},6~{R},8~{R},9~{R},10~{S},15~{R},17~{R},18~{R})-8-[4-azanyl-5-(4-phenylphenyl)pyrrolo[2,3-d]pyrimidin-7-yl]-3,9,12,18-tetrakis(oxidanyl)-3,12-bis(oxidanylidene)-2,4,7,11,13,16-hexaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.2.1.0^{6,10}]octadecan-17-yl]-1~{H}-purin-6-one ; 'C33 H33 N9 O13 P2' 825.615 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 139 ? ? ? A . n A 1 2 ALA 2 140 ? ? ? A . n A 1 3 PRO 3 141 ? ? ? A . n A 1 4 ALA 4 142 ? ? ? A . n A 1 5 GLU 5 143 ? ? ? A . n A 1 6 ILE 6 144 ? ? ? A . n A 1 7 SER 7 145 ? ? ? A . n A 1 8 ALA 8 146 ? ? ? A . n A 1 9 VAL 9 147 ? ? ? A . n A 1 10 CYS 10 148 ? ? ? A . n A 1 11 GLU 11 149 ? ? ? A . n A 1 12 LYS 12 150 ? ? ? A . n A 1 13 GLY 13 151 151 GLY GLY A . n A 1 14 ASN 14 152 152 ASN ASN A . n A 1 15 PHE 15 153 153 PHE PHE A . n A 1 16 ASN 16 154 154 ASN ASN A . n A 1 17 VAL 17 155 155 VAL VAL A . n A 1 18 ALA 18 156 156 ALA ALA A . n A 1 19 HIS 19 157 157 HIS HIS A . n A 1 20 GLY 20 158 158 GLY GLY A . n A 1 21 LEU 21 159 159 LEU LEU A . n A 1 22 ALA 22 160 160 ALA ALA A . n A 1 23 TRP 23 161 161 TRP TRP A . n A 1 24 SER 24 162 162 SER SER A . n A 1 25 TYR 25 163 163 TYR TYR A . n A 1 26 TYR 26 164 164 TYR TYR A . n A 1 27 ILE 27 165 165 ILE ILE A . n A 1 28 GLY 28 166 166 GLY GLY A . n A 1 29 TYR 29 167 167 TYR TYR A . n A 1 30 LEU 30 168 168 LEU LEU A . n A 1 31 ARG 31 169 169 ARG ARG A . n A 1 32 LEU 32 170 170 LEU LEU A . n A 1 33 ILE 33 171 171 ILE ILE A . n A 1 34 LEU 34 172 172 LEU LEU A . n A 1 35 PRO 35 173 173 PRO PRO A . n A 1 36 GLU 36 174 174 GLU GLU A . n A 1 37 LEU 37 175 175 LEU LEU A . n A 1 38 GLN 38 176 176 GLN GLN A . n A 1 39 ALA 39 177 177 ALA ALA A . n A 1 40 ARG 40 178 178 ARG ARG A . n A 1 41 ILE 41 179 179 ILE ILE A . n A 1 42 ARG 42 180 180 ARG ARG A . n A 1 43 THR 43 181 181 THR THR A . n A 1 44 TYR 44 182 182 TYR TYR A . n A 1 45 ASN 45 183 183 ASN ASN A . n A 1 46 GLN 46 184 184 GLN GLN A . n A 1 47 HIS 47 185 185 HIS HIS A . n A 1 48 TYR 48 186 186 TYR TYR A . n A 1 49 ASN 49 187 187 ASN ASN A . n A 1 50 ASN 50 188 188 ASN ASN A . n A 1 51 LEU 51 189 189 LEU LEU A . n A 1 52 LEU 52 190 190 LEU LEU A . n A 1 53 ARG 53 191 191 ARG ARG A . n A 1 54 GLY 54 192 192 GLY GLY A . n A 1 55 ALA 55 193 193 ALA ALA A . n A 1 56 VAL 56 194 194 VAL VAL A . n A 1 57 SER 57 195 195 SER SER A . n A 1 58 GLN 58 196 196 GLN GLN A . n A 1 59 ARG 59 197 197 ARG ARG A . n A 1 60 LEU 60 198 198 LEU LEU A . n A 1 61 TYR 61 199 199 TYR TYR A . n A 1 62 ILE 62 200 200 ILE ILE A . n A 1 63 LEU 63 201 201 LEU LEU A . n A 1 64 LEU 64 202 202 LEU LEU A . n A 1 65 PRO 65 203 203 PRO PRO A . n A 1 66 LEU 66 204 204 LEU LEU A . n A 1 67 ASP 67 205 205 ASP ASP A . n A 1 68 CYS 68 206 206 CYS CYS A . n A 1 69 GLY 69 207 207 GLY GLY A . n A 1 70 VAL 70 208 208 VAL VAL A . n A 1 71 PRO 71 209 209 PRO PRO A . n A 1 72 ASP 72 210 210 ASP ASP A . n A 1 73 ASN 73 211 211 ASN ASN A . n A 1 74 LEU 74 212 212 LEU LEU A . n A 1 75 SER 75 213 213 SER SER A . n A 1 76 MET 76 214 214 MET MET A . n A 1 77 ALA 77 215 215 ALA ALA A . n A 1 78 ASP 78 216 216 ASP ASP A . n A 1 79 PRO 79 217 217 PRO PRO A . n A 1 80 ASN 80 218 218 ASN ASN A . n A 1 81 ILE 81 219 219 ILE ILE A . n A 1 82 ARG 82 220 220 ARG ARG A . n A 1 83 PHE 83 221 221 PHE PHE A . n A 1 84 LEU 84 222 222 LEU LEU A . n A 1 85 ASP 85 223 223 ASP ASP A . n A 1 86 LYS 86 224 224 LYS LYS A . n A 1 87 LEU 87 225 225 LEU LEU A . n A 1 88 PRO 88 226 226 PRO PRO A . n A 1 89 GLN 89 227 227 GLN GLN A . n A 1 90 GLN 90 228 228 GLN GLN A . n A 1 91 THR 91 229 229 THR THR A . n A 1 92 GLY 92 230 230 GLY GLY A . n A 1 93 ASP 93 231 231 ASP ASP A . n A 1 94 ARG 94 232 232 ARG ARG A . n A 1 95 ALA 95 233 233 ALA ALA A . n A 1 96 GLY 96 234 234 GLY GLY A . n A 1 97 ILE 97 235 235 ILE ILE A . n A 1 98 LYS 98 236 236 LYS LYS A . n A 1 99 ASP 99 237 237 ASP ASP A . n A 1 100 ARG 100 238 238 ARG ARG A . n A 1 101 VAL 101 239 239 VAL VAL A . n A 1 102 TYR 102 240 240 TYR TYR A . n A 1 103 SER 103 241 241 SER SER A . n A 1 104 ASN 104 242 242 ASN ASN A . n A 1 105 SER 105 243 243 SER SER A . n A 1 106 ILE 106 244 244 ILE ILE A . n A 1 107 TYR 107 245 245 TYR TYR A . n A 1 108 GLU 108 246 246 GLU GLU A . n A 1 109 LEU 109 247 247 LEU LEU A . n A 1 110 LEU 110 248 248 LEU LEU A . n A 1 111 GLU 111 249 249 GLU GLU A . n A 1 112 ASN 112 250 250 ASN ASN A . n A 1 113 GLY 113 251 251 GLY GLY A . n A 1 114 GLN 114 252 252 GLN GLN A . n A 1 115 ARG 115 253 253 ARG ARG A . n A 1 116 ALA 116 254 254 ALA ALA A . n A 1 117 GLY 117 255 255 GLY GLY A . n A 1 118 THR 118 256 256 THR THR A . n A 1 119 CYS 119 257 257 CYS CYS A . n A 1 120 VAL 120 258 258 VAL VAL A . n A 1 121 LEU 121 259 259 LEU LEU A . n A 1 122 GLU 122 260 260 GLU GLU A . n A 1 123 TYR 123 261 261 TYR TYR A . n A 1 124 ALA 124 262 262 ALA ALA A . n A 1 125 THR 125 263 263 THR THR A . n A 1 126 PRO 126 264 264 PRO PRO A . n A 1 127 LEU 127 265 265 LEU LEU A . n A 1 128 GLN 128 266 266 GLN GLN A . n A 1 129 THR 129 267 267 THR THR A . n A 1 130 LEU 130 268 268 LEU LEU A . n A 1 131 PHE 131 269 269 PHE PHE A . n A 1 132 ALA 132 270 270 ALA ALA A . n A 1 133 MET 133 271 271 MET MET A . n A 1 134 SER 134 272 272 SER SER A . n A 1 135 GLN 135 273 273 GLN GLN A . n A 1 136 TYR 136 274 274 TYR TYR A . n A 1 137 SER 137 275 275 SER SER A . n A 1 138 GLN 138 276 276 GLN GLN A . n A 1 139 ALA 139 277 277 ALA ALA A . n A 1 140 GLY 140 278 278 GLY GLY A . n A 1 141 PHE 141 279 279 PHE PHE A . n A 1 142 SER 142 280 280 SER SER A . n A 1 143 ARG 143 281 281 ARG ARG A . n A 1 144 GLU 144 282 282 GLU GLU A . n A 1 145 ASP 145 283 283 ASP ASP A . n A 1 146 ARG 146 284 284 ARG ARG A . n A 1 147 LEU 147 285 285 LEU LEU A . n A 1 148 GLU 148 286 286 GLU GLU A . n A 1 149 GLN 149 287 287 GLN GLN A . n A 1 150 ALA 150 288 288 ALA ALA A . n A 1 151 LYS 151 289 289 LYS LYS A . n A 1 152 LEU 152 290 290 LEU LEU A . n A 1 153 PHE 153 291 291 PHE PHE A . n A 1 154 CYS 154 292 292 CYS CYS A . n A 1 155 ARG 155 293 293 ARG ARG A . n A 1 156 THR 156 294 294 THR THR A . n A 1 157 LEU 157 295 295 LEU LEU A . n A 1 158 GLU 158 296 296 GLU GLU A . n A 1 159 ASP 159 297 297 ASP ASP A . n A 1 160 ILE 160 298 298 ILE ILE A . n A 1 161 LEU 161 299 299 LEU LEU A . n A 1 162 ALA 162 300 300 ALA ALA A . n A 1 163 ASP 163 301 301 ASP ASP A . n A 1 164 ALA 164 302 302 ALA ALA A . n A 1 165 PRO 165 303 303 PRO PRO A . n A 1 166 GLU 166 304 304 GLU GLU A . n A 1 167 SER 167 305 305 SER SER A . n A 1 168 GLN 168 306 306 GLN GLN A . n A 1 169 ASN 169 307 307 ASN ASN A . n A 1 170 ASN 170 308 308 ASN ASN A . n A 1 171 CYS 171 309 309 CYS CYS A . n A 1 172 ARG 172 310 310 ARG ARG A . n A 1 173 LEU 173 311 311 LEU LEU A . n A 1 174 ILE 174 312 312 ILE ILE A . n A 1 175 ALA 175 313 313 ALA ALA A . n A 1 176 TYR 176 314 314 TYR TYR A . n A 1 177 GLN 177 315 315 GLN GLN A . n A 1 178 GLU 178 316 316 GLU GLU A . n A 1 179 PRO 179 317 317 PRO PRO A . n A 1 180 ALA 180 318 ? ? ? A . n A 1 181 ASP 181 319 ? ? ? A . n A 1 182 ASP 182 320 320 ASP ASP A . n A 1 183 SER 183 321 321 SER SER A . n A 1 184 SER 184 322 322 SER SER A . n A 1 185 PHE 185 323 323 PHE PHE A . n A 1 186 SER 186 324 324 SER SER A . n A 1 187 LEU 187 325 325 LEU LEU A . n A 1 188 SER 188 326 326 SER SER A . n A 1 189 GLN 189 327 327 GLN GLN A . n A 1 190 GLU 190 328 328 GLU GLU A . n A 1 191 VAL 191 329 329 VAL VAL A . n A 1 192 LEU 192 330 330 LEU LEU A . n A 1 193 ARG 193 331 331 ARG ARG A . n A 1 194 HIS 194 332 332 HIS HIS A . n A 1 195 LEU 195 333 333 LEU LEU A . n A 1 196 ARG 196 334 334 ARG ARG A . n A 1 197 GLN 197 335 335 GLN GLN A . n A 1 198 GLU 198 336 336 GLU GLU A . n A 1 199 GLU 199 337 337 GLU ALA A . n A 1 200 LYS 200 338 ? ? ? A . n A 1 201 GLU 201 339 ? ? ? A . n A 1 202 GLU 202 340 ? ? ? A . n A 1 203 VAL 203 341 ? ? ? A . n A 1 204 THR 204 342 ? ? ? A . n A 1 205 VAL 205 343 ? ? ? A . n A 1 206 GLY 206 344 ? ? ? A . n A 1 207 SER 207 345 ? ? ? A . n A 1 208 LEU 208 346 ? ? ? A . n A 1 209 LYS 209 347 ? ? ? A . n A 1 210 THR 210 348 ? ? ? A . n A 1 211 SER 211 349 ? ? ? A . n A 1 212 ALA 212 350 ? ? ? A . n A 1 213 VAL 213 351 ? ? ? A . n A 1 214 PRO 214 352 ? ? ? A . n A 1 215 SER 215 353 ? ? ? A . n A 1 216 THR 216 354 ? ? ? A . n A 1 217 SER 217 355 ? ? ? A . n A 1 218 THR 218 356 ? ? ? A . n A 1 219 MET 219 357 ? ? ? A . n A 1 220 SER 220 358 ? ? ? A . n A 1 221 GLN 221 359 ? ? ? A . n A 1 222 GLU 222 360 ? ? ? A . n A 1 223 PRO 223 361 ? ? ? A . n A 1 224 GLU 224 362 ? ? ? A . n A 1 225 LEU 225 363 ? ? ? A . n A 1 226 LEU 226 364 ? ? ? A . n A 1 227 ILE 227 365 ? ? ? A . n A 1 228 SER 228 366 ? ? ? A . n A 1 229 GLY 229 367 ? ? ? A . n A 1 230 MET 230 368 ? ? ? A . n A 1 231 GLU 231 369 ? ? ? A . n A 1 232 LYS 232 370 ? ? ? A . n A 1 233 PRO 233 371 ? ? ? A . n A 1 234 LEU 234 372 ? ? ? A . n A 1 235 PRO 235 373 ? ? ? A . n A 1 236 LEU 236 374 ? ? ? A . n A 1 237 ARG 237 375 ? ? ? A . n A 1 238 THR 238 376 ? ? ? A . n A 1 239 ASP 239 377 ? ? ? A . n A 1 240 PHE 240 378 ? ? ? A . n A 1 241 SER 241 379 ? ? ? A . n B 1 1 SER 1 139 ? ? ? B . n B 1 2 ALA 2 140 ? ? ? B . n B 1 3 PRO 3 141 ? ? ? B . n B 1 4 ALA 4 142 ? ? ? B . n B 1 5 GLU 5 143 ? ? ? B . n B 1 6 ILE 6 144 ? ? ? B . n B 1 7 SER 7 145 ? ? ? B . n B 1 8 ALA 8 146 ? ? ? B . n B 1 9 VAL 9 147 ? ? ? B . n B 1 10 CYS 10 148 ? ? ? B . n B 1 11 GLU 11 149 ? ? ? B . n B 1 12 LYS 12 150 ? ? ? B . n B 1 13 GLY 13 151 ? ? ? B . n B 1 14 ASN 14 152 ? ? ? B . n B 1 15 PHE 15 153 153 PHE PHE B . n B 1 16 ASN 16 154 154 ASN ASN B . n B 1 17 VAL 17 155 155 VAL VAL B . n B 1 18 ALA 18 156 156 ALA ALA B . n B 1 19 HIS 19 157 157 HIS HIS B . n B 1 20 GLY 20 158 158 GLY GLY B . n B 1 21 LEU 21 159 159 LEU LEU B . n B 1 22 ALA 22 160 160 ALA ALA B . n B 1 23 TRP 23 161 161 TRP TRP B . n B 1 24 SER 24 162 162 SER SER B . n B 1 25 TYR 25 163 163 TYR TYR B . n B 1 26 TYR 26 164 164 TYR TYR B . n B 1 27 ILE 27 165 165 ILE ILE B . n B 1 28 GLY 28 166 166 GLY GLY B . n B 1 29 TYR 29 167 167 TYR TYR B . n B 1 30 LEU 30 168 168 LEU LEU B . n B 1 31 ARG 31 169 169 ARG ARG B . n B 1 32 LEU 32 170 170 LEU LEU B . n B 1 33 ILE 33 171 171 ILE ILE B . n B 1 34 LEU 34 172 172 LEU LEU B . n B 1 35 PRO 35 173 173 PRO PRO B . n B 1 36 GLU 36 174 174 GLU GLU B . n B 1 37 LEU 37 175 175 LEU LEU B . n B 1 38 GLN 38 176 176 GLN GLN B . n B 1 39 ALA 39 177 177 ALA ALA B . n B 1 40 ARG 40 178 178 ARG ARG B . n B 1 41 ILE 41 179 179 ILE ILE B . n B 1 42 ARG 42 180 180 ARG ARG B . n B 1 43 THR 43 181 181 THR THR B . n B 1 44 TYR 44 182 182 TYR TYR B . n B 1 45 ASN 45 183 183 ASN ASN B . n B 1 46 GLN 46 184 184 GLN GLN B . n B 1 47 HIS 47 185 185 HIS HIS B . n B 1 48 TYR 48 186 186 TYR TYR B . n B 1 49 ASN 49 187 187 ASN ASN B . n B 1 50 ASN 50 188 ? ? ? B . n B 1 51 LEU 51 189 ? ? ? B . n B 1 52 LEU 52 190 ? ? ? B . n B 1 53 ARG 53 191 ? ? ? B . n B 1 54 GLY 54 192 ? ? ? B . n B 1 55 ALA 55 193 193 ALA ALA B . n B 1 56 VAL 56 194 194 VAL VAL B . n B 1 57 SER 57 195 195 SER SER B . n B 1 58 GLN 58 196 196 GLN GLN B . n B 1 59 ARG 59 197 197 ARG ARG B . n B 1 60 LEU 60 198 198 LEU LEU B . n B 1 61 TYR 61 199 199 TYR TYR B . n B 1 62 ILE 62 200 200 ILE ILE B . n B 1 63 LEU 63 201 201 LEU LEU B . n B 1 64 LEU 64 202 202 LEU LEU B . n B 1 65 PRO 65 203 203 PRO PRO B . n B 1 66 LEU 66 204 204 LEU LEU B . n B 1 67 ASP 67 205 205 ASP ASP B . n B 1 68 CYS 68 206 206 CYS CYS B . n B 1 69 GLY 69 207 207 GLY GLY B . n B 1 70 VAL 70 208 208 VAL VAL B . n B 1 71 PRO 71 209 209 PRO PRO B . n B 1 72 ASP 72 210 210 ASP ASP B . n B 1 73 ASN 73 211 211 ASN ASN B . n B 1 74 LEU 74 212 212 LEU LEU B . n B 1 75 SER 75 213 213 SER SER B . n B 1 76 MET 76 214 214 MET MET B . n B 1 77 ALA 77 215 215 ALA ALA B . n B 1 78 ASP 78 216 216 ASP ASP B . n B 1 79 PRO 79 217 217 PRO PRO B . n B 1 80 ASN 80 218 218 ASN ASN B . n B 1 81 ILE 81 219 219 ILE ILE B . n B 1 82 ARG 82 220 220 ARG ARG B . n B 1 83 PHE 83 221 221 PHE PHE B . n B 1 84 LEU 84 222 222 LEU LEU B . n B 1 85 ASP 85 223 223 ASP ASP B . n B 1 86 LYS 86 224 224 LYS LYS B . n B 1 87 LEU 87 225 225 LEU LEU B . n B 1 88 PRO 88 226 226 PRO PRO B . n B 1 89 GLN 89 227 227 GLN GLN B . n B 1 90 GLN 90 228 228 GLN GLN B . n B 1 91 THR 91 229 229 THR THR B . n B 1 92 GLY 92 230 230 GLY GLY B . n B 1 93 ASP 93 231 231 ASP ASP B . n B 1 94 ARG 94 232 232 ARG ARG B . n B 1 95 ALA 95 233 233 ALA ALA B . n B 1 96 GLY 96 234 234 GLY GLY B . n B 1 97 ILE 97 235 235 ILE ILE B . n B 1 98 LYS 98 236 236 LYS LYS B . n B 1 99 ASP 99 237 237 ASP ASP B . n B 1 100 ARG 100 238 238 ARG ARG B . n B 1 101 VAL 101 239 239 VAL VAL B . n B 1 102 TYR 102 240 240 TYR TYR B . n B 1 103 SER 103 241 241 SER SER B . n B 1 104 ASN 104 242 242 ASN ASN B . n B 1 105 SER 105 243 243 SER SER B . n B 1 106 ILE 106 244 244 ILE ILE B . n B 1 107 TYR 107 245 245 TYR TYR B . n B 1 108 GLU 108 246 246 GLU GLU B . n B 1 109 LEU 109 247 247 LEU LEU B . n B 1 110 LEU 110 248 248 LEU LEU B . n B 1 111 GLU 111 249 249 GLU GLU B . n B 1 112 ASN 112 250 250 ASN ASN B . n B 1 113 GLY 113 251 251 GLY GLY B . n B 1 114 GLN 114 252 252 GLN GLN B . n B 1 115 ARG 115 253 253 ARG ARG B . n B 1 116 ALA 116 254 254 ALA ALA B . n B 1 117 GLY 117 255 255 GLY GLY B . n B 1 118 THR 118 256 256 THR THR B . n B 1 119 CYS 119 257 257 CYS CYS B . n B 1 120 VAL 120 258 258 VAL VAL B . n B 1 121 LEU 121 259 259 LEU LEU B . n B 1 122 GLU 122 260 260 GLU GLU B . n B 1 123 TYR 123 261 261 TYR TYR B . n B 1 124 ALA 124 262 262 ALA ALA B . n B 1 125 THR 125 263 263 THR THR B . n B 1 126 PRO 126 264 264 PRO PRO B . n B 1 127 LEU 127 265 265 LEU LEU B . n B 1 128 GLN 128 266 266 GLN GLN B . n B 1 129 THR 129 267 267 THR THR B . n B 1 130 LEU 130 268 268 LEU LEU B . n B 1 131 PHE 131 269 269 PHE PHE B . n B 1 132 ALA 132 270 270 ALA ALA B . n B 1 133 MET 133 271 271 MET MET B . n B 1 134 SER 134 272 272 SER SER B . n B 1 135 GLN 135 273 273 GLN GLN B . n B 1 136 TYR 136 274 274 TYR TYR B . n B 1 137 SER 137 275 275 SER SER B . n B 1 138 GLN 138 276 276 GLN GLN B . n B 1 139 ALA 139 277 277 ALA ALA B . n B 1 140 GLY 140 278 278 GLY GLY B . n B 1 141 PHE 141 279 279 PHE PHE B . n B 1 142 SER 142 280 280 SER SER B . n B 1 143 ARG 143 281 281 ARG ARG B . n B 1 144 GLU 144 282 282 GLU GLU B . n B 1 145 ASP 145 283 283 ASP ASP B . n B 1 146 ARG 146 284 284 ARG ARG B . n B 1 147 LEU 147 285 285 LEU LEU B . n B 1 148 GLU 148 286 286 GLU GLU B . n B 1 149 GLN 149 287 287 GLN GLN B . n B 1 150 ALA 150 288 288 ALA ALA B . n B 1 151 LYS 151 289 289 LYS LYS B . n B 1 152 LEU 152 290 290 LEU LEU B . n B 1 153 PHE 153 291 291 PHE PHE B . n B 1 154 CYS 154 292 292 CYS CYS B . n B 1 155 ARG 155 293 293 ARG ARG B . n B 1 156 THR 156 294 294 THR THR B . n B 1 157 LEU 157 295 295 LEU LEU B . n B 1 158 GLU 158 296 296 GLU GLU B . n B 1 159 ASP 159 297 297 ASP ASP B . n B 1 160 ILE 160 298 298 ILE ILE B . n B 1 161 LEU 161 299 299 LEU LEU B . n B 1 162 ALA 162 300 300 ALA ALA B . n B 1 163 ASP 163 301 301 ASP ASP B . n B 1 164 ALA 164 302 302 ALA ALA B . n B 1 165 PRO 165 303 303 PRO PRO B . n B 1 166 GLU 166 304 304 GLU GLU B . n B 1 167 SER 167 305 305 SER SER B . n B 1 168 GLN 168 306 306 GLN GLN B . n B 1 169 ASN 169 307 307 ASN ASN B . n B 1 170 ASN 170 308 308 ASN ASN B . n B 1 171 CYS 171 309 309 CYS CYS B . n B 1 172 ARG 172 310 310 ARG ARG B . n B 1 173 LEU 173 311 311 LEU LEU B . n B 1 174 ILE 174 312 312 ILE ILE B . n B 1 175 ALA 175 313 313 ALA ALA B . n B 1 176 TYR 176 314 314 TYR TYR B . n B 1 177 GLN 177 315 315 GLN GLN B . n B 1 178 GLU 178 316 316 GLU GLU B . n B 1 179 PRO 179 317 317 PRO PRO B . n B 1 180 ALA 180 318 ? ? ? B . n B 1 181 ASP 181 319 319 ASP ASP B . n B 1 182 ASP 182 320 320 ASP ASP B . n B 1 183 SER 183 321 321 SER SER B . n B 1 184 SER 184 322 322 SER SER B . n B 1 185 PHE 185 323 323 PHE PHE B . n B 1 186 SER 186 324 324 SER SER B . n B 1 187 LEU 187 325 325 LEU LEU B . n B 1 188 SER 188 326 326 SER SER B . n B 1 189 GLN 189 327 327 GLN GLN B . n B 1 190 GLU 190 328 328 GLU GLU B . n B 1 191 VAL 191 329 329 VAL VAL B . n B 1 192 LEU 192 330 330 LEU LEU B . n B 1 193 ARG 193 331 331 ARG ARG B . n B 1 194 HIS 194 332 332 HIS HIS B . n B 1 195 LEU 195 333 333 LEU LEU B . n B 1 196 ARG 196 334 334 ARG ARG B . n B 1 197 GLN 197 335 335 GLN GLN B . n B 1 198 GLU 198 336 336 GLU GLU B . n B 1 199 GLU 199 337 337 GLU GLU B . n B 1 200 LYS 200 338 ? ? ? B . n B 1 201 GLU 201 339 ? ? ? B . n B 1 202 GLU 202 340 ? ? ? B . n B 1 203 VAL 203 341 ? ? ? B . n B 1 204 THR 204 342 ? ? ? B . n B 1 205 VAL 205 343 ? ? ? B . n B 1 206 GLY 206 344 ? ? ? B . n B 1 207 SER 207 345 ? ? ? B . n B 1 208 LEU 208 346 ? ? ? B . n B 1 209 LYS 209 347 ? ? ? B . n B 1 210 THR 210 348 ? ? ? B . n B 1 211 SER 211 349 ? ? ? B . n B 1 212 ALA 212 350 ? ? ? B . n B 1 213 VAL 213 351 ? ? ? B . n B 1 214 PRO 214 352 ? ? ? B . n B 1 215 SER 215 353 ? ? ? B . n B 1 216 THR 216 354 ? ? ? B . n B 1 217 SER 217 355 ? ? ? B . n B 1 218 THR 218 356 ? ? ? B . n B 1 219 MET 219 357 ? ? ? B . n B 1 220 SER 220 358 ? ? ? B . n B 1 221 GLN 221 359 ? ? ? B . n B 1 222 GLU 222 360 ? ? ? B . n B 1 223 PRO 223 361 ? ? ? B . n B 1 224 GLU 224 362 ? ? ? B . n B 1 225 LEU 225 363 ? ? ? B . n B 1 226 LEU 226 364 ? ? ? B . n B 1 227 ILE 227 365 ? ? ? B . n B 1 228 SER 228 366 ? ? ? B . n B 1 229 GLY 229 367 ? ? ? B . n B 1 230 MET 230 368 ? ? ? B . n B 1 231 GLU 231 369 ? ? ? B . n B 1 232 LYS 232 370 ? ? ? B . n B 1 233 PRO 233 371 ? ? ? B . n B 1 234 LEU 234 372 ? ? ? B . n B 1 235 PRO 235 373 ? ? ? B . n B 1 236 LEU 236 374 ? ? ? B . n B 1 237 ARG 237 375 ? ? ? B . n B 1 238 THR 238 376 ? ? ? B . n B 1 239 ASP 239 377 ? ? ? B . n B 1 240 PHE 240 378 ? ? ? B . n B 1 241 SER 241 379 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 KWO 1 401 401 KWO LIG B . D 3 HOH 1 401 37 HOH HOH A . D 3 HOH 2 402 48 HOH HOH A . D 3 HOH 3 403 27 HOH HOH A . D 3 HOH 4 404 123 HOH HOH A . D 3 HOH 5 405 26 HOH HOH A . D 3 HOH 6 406 7 HOH HOH A . D 3 HOH 7 407 63 HOH HOH A . D 3 HOH 8 408 34 HOH HOH A . D 3 HOH 9 409 13 HOH HOH A . D 3 HOH 10 410 36 HOH HOH A . D 3 HOH 11 411 4 HOH HOH A . D 3 HOH 12 412 31 HOH HOH A . D 3 HOH 13 413 68 HOH HOH A . D 3 HOH 14 414 131 HOH HOH A . D 3 HOH 15 415 59 HOH HOH A . D 3 HOH 16 416 132 HOH HOH A . D 3 HOH 17 417 9 HOH HOH A . D 3 HOH 18 418 114 HOH HOH A . D 3 HOH 19 419 16 HOH HOH A . D 3 HOH 20 420 3 HOH HOH A . D 3 HOH 21 421 1 HOH HOH A . D 3 HOH 22 422 12 HOH HOH A . D 3 HOH 23 423 83 HOH HOH A . D 3 HOH 24 424 10 HOH HOH A . D 3 HOH 25 425 84 HOH HOH A . D 3 HOH 26 426 42 HOH HOH A . D 3 HOH 27 427 20 HOH HOH A . D 3 HOH 28 428 89 HOH HOH A . D 3 HOH 29 429 2 HOH HOH A . D 3 HOH 30 430 21 HOH HOH A . D 3 HOH 31 431 6 HOH HOH A . D 3 HOH 32 432 130 HOH HOH A . D 3 HOH 33 433 39 HOH HOH A . D 3 HOH 34 434 15 HOH HOH A . D 3 HOH 35 435 58 HOH HOH A . D 3 HOH 36 436 19 HOH HOH A . D 3 HOH 37 437 56 HOH HOH A . D 3 HOH 38 438 45 HOH HOH A . D 3 HOH 39 439 5 HOH HOH A . D 3 HOH 40 440 118 HOH HOH A . D 3 HOH 41 441 126 HOH HOH A . D 3 HOH 42 442 104 HOH HOH A . D 3 HOH 43 443 40 HOH HOH A . D 3 HOH 44 444 67 HOH HOH A . D 3 HOH 45 445 78 HOH HOH A . D 3 HOH 46 446 112 HOH HOH A . D 3 HOH 47 447 103 HOH HOH A . D 3 HOH 48 448 96 HOH HOH A . D 3 HOH 49 449 43 HOH HOH A . D 3 HOH 50 450 14 HOH HOH A . D 3 HOH 51 451 122 HOH HOH A . D 3 HOH 52 452 86 HOH HOH A . D 3 HOH 53 453 22 HOH HOH A . D 3 HOH 54 454 98 HOH HOH A . D 3 HOH 55 455 125 HOH HOH A . D 3 HOH 56 456 66 HOH HOH A . D 3 HOH 57 457 25 HOH HOH A . E 3 HOH 1 501 85 HOH HOH B . E 3 HOH 2 502 46 HOH HOH B . E 3 HOH 3 503 119 HOH HOH B . E 3 HOH 4 504 51 HOH HOH B . E 3 HOH 5 505 17 HOH HOH B . E 3 HOH 6 506 49 HOH HOH B . E 3 HOH 7 507 47 HOH HOH B . E 3 HOH 8 508 38 HOH HOH B . E 3 HOH 9 509 18 HOH HOH B . E 3 HOH 10 510 35 HOH HOH B . E 3 HOH 11 511 87 HOH HOH B . E 3 HOH 12 512 32 HOH HOH B . E 3 HOH 13 513 74 HOH HOH B . E 3 HOH 14 514 11 HOH HOH B . E 3 HOH 15 515 57 HOH HOH B . E 3 HOH 16 516 60 HOH HOH B . E 3 HOH 17 517 8 HOH HOH B . E 3 HOH 18 518 29 HOH HOH B . E 3 HOH 19 519 50 HOH HOH B . E 3 HOH 20 520 64 HOH HOH B . E 3 HOH 21 521 41 HOH HOH B . E 3 HOH 22 522 71 HOH HOH B . E 3 HOH 23 523 54 HOH HOH B . E 3 HOH 24 524 24 HOH HOH B . E 3 HOH 25 525 23 HOH HOH B . E 3 HOH 26 526 30 HOH HOH B . E 3 HOH 27 527 44 HOH HOH B . E 3 HOH 28 528 33 HOH HOH B . E 3 HOH 29 529 82 HOH HOH B . E 3 HOH 30 530 52 HOH HOH B . E 3 HOH 31 531 92 HOH HOH B . E 3 HOH 32 532 69 HOH HOH B . E 3 HOH 33 533 73 HOH HOH B . E 3 HOH 34 534 53 HOH HOH B . E 3 HOH 35 535 105 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 174 ? CG ? A GLU 36 CG 2 1 Y 1 A GLU 174 ? CD ? A GLU 36 CD 3 1 Y 1 A GLU 174 ? OE1 ? A GLU 36 OE1 4 1 Y 1 A GLU 174 ? OE2 ? A GLU 36 OE2 5 1 Y 1 A GLN 196 ? CG ? A GLN 58 CG 6 1 Y 1 A GLN 196 ? CD ? A GLN 58 CD 7 1 Y 1 A GLN 196 ? OE1 ? A GLN 58 OE1 8 1 Y 1 A GLN 196 ? NE2 ? A GLN 58 NE2 9 1 Y 1 A MET 214 ? CG ? A MET 76 CG 10 1 Y 1 A MET 214 ? SD ? A MET 76 SD 11 1 Y 1 A MET 214 ? CE ? A MET 76 CE 12 1 Y 1 A LYS 224 ? CG ? A LYS 86 CG 13 1 Y 1 A LYS 224 ? CD ? A LYS 86 CD 14 1 Y 1 A LYS 224 ? CE ? A LYS 86 CE 15 1 Y 1 A LYS 224 ? NZ ? A LYS 86 NZ 16 1 Y 1 A LYS 236 ? CG ? A LYS 98 CG 17 1 Y 1 A LYS 236 ? CD ? A LYS 98 CD 18 1 Y 1 A LYS 236 ? CE ? A LYS 98 CE 19 1 Y 1 A LYS 236 ? NZ ? A LYS 98 NZ 20 1 Y 1 A ASP 237 ? CG ? A ASP 99 CG 21 1 Y 1 A ASP 237 ? OD1 ? A ASP 99 OD1 22 1 Y 1 A ASP 237 ? OD2 ? A ASP 99 OD2 23 1 Y 1 A VAL 239 ? CG1 ? A VAL 101 CG1 24 1 Y 1 A VAL 239 ? CG2 ? A VAL 101 CG2 25 1 Y 1 A GLN 252 ? CG ? A GLN 114 CG 26 1 Y 1 A GLN 252 ? CD ? A GLN 114 CD 27 1 Y 1 A GLN 252 ? OE1 ? A GLN 114 OE1 28 1 Y 1 A GLN 252 ? NE2 ? A GLN 114 NE2 29 1 Y 1 A ARG 281 ? CG ? A ARG 143 CG 30 1 Y 1 A ARG 281 ? CD ? A ARG 143 CD 31 1 Y 1 A ARG 281 ? NE ? A ARG 143 NE 32 1 Y 1 A ARG 281 ? CZ ? A ARG 143 CZ 33 1 Y 1 A ARG 281 ? NH1 ? A ARG 143 NH1 34 1 Y 1 A ARG 281 ? NH2 ? A ARG 143 NH2 35 1 Y 1 A GLU 282 ? CG ? A GLU 144 CG 36 1 Y 1 A GLU 282 ? CD ? A GLU 144 CD 37 1 Y 1 A GLU 282 ? OE1 ? A GLU 144 OE1 38 1 Y 1 A GLU 282 ? OE2 ? A GLU 144 OE2 39 1 Y 1 A GLU 296 ? CG ? A GLU 158 CG 40 1 Y 1 A GLU 296 ? CD ? A GLU 158 CD 41 1 Y 1 A GLU 296 ? OE1 ? A GLU 158 OE1 42 1 Y 1 A GLU 296 ? OE2 ? A GLU 158 OE2 43 1 Y 1 A ASP 301 ? CG ? A ASP 163 CG 44 1 Y 1 A ASP 301 ? OD1 ? A ASP 163 OD1 45 1 Y 1 A ASP 301 ? OD2 ? A ASP 163 OD2 46 1 Y 1 A GLN 306 ? CG ? A GLN 168 CG 47 1 Y 1 A GLN 306 ? CD ? A GLN 168 CD 48 1 Y 1 A GLN 306 ? OE1 ? A GLN 168 OE1 49 1 Y 1 A GLN 306 ? NE2 ? A GLN 168 NE2 50 1 Y 1 A ARG 310 ? CG ? A ARG 172 CG 51 1 Y 1 A ARG 310 ? CD ? A ARG 172 CD 52 1 Y 1 A ARG 310 ? NE ? A ARG 172 NE 53 1 Y 1 A ARG 310 ? CZ ? A ARG 172 CZ 54 1 Y 1 A ARG 310 ? NH1 ? A ARG 172 NH1 55 1 Y 1 A ARG 310 ? NH2 ? A ARG 172 NH2 56 1 Y 1 A GLU 316 ? CG ? A GLU 178 CG 57 1 Y 1 A GLU 316 ? CD ? A GLU 178 CD 58 1 Y 1 A GLU 316 ? OE1 ? A GLU 178 OE1 59 1 Y 1 A GLU 316 ? OE2 ? A GLU 178 OE2 60 1 Y 1 A ASP 320 ? CG ? A ASP 182 CG 61 1 Y 1 A ASP 320 ? OD1 ? A ASP 182 OD1 62 1 Y 1 A ASP 320 ? OD2 ? A ASP 182 OD2 63 1 Y 1 A SER 321 ? OG ? A SER 183 OG 64 1 Y 1 A GLU 337 ? CG ? A GLU 199 CG 65 1 Y 1 A GLU 337 ? CD ? A GLU 199 CD 66 1 Y 1 A GLU 337 ? OE1 ? A GLU 199 OE1 67 1 Y 1 A GLU 337 ? OE2 ? A GLU 199 OE2 68 1 Y 1 B PHE 153 ? CG ? B PHE 15 CG 69 1 Y 1 B PHE 153 ? CD1 ? B PHE 15 CD1 70 1 Y 1 B PHE 153 ? CD2 ? B PHE 15 CD2 71 1 Y 1 B PHE 153 ? CE1 ? B PHE 15 CE1 72 1 Y 1 B PHE 153 ? CE2 ? B PHE 15 CE2 73 1 Y 1 B PHE 153 ? CZ ? B PHE 15 CZ 74 1 Y 1 B ARG 180 ? CG ? B ARG 42 CG 75 1 Y 1 B ARG 180 ? CD ? B ARG 42 CD 76 1 Y 1 B ARG 180 ? NE ? B ARG 42 NE 77 1 Y 1 B ARG 180 ? CZ ? B ARG 42 CZ 78 1 Y 1 B ARG 180 ? NH1 ? B ARG 42 NH1 79 1 Y 1 B ARG 180 ? NH2 ? B ARG 42 NH2 80 1 Y 1 B THR 181 ? OG1 ? B THR 43 OG1 81 1 Y 1 B THR 181 ? CG2 ? B THR 43 CG2 82 1 Y 1 B HIS 185 ? CG ? B HIS 47 CG 83 1 Y 1 B HIS 185 ? ND1 ? B HIS 47 ND1 84 1 Y 1 B HIS 185 ? CD2 ? B HIS 47 CD2 85 1 Y 1 B HIS 185 ? CE1 ? B HIS 47 CE1 86 1 Y 1 B HIS 185 ? NE2 ? B HIS 47 NE2 87 1 Y 1 B TYR 186 ? CG ? B TYR 48 CG 88 1 Y 1 B TYR 186 ? CD1 ? B TYR 48 CD1 89 1 Y 1 B TYR 186 ? CD2 ? B TYR 48 CD2 90 1 Y 1 B TYR 186 ? CE1 ? B TYR 48 CE1 91 1 Y 1 B TYR 186 ? CE2 ? B TYR 48 CE2 92 1 Y 1 B TYR 186 ? CZ ? B TYR 48 CZ 93 1 Y 1 B TYR 186 ? OH ? B TYR 48 OH 94 1 Y 1 B VAL 194 ? CG1 ? B VAL 56 CG1 95 1 Y 1 B VAL 194 ? CG2 ? B VAL 56 CG2 96 1 Y 1 B MET 214 ? CG ? B MET 76 CG 97 1 Y 1 B MET 214 ? SD ? B MET 76 SD 98 1 Y 1 B MET 214 ? CE ? B MET 76 CE 99 1 Y 1 B LYS 224 ? CG ? B LYS 86 CG 100 1 Y 1 B LYS 224 ? CD ? B LYS 86 CD 101 1 Y 1 B LYS 224 ? CE ? B LYS 86 CE 102 1 Y 1 B LYS 224 ? NZ ? B LYS 86 NZ 103 1 Y 1 B LYS 236 ? CG ? B LYS 98 CG 104 1 Y 1 B LYS 236 ? CD ? B LYS 98 CD 105 1 Y 1 B LYS 236 ? CE ? B LYS 98 CE 106 1 Y 1 B LYS 236 ? NZ ? B LYS 98 NZ 107 1 Y 1 B ASP 237 ? CG ? B ASP 99 CG 108 1 Y 1 B ASP 237 ? OD1 ? B ASP 99 OD1 109 1 Y 1 B ASP 237 ? OD2 ? B ASP 99 OD2 110 1 Y 1 B ARG 238 ? CG ? B ARG 100 CG 111 1 Y 1 B ARG 238 ? CD ? B ARG 100 CD 112 1 Y 1 B ARG 238 ? NE ? B ARG 100 NE 113 1 Y 1 B ARG 238 ? CZ ? B ARG 100 CZ 114 1 Y 1 B ARG 238 ? NH1 ? B ARG 100 NH1 115 1 Y 1 B ARG 238 ? NH2 ? B ARG 100 NH2 116 1 Y 1 B VAL 239 ? CG1 ? B VAL 101 CG1 117 1 Y 1 B VAL 239 ? CG2 ? B VAL 101 CG2 118 1 Y 1 B ARG 281 ? CG ? B ARG 143 CG 119 1 Y 1 B ARG 281 ? CD ? B ARG 143 CD 120 1 Y 1 B ARG 281 ? NE ? B ARG 143 NE 121 1 Y 1 B ARG 281 ? CZ ? B ARG 143 CZ 122 1 Y 1 B ARG 281 ? NH1 ? B ARG 143 NH1 123 1 Y 1 B ARG 281 ? NH2 ? B ARG 143 NH2 124 1 Y 1 B GLU 282 ? CG ? B GLU 144 CG 125 1 Y 1 B GLU 282 ? CD ? B GLU 144 CD 126 1 Y 1 B GLU 282 ? OE1 ? B GLU 144 OE1 127 1 Y 1 B GLU 282 ? OE2 ? B GLU 144 OE2 128 1 Y 1 B ASP 283 ? CG ? B ASP 145 CG 129 1 Y 1 B ASP 283 ? OD1 ? B ASP 145 OD1 130 1 Y 1 B ASP 283 ? OD2 ? B ASP 145 OD2 131 1 Y 1 B GLU 286 ? CG ? B GLU 148 CG 132 1 Y 1 B GLU 286 ? CD ? B GLU 148 CD 133 1 Y 1 B GLU 286 ? OE1 ? B GLU 148 OE1 134 1 Y 1 B GLU 286 ? OE2 ? B GLU 148 OE2 135 1 Y 1 B ARG 293 ? CG ? B ARG 155 CG 136 1 Y 1 B ARG 293 ? CD ? B ARG 155 CD 137 1 Y 1 B ARG 293 ? NE ? B ARG 155 NE 138 1 Y 1 B ARG 293 ? CZ ? B ARG 155 CZ 139 1 Y 1 B ARG 293 ? NH1 ? B ARG 155 NH1 140 1 Y 1 B ARG 293 ? NH2 ? B ARG 155 NH2 141 1 Y 1 B GLN 306 ? CG ? B GLN 168 CG 142 1 Y 1 B GLN 306 ? CD ? B GLN 168 CD 143 1 Y 1 B GLN 306 ? OE1 ? B GLN 168 OE1 144 1 Y 1 B GLN 306 ? NE2 ? B GLN 168 NE2 145 1 Y 1 B ARG 310 ? CG ? B ARG 172 CG 146 1 Y 1 B ARG 310 ? CD ? B ARG 172 CD 147 1 Y 1 B ARG 310 ? NE ? B ARG 172 NE 148 1 Y 1 B ARG 310 ? CZ ? B ARG 172 CZ 149 1 Y 1 B ARG 310 ? NH1 ? B ARG 172 NH1 150 1 Y 1 B ARG 310 ? NH2 ? B ARG 172 NH2 151 1 Y 1 B GLU 316 ? CG ? B GLU 178 CG 152 1 Y 1 B GLU 316 ? CD ? B GLU 178 CD 153 1 Y 1 B GLU 316 ? OE1 ? B GLU 178 OE1 154 1 Y 1 B GLU 316 ? OE2 ? B GLU 178 OE2 155 1 Y 1 B ASP 319 ? CG ? B ASP 181 CG 156 1 Y 1 B ASP 319 ? OD1 ? B ASP 181 OD1 157 1 Y 1 B ASP 319 ? OD2 ? B ASP 181 OD2 158 1 Y 1 B ASP 320 ? CG ? B ASP 182 CG 159 1 Y 1 B ASP 320 ? OD1 ? B ASP 182 OD1 160 1 Y 1 B ASP 320 ? OD2 ? B ASP 182 OD2 161 1 Y 1 B ARG 331 ? CG ? B ARG 193 CG 162 1 Y 1 B ARG 331 ? CD ? B ARG 193 CD 163 1 Y 1 B ARG 331 ? NE ? B ARG 193 NE 164 1 Y 1 B ARG 331 ? CZ ? B ARG 193 CZ 165 1 Y 1 B ARG 331 ? NH1 ? B ARG 193 NH1 166 1 Y 1 B ARG 331 ? NH2 ? B ARG 193 NH2 167 1 Y 1 B GLN 335 ? CG ? B GLN 197 CG 168 1 Y 1 B GLN 335 ? CD ? B GLN 197 CD 169 1 Y 1 B GLN 335 ? OE1 ? B GLN 197 OE1 170 1 Y 1 B GLN 335 ? NE2 ? B GLN 197 NE2 171 1 Y 1 B GLU 337 ? CG ? B GLU 199 CG 172 1 Y 1 B GLU 337 ? CD ? B GLU 199 CD 173 1 Y 1 B GLU 337 ? OE1 ? B GLU 199 OE1 174 1 Y 1 B GLU 337 ? OE2 ? B GLU 199 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8A2J _cell.details ? _cell.formula_units_Z ? _cell.length_a 94.290 _cell.length_a_esd ? _cell.length_b 116.910 _cell.length_b_esd ? _cell.length_c 35.980 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8A2J _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8A2J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM citric acid, 20% (w/v) PEG 6000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-10-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 33.900 _reflns.entry_id 8A2J _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.32 _reflns.d_resolution_low 36.020 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21423 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.200 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.417 _reflns.pdbx_Rmerge_I_obs 0.193 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.787 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.213 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.450 2.600 ? 0.790 ? 9888 2440 ? 2058 84.300 ? ? ? ? 1.869 ? ? ? ? ? ? ? ? 4.805 ? ? ? ? 2.077 ? ? 1 1 0.526 ? ? ? ? ? ? ? ? ? ? 2.600 2.780 ? 1.380 ? 11115 2299 ? 2151 93.600 ? ? ? ? 1.121 ? ? ? ? ? ? ? ? 5.167 ? ? ? ? 1.242 ? ? 2 1 0.700 ? ? ? ? ? ? ? ? ? ? 2.780 3.000 ? 2.270 ? 11521 2137 ? 2062 96.500 ? ? ? ? 0.687 ? ? ? ? ? ? ? ? 5.587 ? ? ? ? 0.759 ? ? 3 1 0.872 ? ? ? ? ? ? ? ? ? ? 3.000 3.290 ? 4.430 ? 11648 1982 ? 1964 99.100 ? ? ? ? 0.354 ? ? ? ? ? ? ? ? 5.931 ? ? ? ? 0.388 ? ? 4 1 0.940 ? ? ? ? ? ? ? ? ? ? 3.290 3.670 ? 7.560 ? 10666 1784 ? 1761 98.700 ? ? ? ? 0.229 ? ? ? ? ? ? ? ? 6.057 ? ? ? ? 0.251 ? ? 5 1 0.975 ? ? ? ? ? ? ? ? ? ? 3.670 4.240 ? 11.750 ? 8954 1607 ? 1576 98.100 ? ? ? ? 0.152 ? ? ? ? ? ? ? ? 5.681 ? ? ? ? 0.167 ? ? 6 1 0.985 ? ? ? ? ? ? ? ? ? ? 4.240 5.180 ? 14.630 ? 5889 1398 ? 1362 97.400 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 4.324 ? ? ? ? 0.116 ? ? 7 1 0.992 ? ? ? ? ? ? ? ? ? ? 5.180 7.280 ? 12.490 ? 6119 1099 ? 1092 99.400 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? 5.603 ? ? ? ? 0.149 ? ? 8 1 0.988 ? ? ? ? ? ? ? ? ? ? 7.280 36.020 ? 22.980 ? 3689 665 ? 648 97.400 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 5.693 ? ? ? ? 0.063 ? ? 9 1 0.998 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 101.680 _refine.B_iso_mean 54.4530 _refine.B_iso_min 30.270 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8A2J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3200 _refine.ls_d_res_low 36.0200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17820 _refine.ls_number_reflns_R_free 888 _refine.ls_number_reflns_R_work 16932 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.1000 _refine.ls_percent_reflns_R_free 4.9800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2264 _refine.ls_R_factor_R_free 0.2640 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2245 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4KSY _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.8100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3200 _refine_hist.d_res_low 36.0200 _refine_hist.number_atoms_solvent 92 _refine_hist.number_atoms_total 2916 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 364 _refine_hist.pdbx_B_iso_mean_ligand 51.88 _refine_hist.pdbx_B_iso_mean_solvent 55.80 _refine_hist.pdbx_number_atoms_protein 2767 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 57 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 1437 12.049 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 1437 12.049 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3200 2.4700 2863 . 141 2722 97.0000 . . . 0.2969 0.0000 0.2325 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.4700 2.6600 2889 . 141 2748 98.0000 . . . 0.3225 0.0000 0.2359 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.6600 2.9200 2946 . 151 2795 100.0000 . . . 0.3197 0.0000 0.2432 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.9200 3.3500 2964 . 146 2818 100.0000 . . . 0.2517 0.0000 0.2102 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.3500 4.2100 3003 . 156 2847 100.0000 . . . 0.2545 0.0000 0.2042 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 4.2100 36.0200 3155 . 153 3002 99.0000 . . . 0.2358 0.0000 0.2368 . . . . . . . 6 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and ((resid 153 and (name N or name CA or name C or name O or name CB )) or resid 154 through 179 or (resid 180 through 181 and (name N or name CA or name C or name O or name CB )) or resid 182 through 184 or (resid 185 through 186 and (name N or name CA or name C or name O or name CB )) or resid 187 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 212 or resid 214 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 282 or (resid 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 285 or (resid 286 and (name N or name CA or name C or name O or name CB )) or resid 287 through 292 or (resid 293 and (name N or name CA or name C or name O or name CB )) or resid 294 through 330 or resid 332 through 334 or (resid 335 and (name N or name CA or name C or name O or name CB )) or resid 336)) ; 1 2 ;(chain B and (resid 153 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 195 or (resid 196 and (name N or name CA or name C or name O or name CB )) or resid 197 through 212 or resid 214 through 251 or (resid 252 and (name N or name CA or name C or name O or name CB )) or resid 253 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 300 or (resid 301 through 302 and (name N or name CA or name C or name O or name CB )) or resid 303 through 319 or (resid 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 336)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A PHE 15 . A PHE 15 . A PHE 153 A PHE 153 ? ;(chain A and ((resid 153 and (name N or name CA or name C or name O or name CB )) or resid 154 through 179 or (resid 180 through 181 and (name N or name CA or name C or name O or name CB )) or resid 182 through 184 or (resid 185 through 186 and (name N or name CA or name C or name O or name CB )) or resid 187 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 212 or resid 214 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 282 or (resid 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 285 or (resid 286 and (name N or name CA or name C or name O or name CB )) or resid 287 through 292 or (resid 293 and (name N or name CA or name C or name O or name CB )) or resid 294 through 330 or resid 332 through 334 or (resid 335 and (name N or name CA or name C or name O or name CB )) or resid 336)) ; 1 1 2 A GLY 13 . A GLU 199 . A GLY 151 A GLU 337 ? ;(chain A and ((resid 153 and (name N or name CA or name C or name O or name CB )) or resid 154 through 179 or (resid 180 through 181 and (name N or name CA or name C or name O or name CB )) or resid 182 through 184 or (resid 185 through 186 and (name N or name CA or name C or name O or name CB )) or resid 187 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 212 or resid 214 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 282 or (resid 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 285 or (resid 286 and (name N or name CA or name C or name O or name CB )) or resid 287 through 292 or (resid 293 and (name N or name CA or name C or name O or name CB )) or resid 294 through 330 or resid 332 through 334 or (resid 335 and (name N or name CA or name C or name O or name CB )) or resid 336)) ; 1 1 3 A GLY 13 . A GLU 199 . A GLY 151 A GLU 337 ? ;(chain A and ((resid 153 and (name N or name CA or name C or name O or name CB )) or resid 154 through 179 or (resid 180 through 181 and (name N or name CA or name C or name O or name CB )) or resid 182 through 184 or (resid 185 through 186 and (name N or name CA or name C or name O or name CB )) or resid 187 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 212 or resid 214 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 282 or (resid 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 285 or (resid 286 and (name N or name CA or name C or name O or name CB )) or resid 287 through 292 or (resid 293 and (name N or name CA or name C or name O or name CB )) or resid 294 through 330 or resid 332 through 334 or (resid 335 and (name N or name CA or name C or name O or name CB )) or resid 336)) ; 1 1 4 A GLY 13 . A GLU 199 . A GLY 151 A GLU 337 ? ;(chain A and ((resid 153 and (name N or name CA or name C or name O or name CB )) or resid 154 through 179 or (resid 180 through 181 and (name N or name CA or name C or name O or name CB )) or resid 182 through 184 or (resid 185 through 186 and (name N or name CA or name C or name O or name CB )) or resid 187 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 212 or resid 214 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 282 or (resid 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 285 or (resid 286 and (name N or name CA or name C or name O or name CB )) or resid 287 through 292 or (resid 293 and (name N or name CA or name C or name O or name CB )) or resid 294 through 330 or resid 332 through 334 or (resid 335 and (name N or name CA or name C or name O or name CB )) or resid 336)) ; 1 1 5 A GLY 13 . A GLU 199 . A GLY 151 A GLU 337 ? ;(chain A and ((resid 153 and (name N or name CA or name C or name O or name CB )) or resid 154 through 179 or (resid 180 through 181 and (name N or name CA or name C or name O or name CB )) or resid 182 through 184 or (resid 185 through 186 and (name N or name CA or name C or name O or name CB )) or resid 187 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 212 or resid 214 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 282 or (resid 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 285 or (resid 286 and (name N or name CA or name C or name O or name CB )) or resid 287 through 292 or (resid 293 and (name N or name CA or name C or name O or name CB )) or resid 294 through 330 or resid 332 through 334 or (resid 335 and (name N or name CA or name C or name O or name CB )) or resid 336)) ; 1 2 1 B PHE 15 . B PRO 35 . B PHE 153 B PRO 173 ? ;(chain B and (resid 153 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 195 or (resid 196 and (name N or name CA or name C or name O or name CB )) or resid 197 through 212 or resid 214 through 251 or (resid 252 and (name N or name CA or name C or name O or name CB )) or resid 253 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 300 or (resid 301 through 302 and (name N or name CA or name C or name O or name CB )) or resid 303 through 319 or (resid 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 336)) ; 1 2 2 B GLU 36 . B GLU 36 . B GLU 174 B GLU 174 ? ;(chain B and (resid 153 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 195 or (resid 196 and (name N or name CA or name C or name O or name CB )) or resid 197 through 212 or resid 214 through 251 or (resid 252 and (name N or name CA or name C or name O or name CB )) or resid 253 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 300 or (resid 301 through 302 and (name N or name CA or name C or name O or name CB )) or resid 303 through 319 or (resid 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 336)) ; 1 2 3 B PHE 15 . B GLU 199 . B PHE 153 B GLU 337 ? ;(chain B and (resid 153 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 195 or (resid 196 and (name N or name CA or name C or name O or name CB )) or resid 197 through 212 or resid 214 through 251 or (resid 252 and (name N or name CA or name C or name O or name CB )) or resid 253 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 300 or (resid 301 through 302 and (name N or name CA or name C or name O or name CB )) or resid 303 through 319 or (resid 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 336)) ; 1 2 4 B PHE 15 . B GLU 199 . B PHE 153 B GLU 337 ? ;(chain B and (resid 153 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 195 or (resid 196 and (name N or name CA or name C or name O or name CB )) or resid 197 through 212 or resid 214 through 251 or (resid 252 and (name N or name CA or name C or name O or name CB )) or resid 253 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 300 or (resid 301 through 302 and (name N or name CA or name C or name O or name CB )) or resid 303 through 319 or (resid 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 336)) ; 1 2 5 B PHE 15 . B GLU 199 . B PHE 153 B GLU 337 ? ;(chain B and (resid 153 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 195 or (resid 196 and (name N or name CA or name C or name O or name CB )) or resid 197 through 212 or resid 214 through 251 or (resid 252 and (name N or name CA or name C or name O or name CB )) or resid 253 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 300 or (resid 301 through 302 and (name N or name CA or name C or name O or name CB )) or resid 303 through 319 or (resid 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 336)) ; 1 2 6 B PHE 15 . B GLU 199 . B PHE 153 B GLU 337 ? ;(chain B and (resid 153 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 195 or (resid 196 and (name N or name CA or name C or name O or name CB )) or resid 197 through 212 or resid 214 through 251 or (resid 252 and (name N or name CA or name C or name O or name CB )) or resid 253 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 300 or (resid 301 through 302 and (name N or name CA or name C or name O or name CB )) or resid 303 through 319 or (resid 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 336)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 8A2J _struct.title ;human STING in complex with 2'-3'-cyclic-GMP-7-deaza(4-biphenylyl)-AMP ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8A2J _struct_keywords.text 'Complex, STING, cyclic dinucleotide, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STING_HUMAN _struct_ref.pdbx_db_accession Q86WV6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNI RFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDIL ADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS ; _struct_ref.pdbx_align_begin 140 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8A2J A 2 ? 241 ? Q86WV6 140 ? 379 ? 140 379 2 1 8A2J B 2 ? 241 ? Q86WV6 140 ? 379 ? 140 379 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8A2J SER A 1 ? UNP Q86WV6 ? ? 'expression tag' 139 1 1 8A2J ARG A 94 ? UNP Q86WV6 HIS 232 variant 232 2 2 8A2J SER B 1 ? UNP Q86WV6 ? ? 'expression tag' 139 3 2 8A2J ARG B 94 ? UNP Q86WV6 HIS 232 variant 232 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 13 ? GLY A 28 ? GLY A 151 GLY A 166 1 ? 16 HELX_P HELX_P2 AA2 TYR A 29 ? ASN A 49 ? TYR A 167 ASN A 187 1 ? 21 HELX_P HELX_P3 AA3 THR A 125 ? TYR A 136 ? THR A 263 TYR A 274 1 ? 12 HELX_P HELX_P4 AA4 SER A 137 ? GLY A 140 ? SER A 275 GLY A 278 5 ? 4 HELX_P HELX_P5 AA5 SER A 142 ? ASP A 163 ? SER A 280 ASP A 301 1 ? 22 HELX_P HELX_P6 AA6 SER A 186 ? GLU A 198 ? SER A 324 GLU A 336 1 ? 13 HELX_P HELX_P7 AA7 ASN B 16 ? TYR B 29 ? ASN B 154 TYR B 167 1 ? 14 HELX_P HELX_P8 AA8 TYR B 29 ? LEU B 34 ? TYR B 167 LEU B 172 1 ? 6 HELX_P HELX_P9 AA9 GLU B 36 ? ASN B 45 ? GLU B 174 ASN B 183 1 ? 10 HELX_P HELX_P10 AB1 ASN B 73 ? ASP B 78 ? ASN B 211 ASP B 216 1 ? 6 HELX_P HELX_P11 AB2 THR B 125 ? SER B 134 ? THR B 263 SER B 272 1 ? 10 HELX_P HELX_P12 AB3 TYR B 136 ? GLY B 140 ? TYR B 274 GLY B 278 5 ? 5 HELX_P HELX_P13 AB4 SER B 142 ? ALA B 162 ? SER B 280 ALA B 300 1 ? 21 HELX_P HELX_P14 AB5 ALA B 164 ? ASN B 169 ? ALA B 302 ASN B 307 1 ? 6 HELX_P HELX_P15 AB6 SER B 186 ? GLU B 199 ? SER B 324 GLU B 337 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 5 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? parallel AA3 4 5 ? parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 81 ? LYS A 86 ? ILE A 219 LYS A 224 AA1 2 SER A 105 ? GLU A 111 ? SER A 243 GLU A 249 AA1 3 GLN A 114 ? TYR A 123 ? GLN A 252 TYR A 261 AA1 4 LEU A 60 ? PRO A 65 ? LEU A 198 PRO A 203 AA1 5 CYS A 171 ? TYR A 176 ? CYS A 309 TYR A 314 AA2 1 GLN A 90 ? ARG A 94 ? GLN A 228 ARG A 232 AA2 2 ILE A 97 ? TYR A 102 ? ILE A 235 TYR A 240 AA3 1 ILE B 81 ? LYS B 86 ? ILE B 219 LYS B 224 AA3 2 SER B 105 ? GLU B 111 ? SER B 243 GLU B 249 AA3 3 GLN B 114 ? TYR B 123 ? GLN B 252 TYR B 261 AA3 4 LEU B 60 ? PRO B 65 ? LEU B 198 PRO B 203 AA3 5 CYS B 171 ? TYR B 176 ? CYS B 309 TYR B 314 AA4 1 GLN B 90 ? ARG B 94 ? GLN B 228 ARG B 232 AA4 2 ILE B 97 ? TYR B 102 ? ILE B 235 TYR B 240 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 85 ? N ASP A 223 O ILE A 106 ? O ILE A 244 AA1 2 3 N GLU A 111 ? N GLU A 249 O GLN A 114 ? O GLN A 252 AA1 3 4 O VAL A 120 ? O VAL A 258 N TYR A 61 ? N TYR A 199 AA1 4 5 N LEU A 64 ? N LEU A 202 O ILE A 174 ? O ILE A 312 AA2 1 2 N GLN A 90 ? N GLN A 228 O TYR A 102 ? O TYR A 240 AA3 1 2 N ASP B 85 ? N ASP B 223 O ILE B 106 ? O ILE B 244 AA3 2 3 N LEU B 109 ? N LEU B 247 O ALA B 116 ? O ALA B 254 AA3 3 4 O VAL B 120 ? O VAL B 258 N TYR B 61 ? N TYR B 199 AA3 4 5 N LEU B 64 ? N LEU B 202 O ILE B 174 ? O ILE B 312 AA4 1 2 N GLN B 90 ? N GLN B 228 O TYR B 102 ? O TYR B 240 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG1 B THR 267 ? ? O B HOH 501 ? ? 2.14 2 1 OE1 A GLN 227 ? ? O A HOH 401 ? ? 2.16 3 1 OG B SER 241 ? ? O B HOH 502 ? ? 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 167 ? ? -144.70 -70.61 2 1 ASN A 188 ? ? -90.22 41.51 3 1 LEU A 202 ? ? -119.62 72.91 4 1 GLN A 306 ? ? -117.20 65.23 5 1 TYR B 167 ? ? -145.89 -73.52 # _pdbx_entry_details.entry_id 8A2J _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 139 ? A SER 1 2 1 Y 1 A ALA 140 ? A ALA 2 3 1 Y 1 A PRO 141 ? A PRO 3 4 1 Y 1 A ALA 142 ? A ALA 4 5 1 Y 1 A GLU 143 ? A GLU 5 6 1 Y 1 A ILE 144 ? A ILE 6 7 1 Y 1 A SER 145 ? A SER 7 8 1 Y 1 A ALA 146 ? A ALA 8 9 1 Y 1 A VAL 147 ? A VAL 9 10 1 Y 1 A CYS 148 ? A CYS 10 11 1 Y 1 A GLU 149 ? A GLU 11 12 1 Y 1 A LYS 150 ? A LYS 12 13 1 Y 1 A ALA 318 ? A ALA 180 14 1 Y 1 A ASP 319 ? A ASP 181 15 1 Y 1 A LYS 338 ? A LYS 200 16 1 Y 1 A GLU 339 ? A GLU 201 17 1 Y 1 A GLU 340 ? A GLU 202 18 1 Y 1 A VAL 341 ? A VAL 203 19 1 Y 1 A THR 342 ? A THR 204 20 1 Y 1 A VAL 343 ? A VAL 205 21 1 Y 1 A GLY 344 ? A GLY 206 22 1 Y 1 A SER 345 ? A SER 207 23 1 Y 1 A LEU 346 ? A LEU 208 24 1 Y 1 A LYS 347 ? A LYS 209 25 1 Y 1 A THR 348 ? A THR 210 26 1 Y 1 A SER 349 ? A SER 211 27 1 Y 1 A ALA 350 ? A ALA 212 28 1 Y 1 A VAL 351 ? A VAL 213 29 1 Y 1 A PRO 352 ? A PRO 214 30 1 Y 1 A SER 353 ? A SER 215 31 1 Y 1 A THR 354 ? A THR 216 32 1 Y 1 A SER 355 ? A SER 217 33 1 Y 1 A THR 356 ? A THR 218 34 1 Y 1 A MET 357 ? A MET 219 35 1 Y 1 A SER 358 ? A SER 220 36 1 Y 1 A GLN 359 ? A GLN 221 37 1 Y 1 A GLU 360 ? A GLU 222 38 1 Y 1 A PRO 361 ? A PRO 223 39 1 Y 1 A GLU 362 ? A GLU 224 40 1 Y 1 A LEU 363 ? A LEU 225 41 1 Y 1 A LEU 364 ? A LEU 226 42 1 Y 1 A ILE 365 ? A ILE 227 43 1 Y 1 A SER 366 ? A SER 228 44 1 Y 1 A GLY 367 ? A GLY 229 45 1 Y 1 A MET 368 ? A MET 230 46 1 Y 1 A GLU 369 ? A GLU 231 47 1 Y 1 A LYS 370 ? A LYS 232 48 1 Y 1 A PRO 371 ? A PRO 233 49 1 Y 1 A LEU 372 ? A LEU 234 50 1 Y 1 A PRO 373 ? A PRO 235 51 1 Y 1 A LEU 374 ? A LEU 236 52 1 Y 1 A ARG 375 ? A ARG 237 53 1 Y 1 A THR 376 ? A THR 238 54 1 Y 1 A ASP 377 ? A ASP 239 55 1 Y 1 A PHE 378 ? A PHE 240 56 1 Y 1 A SER 379 ? A SER 241 57 1 Y 1 B SER 139 ? B SER 1 58 1 Y 1 B ALA 140 ? B ALA 2 59 1 Y 1 B PRO 141 ? B PRO 3 60 1 Y 1 B ALA 142 ? B ALA 4 61 1 Y 1 B GLU 143 ? B GLU 5 62 1 Y 1 B ILE 144 ? B ILE 6 63 1 Y 1 B SER 145 ? B SER 7 64 1 Y 1 B ALA 146 ? B ALA 8 65 1 Y 1 B VAL 147 ? B VAL 9 66 1 Y 1 B CYS 148 ? B CYS 10 67 1 Y 1 B GLU 149 ? B GLU 11 68 1 Y 1 B LYS 150 ? B LYS 12 69 1 Y 1 B GLY 151 ? B GLY 13 70 1 Y 1 B ASN 152 ? B ASN 14 71 1 Y 1 B ASN 188 ? B ASN 50 72 1 Y 1 B LEU 189 ? B LEU 51 73 1 Y 1 B LEU 190 ? B LEU 52 74 1 Y 1 B ARG 191 ? B ARG 53 75 1 Y 1 B GLY 192 ? B GLY 54 76 1 Y 1 B ALA 318 ? B ALA 180 77 1 Y 1 B LYS 338 ? B LYS 200 78 1 Y 1 B GLU 339 ? B GLU 201 79 1 Y 1 B GLU 340 ? B GLU 202 80 1 Y 1 B VAL 341 ? B VAL 203 81 1 Y 1 B THR 342 ? B THR 204 82 1 Y 1 B VAL 343 ? B VAL 205 83 1 Y 1 B GLY 344 ? B GLY 206 84 1 Y 1 B SER 345 ? B SER 207 85 1 Y 1 B LEU 346 ? B LEU 208 86 1 Y 1 B LYS 347 ? B LYS 209 87 1 Y 1 B THR 348 ? B THR 210 88 1 Y 1 B SER 349 ? B SER 211 89 1 Y 1 B ALA 350 ? B ALA 212 90 1 Y 1 B VAL 351 ? B VAL 213 91 1 Y 1 B PRO 352 ? B PRO 214 92 1 Y 1 B SER 353 ? B SER 215 93 1 Y 1 B THR 354 ? B THR 216 94 1 Y 1 B SER 355 ? B SER 217 95 1 Y 1 B THR 356 ? B THR 218 96 1 Y 1 B MET 357 ? B MET 219 97 1 Y 1 B SER 358 ? B SER 220 98 1 Y 1 B GLN 359 ? B GLN 221 99 1 Y 1 B GLU 360 ? B GLU 222 100 1 Y 1 B PRO 361 ? B PRO 223 101 1 Y 1 B GLU 362 ? B GLU 224 102 1 Y 1 B LEU 363 ? B LEU 225 103 1 Y 1 B LEU 364 ? B LEU 226 104 1 Y 1 B ILE 365 ? B ILE 227 105 1 Y 1 B SER 366 ? B SER 228 106 1 Y 1 B GLY 367 ? B GLY 229 107 1 Y 1 B MET 368 ? B MET 230 108 1 Y 1 B GLU 369 ? B GLU 231 109 1 Y 1 B LYS 370 ? B LYS 232 110 1 Y 1 B PRO 371 ? B PRO 233 111 1 Y 1 B LEU 372 ? B LEU 234 112 1 Y 1 B PRO 373 ? B PRO 235 113 1 Y 1 B LEU 374 ? B LEU 236 114 1 Y 1 B ARG 375 ? B ARG 237 115 1 Y 1 B THR 376 ? B THR 238 116 1 Y 1 B ASP 377 ? B ASP 239 117 1 Y 1 B PHE 378 ? B PHE 240 118 1 Y 1 B SER 379 ? B SER 241 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 KWO C13 C N R 183 KWO C17 C N N 184 KWO C20 C N R 185 KWO C22 C Y N 186 KWO C24 C Y N 187 KWO C02 C N R 188 KWO C03 C N S 189 KWO C08 C N R 190 KWO C09 C N N 191 KWO C14 C N R 192 KWO C16 C N R 193 KWO C25 C Y N 194 KWO C27 C N N 195 KWO C30 C N N 196 KWO C35 C N R 197 KWO C37 C Y N 198 KWO C38 C Y N 199 KWO C39 C Y N 200 KWO C40 C Y N 201 KWO C41 C Y N 202 KWO C42 C Y N 203 KWO C43 C Y N 204 KWO C44 C Y N 205 KWO C45 C Y N 206 KWO C46 C Y N 207 KWO C47 C Y N 208 KWO C48 C Y N 209 KWO C49 C Y N 210 KWO C50 C Y N 211 KWO C51 C Y N 212 KWO C52 C Y N 213 KWO C54 C Y N 214 KWO C56 C Y N 215 KWO N21 N Y N 216 KWO N23 N Y N 217 KWO N26 N N N 218 KWO N28 N N N 219 KWO N29 N N N 220 KWO N36 N Y N 221 KWO N53 N Y N 222 KWO N55 N Y N 223 KWO N57 N N N 224 KWO O01 O N N 225 KWO O04 O N N 226 KWO O06 O N N 227 KWO O07 O N N 228 KWO O10 O N N 229 KWO O12 O N N 230 KWO O15 O N N 231 KWO O18 O N N 232 KWO O19 O N N 233 KWO O31 O N N 234 KWO O32 O N N 235 KWO O33 O N N 236 KWO O34 O N N 237 KWO P05 P N N 238 KWO P11 P N N 239 KWO H1 H N N 240 KWO H2 H N N 241 KWO H3 H N N 242 KWO H4 H N N 243 KWO H5 H N N 244 KWO H6 H N N 245 KWO H7 H N N 246 KWO H8 H N N 247 KWO H9 H N N 248 KWO H10 H N N 249 KWO H11 H N N 250 KWO H12 H N N 251 KWO H13 H N N 252 KWO H14 H N N 253 KWO H15 H N N 254 KWO H16 H N N 255 KWO H17 H N N 256 KWO H18 H N N 257 KWO H19 H N N 258 KWO H20 H N N 259 KWO H21 H N N 260 KWO H22 H N N 261 KWO H23 H N N 262 KWO H24 H N N 263 KWO H25 H N N 264 KWO H26 H N N 265 KWO H27 H N N 266 KWO H28 H N N 267 KWO H29 H N N 268 KWO H30 H N N 269 KWO H31 H N N 270 KWO H32 H N N 271 KWO H33 H N N 272 LEU N N N N 273 LEU CA C N S 274 LEU C C N N 275 LEU O O N N 276 LEU CB C N N 277 LEU CG C N N 278 LEU CD1 C N N 279 LEU CD2 C N N 280 LEU OXT O N N 281 LEU H H N N 282 LEU H2 H N N 283 LEU HA H N N 284 LEU HB2 H N N 285 LEU HB3 H N N 286 LEU HG H N N 287 LEU HD11 H N N 288 LEU HD12 H N N 289 LEU HD13 H N N 290 LEU HD21 H N N 291 LEU HD22 H N N 292 LEU HD23 H N N 293 LEU HXT H N N 294 LYS N N N N 295 LYS CA C N S 296 LYS C C N N 297 LYS O O N N 298 LYS CB C N N 299 LYS CG C N N 300 LYS CD C N N 301 LYS CE C N N 302 LYS NZ N N N 303 LYS OXT O N N 304 LYS H H N N 305 LYS H2 H N N 306 LYS HA H N N 307 LYS HB2 H N N 308 LYS HB3 H N N 309 LYS HG2 H N N 310 LYS HG3 H N N 311 LYS HD2 H N N 312 LYS HD3 H N N 313 LYS HE2 H N N 314 LYS HE3 H N N 315 LYS HZ1 H N N 316 LYS HZ2 H N N 317 LYS HZ3 H N N 318 LYS HXT H N N 319 MET N N N N 320 MET CA C N S 321 MET C C N N 322 MET O O N N 323 MET CB C N N 324 MET CG C N N 325 MET SD S N N 326 MET CE C N N 327 MET OXT O N N 328 MET H H N N 329 MET H2 H N N 330 MET HA H N N 331 MET HB2 H N N 332 MET HB3 H N N 333 MET HG2 H N N 334 MET HG3 H N N 335 MET HE1 H N N 336 MET HE2 H N N 337 MET HE3 H N N 338 MET HXT H N N 339 PHE N N N N 340 PHE CA C N S 341 PHE C C N N 342 PHE O O N N 343 PHE CB C N N 344 PHE CG C Y N 345 PHE CD1 C Y N 346 PHE CD2 C Y N 347 PHE CE1 C Y N 348 PHE CE2 C Y N 349 PHE CZ C Y N 350 PHE OXT O N N 351 PHE H H N N 352 PHE H2 H N N 353 PHE HA H N N 354 PHE HB2 H N N 355 PHE HB3 H N N 356 PHE HD1 H N N 357 PHE HD2 H N N 358 PHE HE1 H N N 359 PHE HE2 H N N 360 PHE HZ H N N 361 PHE HXT H N N 362 PRO N N N N 363 PRO CA C N S 364 PRO C C N N 365 PRO O O N N 366 PRO CB C N N 367 PRO CG C N N 368 PRO CD C N N 369 PRO OXT O N N 370 PRO H H N N 371 PRO HA H N N 372 PRO HB2 H N N 373 PRO HB3 H N N 374 PRO HG2 H N N 375 PRO HG3 H N N 376 PRO HD2 H N N 377 PRO HD3 H N N 378 PRO HXT H N N 379 SER N N N N 380 SER CA C N S 381 SER C C N N 382 SER O O N N 383 SER CB C N N 384 SER OG O N N 385 SER OXT O N N 386 SER H H N N 387 SER H2 H N N 388 SER HA H N N 389 SER HB2 H N N 390 SER HB3 H N N 391 SER HG H N N 392 SER HXT H N N 393 THR N N N N 394 THR CA C N S 395 THR C C N N 396 THR O O N N 397 THR CB C N R 398 THR OG1 O N N 399 THR CG2 C N N 400 THR OXT O N N 401 THR H H N N 402 THR H2 H N N 403 THR HA H N N 404 THR HB H N N 405 THR HG1 H N N 406 THR HG21 H N N 407 THR HG22 H N N 408 THR HG23 H N N 409 THR HXT H N N 410 TRP N N N N 411 TRP CA C N S 412 TRP C C N N 413 TRP O O N N 414 TRP CB C N N 415 TRP CG C Y N 416 TRP CD1 C Y N 417 TRP CD2 C Y N 418 TRP NE1 N Y N 419 TRP CE2 C Y N 420 TRP CE3 C Y N 421 TRP CZ2 C Y N 422 TRP CZ3 C Y N 423 TRP CH2 C Y N 424 TRP OXT O N N 425 TRP H H N N 426 TRP H2 H N N 427 TRP HA H N N 428 TRP HB2 H N N 429 TRP HB3 H N N 430 TRP HD1 H N N 431 TRP HE1 H N N 432 TRP HE3 H N N 433 TRP HZ2 H N N 434 TRP HZ3 H N N 435 TRP HH2 H N N 436 TRP HXT H N N 437 TYR N N N N 438 TYR CA C N S 439 TYR C C N N 440 TYR O O N N 441 TYR CB C N N 442 TYR CG C Y N 443 TYR CD1 C Y N 444 TYR CD2 C Y N 445 TYR CE1 C Y N 446 TYR CE2 C Y N 447 TYR CZ C Y N 448 TYR OH O N N 449 TYR OXT O N N 450 TYR H H N N 451 TYR H2 H N N 452 TYR HA H N N 453 TYR HB2 H N N 454 TYR HB3 H N N 455 TYR HD1 H N N 456 TYR HD2 H N N 457 TYR HE1 H N N 458 TYR HE2 H N N 459 TYR HH H N N 460 TYR HXT H N N 461 VAL N N N N 462 VAL CA C N S 463 VAL C C N N 464 VAL O O N N 465 VAL CB C N N 466 VAL CG1 C N N 467 VAL CG2 C N N 468 VAL OXT O N N 469 VAL H H N N 470 VAL H2 H N N 471 VAL HA H N N 472 VAL HB H N N 473 VAL HG11 H N N 474 VAL HG12 H N N 475 VAL HG13 H N N 476 VAL HG21 H N N 477 VAL HG22 H N N 478 VAL HG23 H N N 479 VAL HXT H N N 480 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 KWO C47 C48 doub Y N 173 KWO C47 C46 sing Y N 174 KWO O32 P11 doub N N 175 KWO O33 P11 sing N N 176 KWO C48 C43 sing Y N 177 KWO C46 C45 doub Y N 178 KWO P11 O10 sing N N 179 KWO P11 O12 sing N N 180 KWO C43 C42 sing N N 181 KWO C43 C44 doub Y N 182 KWO O34 C08 sing N N 183 KWO O34 C35 sing N N 184 KWO C41 C42 doub Y N 185 KWO C41 C40 sing Y N 186 KWO C45 C44 sing Y N 187 KWO C42 C49 sing Y N 188 KWO C09 O10 sing N N 189 KWO C09 C08 sing N N 190 KWO C40 C39 doub Y N 191 KWO C49 C50 doub Y N 192 KWO C39 C50 sing Y N 193 KWO C39 C38 sing N N 194 KWO C37 C38 doub Y N 195 KWO C37 N36 sing Y N 196 KWO C08 C03 sing N N 197 KWO C38 C51 sing Y N 198 KWO C35 N36 sing N N 199 KWO C35 C02 sing N N 200 KWO N36 C52 sing Y N 201 KWO O12 C13 sing N N 202 KWO C51 C52 doub Y N 203 KWO C51 C56 sing Y N 204 KWO C52 N53 sing Y N 205 KWO N57 C56 sing N N 206 KWO C56 N55 doub Y N 207 KWO N53 C54 doub Y N 208 KWO O15 C14 sing N N 209 KWO N55 C54 sing Y N 210 KWO N28 C27 sing N N 211 KWO C03 C02 sing N N 212 KWO C03 O04 sing N N 213 KWO C02 O01 sing N N 214 KWO C13 C14 sing N N 215 KWO C13 C20 sing N N 216 KWO C27 N26 doub N N 217 KWO C27 N29 sing N N 218 KWO C14 C16 sing N N 219 KWO N26 C25 sing N N 220 KWO N29 C30 sing N N 221 KWO O04 P05 sing N N 222 KWO C20 N21 sing N N 223 KWO C20 O19 sing N N 224 KWO C25 N21 sing Y N 225 KWO C25 C24 doub Y N 226 KWO C30 C24 sing N N 227 KWO C30 O31 doub N N 228 KWO N21 C22 sing Y N 229 KWO C24 N23 sing Y N 230 KWO C16 O19 sing N N 231 KWO C16 C17 sing N N 232 KWO C22 N23 doub Y N 233 KWO O18 P05 sing N N 234 KWO O18 C17 sing N N 235 KWO P05 O06 doub N N 236 KWO P05 O07 sing N N 237 KWO C13 H1 sing N N 238 KWO C17 H2 sing N N 239 KWO C17 H3 sing N N 240 KWO C20 H4 sing N N 241 KWO C22 H5 sing N N 242 KWO C02 H6 sing N N 243 KWO C03 H7 sing N N 244 KWO C08 H8 sing N N 245 KWO C09 H9 sing N N 246 KWO C09 H10 sing N N 247 KWO C14 H11 sing N N 248 KWO C16 H12 sing N N 249 KWO C35 H13 sing N N 250 KWO C37 H14 sing N N 251 KWO C40 H15 sing N N 252 KWO C41 H16 sing N N 253 KWO C44 H17 sing N N 254 KWO C45 H18 sing N N 255 KWO C46 H19 sing N N 256 KWO C47 H20 sing N N 257 KWO C48 H21 sing N N 258 KWO C49 H22 sing N N 259 KWO C50 H23 sing N N 260 KWO C54 H24 sing N N 261 KWO N28 H25 sing N N 262 KWO N28 H26 sing N N 263 KWO N29 H27 sing N N 264 KWO N57 H28 sing N N 265 KWO N57 H29 sing N N 266 KWO O01 H30 sing N N 267 KWO O07 H31 sing N N 268 KWO O15 H32 sing N N 269 KWO O33 H33 sing N N 270 LEU N CA sing N N 271 LEU N H sing N N 272 LEU N H2 sing N N 273 LEU CA C sing N N 274 LEU CA CB sing N N 275 LEU CA HA sing N N 276 LEU C O doub N N 277 LEU C OXT sing N N 278 LEU CB CG sing N N 279 LEU CB HB2 sing N N 280 LEU CB HB3 sing N N 281 LEU CG CD1 sing N N 282 LEU CG CD2 sing N N 283 LEU CG HG sing N N 284 LEU CD1 HD11 sing N N 285 LEU CD1 HD12 sing N N 286 LEU CD1 HD13 sing N N 287 LEU CD2 HD21 sing N N 288 LEU CD2 HD22 sing N N 289 LEU CD2 HD23 sing N N 290 LEU OXT HXT sing N N 291 LYS N CA sing N N 292 LYS N H sing N N 293 LYS N H2 sing N N 294 LYS CA C sing N N 295 LYS CA CB sing N N 296 LYS CA HA sing N N 297 LYS C O doub N N 298 LYS C OXT sing N N 299 LYS CB CG sing N N 300 LYS CB HB2 sing N N 301 LYS CB HB3 sing N N 302 LYS CG CD sing N N 303 LYS CG HG2 sing N N 304 LYS CG HG3 sing N N 305 LYS CD CE sing N N 306 LYS CD HD2 sing N N 307 LYS CD HD3 sing N N 308 LYS CE NZ sing N N 309 LYS CE HE2 sing N N 310 LYS CE HE3 sing N N 311 LYS NZ HZ1 sing N N 312 LYS NZ HZ2 sing N N 313 LYS NZ HZ3 sing N N 314 LYS OXT HXT sing N N 315 MET N CA sing N N 316 MET N H sing N N 317 MET N H2 sing N N 318 MET CA C sing N N 319 MET CA CB sing N N 320 MET CA HA sing N N 321 MET C O doub N N 322 MET C OXT sing N N 323 MET CB CG sing N N 324 MET CB HB2 sing N N 325 MET CB HB3 sing N N 326 MET CG SD sing N N 327 MET CG HG2 sing N N 328 MET CG HG3 sing N N 329 MET SD CE sing N N 330 MET CE HE1 sing N N 331 MET CE HE2 sing N N 332 MET CE HE3 sing N N 333 MET OXT HXT sing N N 334 PHE N CA sing N N 335 PHE N H sing N N 336 PHE N H2 sing N N 337 PHE CA C sing N N 338 PHE CA CB sing N N 339 PHE CA HA sing N N 340 PHE C O doub N N 341 PHE C OXT sing N N 342 PHE CB CG sing N N 343 PHE CB HB2 sing N N 344 PHE CB HB3 sing N N 345 PHE CG CD1 doub Y N 346 PHE CG CD2 sing Y N 347 PHE CD1 CE1 sing Y N 348 PHE CD1 HD1 sing N N 349 PHE CD2 CE2 doub Y N 350 PHE CD2 HD2 sing N N 351 PHE CE1 CZ doub Y N 352 PHE CE1 HE1 sing N N 353 PHE CE2 CZ sing Y N 354 PHE CE2 HE2 sing N N 355 PHE CZ HZ sing N N 356 PHE OXT HXT sing N N 357 PRO N CA sing N N 358 PRO N CD sing N N 359 PRO N H sing N N 360 PRO CA C sing N N 361 PRO CA CB sing N N 362 PRO CA HA sing N N 363 PRO C O doub N N 364 PRO C OXT sing N N 365 PRO CB CG sing N N 366 PRO CB HB2 sing N N 367 PRO CB HB3 sing N N 368 PRO CG CD sing N N 369 PRO CG HG2 sing N N 370 PRO CG HG3 sing N N 371 PRO CD HD2 sing N N 372 PRO CD HD3 sing N N 373 PRO OXT HXT sing N N 374 SER N CA sing N N 375 SER N H sing N N 376 SER N H2 sing N N 377 SER CA C sing N N 378 SER CA CB sing N N 379 SER CA HA sing N N 380 SER C O doub N N 381 SER C OXT sing N N 382 SER CB OG sing N N 383 SER CB HB2 sing N N 384 SER CB HB3 sing N N 385 SER OG HG sing N N 386 SER OXT HXT sing N N 387 THR N CA sing N N 388 THR N H sing N N 389 THR N H2 sing N N 390 THR CA C sing N N 391 THR CA CB sing N N 392 THR CA HA sing N N 393 THR C O doub N N 394 THR C OXT sing N N 395 THR CB OG1 sing N N 396 THR CB CG2 sing N N 397 THR CB HB sing N N 398 THR OG1 HG1 sing N N 399 THR CG2 HG21 sing N N 400 THR CG2 HG22 sing N N 401 THR CG2 HG23 sing N N 402 THR OXT HXT sing N N 403 TRP N CA sing N N 404 TRP N H sing N N 405 TRP N H2 sing N N 406 TRP CA C sing N N 407 TRP CA CB sing N N 408 TRP CA HA sing N N 409 TRP C O doub N N 410 TRP C OXT sing N N 411 TRP CB CG sing N N 412 TRP CB HB2 sing N N 413 TRP CB HB3 sing N N 414 TRP CG CD1 doub Y N 415 TRP CG CD2 sing Y N 416 TRP CD1 NE1 sing Y N 417 TRP CD1 HD1 sing N N 418 TRP CD2 CE2 doub Y N 419 TRP CD2 CE3 sing Y N 420 TRP NE1 CE2 sing Y N 421 TRP NE1 HE1 sing N N 422 TRP CE2 CZ2 sing Y N 423 TRP CE3 CZ3 doub Y N 424 TRP CE3 HE3 sing N N 425 TRP CZ2 CH2 doub Y N 426 TRP CZ2 HZ2 sing N N 427 TRP CZ3 CH2 sing Y N 428 TRP CZ3 HZ3 sing N N 429 TRP CH2 HH2 sing N N 430 TRP OXT HXT sing N N 431 TYR N CA sing N N 432 TYR N H sing N N 433 TYR N H2 sing N N 434 TYR CA C sing N N 435 TYR CA CB sing N N 436 TYR CA HA sing N N 437 TYR C O doub N N 438 TYR C OXT sing N N 439 TYR CB CG sing N N 440 TYR CB HB2 sing N N 441 TYR CB HB3 sing N N 442 TYR CG CD1 doub Y N 443 TYR CG CD2 sing Y N 444 TYR CD1 CE1 sing Y N 445 TYR CD1 HD1 sing N N 446 TYR CD2 CE2 doub Y N 447 TYR CD2 HD2 sing N N 448 TYR CE1 CZ doub Y N 449 TYR CE1 HE1 sing N N 450 TYR CE2 CZ sing Y N 451 TYR CE2 HE2 sing N N 452 TYR CZ OH sing N N 453 TYR OH HH sing N N 454 TYR OXT HXT sing N N 455 VAL N CA sing N N 456 VAL N H sing N N 457 VAL N H2 sing N N 458 VAL CA C sing N N 459 VAL CA CB sing N N 460 VAL CA HA sing N N 461 VAL C O doub N N 462 VAL C OXT sing N N 463 VAL CB CG1 sing N N 464 VAL CB CG2 sing N N 465 VAL CB HB sing N N 466 VAL CG1 HG11 sing N N 467 VAL CG1 HG12 sing N N 468 VAL CG1 HG13 sing N N 469 VAL CG2 HG21 sing N N 470 VAL CG2 HG22 sing N N 471 VAL CG2 HG23 sing N N 472 VAL OXT HXT sing N N 473 # _pdbx_audit_support.funding_organization 'European Regional Development Fund' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number CZ.02.1.01/0.0/0.0/16_019/0000729 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id KWO _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id KWO _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4KSY _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8A2J _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010606 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008554 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027793 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_