data_8A4Y # _entry.id 8A4Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8A4Y pdb_00008a4y 10.2210/pdb8a4y/pdb WWPDB D_1292123640 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-23 2 'Structure model' 1 1 2022-11-30 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8A4Y _pdbx_database_status.recvd_initial_deposition_date 2022-06-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email f.kozielski@ucl.ac.uk _pdbx_contact_author.name_first Frank _pdbx_contact_author.name_last Kozielski _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6096-9102 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Borsatto, A.' 1 0000-0002-8889-6491 'Galdadas, I.' 2 0000-0003-2136-9723 'Ma, S.' 3 0000-0002-9560-5082 'Damfo, S.' 4 ? 'Haider, S.' 5 0000-0003-2650-2925 'Kozielski, F.' 6 0000-0001-6096-9102 'Estarellas, C.' 7 0000-0002-0944-9053 'Gervasio, F.L.' 8 0000-0003-4831-5039 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Revealing druggable cryptic pockets in the Nsp1 of SARS-CoV-2 and other beta-coronaviruses by simulations and crystallography.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.81167 _citation.pdbx_database_id_PubMed 36412088 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Borsatto, A.' 1 ? primary 'Akkad, O.' 2 ? primary 'Galdadas, I.' 3 ? primary 'Ma, S.' 4 ? primary 'Damfo, S.' 5 ? primary 'Haider, S.' 6 ? primary 'Kozielski, F.' 7 ? primary 'Estarellas, C.' 8 ? primary 'Gervasio, F.L.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Host translation inhibitor nsp1' 13109.153 1 ? ? ? ? 2 non-polymer syn 'N-(2,3-dihydro-1H-inden-5-yl)acetamide' 175.227 1 ? ? ? ? 3 water nat water 18.015 138 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Leader protein,Non-structural protein 1,nsp1,SARS-CoV-2 non-structural protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVEL VAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKN ; _entity_poly.pdbx_seq_one_letter_code_can ;MEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVEL VAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-(2,3-dihydro-1H-inden-5-yl)acetamide' QO6 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LYS n 1 4 THR n 1 5 HIS n 1 6 VAL n 1 7 GLN n 1 8 LEU n 1 9 SER n 1 10 LEU n 1 11 PRO n 1 12 VAL n 1 13 LEU n 1 14 GLN n 1 15 VAL n 1 16 ARG n 1 17 ASP n 1 18 VAL n 1 19 LEU n 1 20 VAL n 1 21 ARG n 1 22 GLY n 1 23 PHE n 1 24 GLY n 1 25 ASP n 1 26 SER n 1 27 VAL n 1 28 GLU n 1 29 GLU n 1 30 VAL n 1 31 LEU n 1 32 SER n 1 33 GLU n 1 34 ALA n 1 35 ARG n 1 36 GLN n 1 37 HIS n 1 38 LEU n 1 39 LYS n 1 40 ASP n 1 41 GLY n 1 42 THR n 1 43 CYS n 1 44 GLY n 1 45 LEU n 1 46 VAL n 1 47 GLU n 1 48 VAL n 1 49 GLU n 1 50 LYS n 1 51 GLY n 1 52 VAL n 1 53 LEU n 1 54 PRO n 1 55 GLN n 1 56 LEU n 1 57 GLU n 1 58 GLN n 1 59 PRO n 1 60 TYR n 1 61 VAL n 1 62 PHE n 1 63 ILE n 1 64 LYS n 1 65 ARG n 1 66 SER n 1 67 ASP n 1 68 ALA n 1 69 ARG n 1 70 THR n 1 71 ALA n 1 72 PRO n 1 73 HIS n 1 74 GLY n 1 75 HIS n 1 76 VAL n 1 77 MET n 1 78 VAL n 1 79 GLU n 1 80 LEU n 1 81 VAL n 1 82 ALA n 1 83 GLU n 1 84 LEU n 1 85 GLU n 1 86 GLY n 1 87 ILE n 1 88 GLN n 1 89 TYR n 1 90 GLY n 1 91 ARG n 1 92 SER n 1 93 GLY n 1 94 GLU n 1 95 THR n 1 96 LEU n 1 97 GLY n 1 98 VAL n 1 99 LEU n 1 100 VAL n 1 101 PRO n 1 102 HIS n 1 103 VAL n 1 104 GLY n 1 105 GLU n 1 106 ILE n 1 107 PRO n 1 108 VAL n 1 109 ALA n 1 110 TYR n 1 111 ARG n 1 112 LYS n 1 113 VAL n 1 114 LEU n 1 115 LEU n 1 116 ARG n 1 117 LYS n 1 118 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 118 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rep, 1a-1b' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Severe acute respiratory syndrome coronavirus 2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2697049 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QO6 non-polymer . 'N-(2,3-dihydro-1H-inden-5-yl)acetamide' '~{N}-(2,3-dihydro-1~{H}-inden-5-yl)ethanamide' 'C11 H13 N O' 175.227 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 9 9 MET MET A . n A 1 2 GLU 2 10 10 GLU GLU A . n A 1 3 LYS 3 11 11 LYS LYS A . n A 1 4 THR 4 12 12 THR THR A . n A 1 5 HIS 5 13 13 HIS HIS A . n A 1 6 VAL 6 14 14 VAL VAL A . n A 1 7 GLN 7 15 15 GLN GLN A . n A 1 8 LEU 8 16 16 LEU LEU A . n A 1 9 SER 9 17 17 SER SER A . n A 1 10 LEU 10 18 18 LEU LEU A . n A 1 11 PRO 11 19 19 PRO PRO A . n A 1 12 VAL 12 20 20 VAL VAL A . n A 1 13 LEU 13 21 21 LEU LEU A . n A 1 14 GLN 14 22 22 GLN GLN A . n A 1 15 VAL 15 23 23 VAL VAL A . n A 1 16 ARG 16 24 24 ARG ARG A . n A 1 17 ASP 17 25 25 ASP ASP A . n A 1 18 VAL 18 26 26 VAL VAL A . n A 1 19 LEU 19 27 27 LEU LEU A . n A 1 20 VAL 20 28 28 VAL VAL A . n A 1 21 ARG 21 29 29 ARG ARG A . n A 1 22 GLY 22 30 30 GLY GLY A . n A 1 23 PHE 23 31 31 PHE PHE A . n A 1 24 GLY 24 32 32 GLY GLY A . n A 1 25 ASP 25 33 33 ASP ASP A . n A 1 26 SER 26 34 34 SER SER A . n A 1 27 VAL 27 35 35 VAL VAL A . n A 1 28 GLU 28 36 36 GLU GLU A . n A 1 29 GLU 29 37 37 GLU GLU A . n A 1 30 VAL 30 38 38 VAL VAL A . n A 1 31 LEU 31 39 39 LEU LEU A . n A 1 32 SER 32 40 40 SER SER A . n A 1 33 GLU 33 41 41 GLU GLU A . n A 1 34 ALA 34 42 42 ALA ALA A . n A 1 35 ARG 35 43 43 ARG ARG A . n A 1 36 GLN 36 44 44 GLN GLN A . n A 1 37 HIS 37 45 45 HIS HIS A . n A 1 38 LEU 38 46 46 LEU LEU A . n A 1 39 LYS 39 47 47 LYS LYS A . n A 1 40 ASP 40 48 48 ASP ASP A . n A 1 41 GLY 41 49 49 GLY GLY A . n A 1 42 THR 42 50 50 THR THR A . n A 1 43 CYS 43 51 51 CYS CYS A . n A 1 44 GLY 44 52 52 GLY GLY A . n A 1 45 LEU 45 53 53 LEU LEU A . n A 1 46 VAL 46 54 54 VAL VAL A . n A 1 47 GLU 47 55 55 GLU GLU A . n A 1 48 VAL 48 56 56 VAL VAL A . n A 1 49 GLU 49 57 57 GLU GLU A . n A 1 50 LYS 50 58 58 LYS LYS A . n A 1 51 GLY 51 59 59 GLY GLY A . n A 1 52 VAL 52 60 60 VAL VAL A . n A 1 53 LEU 53 61 61 LEU LEU A . n A 1 54 PRO 54 62 62 PRO PRO A . n A 1 55 GLN 55 63 63 GLN GLN A . n A 1 56 LEU 56 64 64 LEU LEU A . n A 1 57 GLU 57 65 65 GLU GLU A . n A 1 58 GLN 58 66 66 GLN GLN A . n A 1 59 PRO 59 67 67 PRO PRO A . n A 1 60 TYR 60 68 68 TYR TYR A . n A 1 61 VAL 61 69 69 VAL VAL A . n A 1 62 PHE 62 70 70 PHE PHE A . n A 1 63 ILE 63 71 71 ILE ILE A . n A 1 64 LYS 64 72 72 LYS LYS A . n A 1 65 ARG 65 73 73 ARG ARG A . n A 1 66 SER 66 74 74 SER SER A . n A 1 67 ASP 67 75 75 ASP ASP A . n A 1 68 ALA 68 76 76 ALA ALA A . n A 1 69 ARG 69 77 77 ARG ARG A . n A 1 70 THR 70 78 78 THR THR A . n A 1 71 ALA 71 79 79 ALA ALA A . n A 1 72 PRO 72 80 80 PRO PRO A . n A 1 73 HIS 73 81 81 HIS HIS A . n A 1 74 GLY 74 82 82 GLY GLY A . n A 1 75 HIS 75 83 83 HIS HIS A . n A 1 76 VAL 76 84 84 VAL VAL A . n A 1 77 MET 77 85 85 MET MET A . n A 1 78 VAL 78 86 86 VAL VAL A . n A 1 79 GLU 79 87 87 GLU GLU A . n A 1 80 LEU 80 88 88 LEU LEU A . n A 1 81 VAL 81 89 89 VAL VAL A . n A 1 82 ALA 82 90 90 ALA ALA A . n A 1 83 GLU 83 91 91 GLU GLU A . n A 1 84 LEU 84 92 92 LEU LEU A . n A 1 85 GLU 85 93 93 GLU GLU A . n A 1 86 GLY 86 94 94 GLY GLY A . n A 1 87 ILE 87 95 95 ILE ILE A . n A 1 88 GLN 88 96 96 GLN GLN A . n A 1 89 TYR 89 97 97 TYR TYR A . n A 1 90 GLY 90 98 98 GLY GLY A . n A 1 91 ARG 91 99 99 ARG ARG A . n A 1 92 SER 92 100 100 SER SER A . n A 1 93 GLY 93 101 101 GLY GLY A . n A 1 94 GLU 94 102 102 GLU GLU A . n A 1 95 THR 95 103 103 THR THR A . n A 1 96 LEU 96 104 104 LEU LEU A . n A 1 97 GLY 97 105 105 GLY GLY A . n A 1 98 VAL 98 106 106 VAL VAL A . n A 1 99 LEU 99 107 107 LEU LEU A . n A 1 100 VAL 100 108 108 VAL VAL A . n A 1 101 PRO 101 109 109 PRO PRO A . n A 1 102 HIS 102 110 110 HIS HIS A . n A 1 103 VAL 103 111 111 VAL VAL A . n A 1 104 GLY 104 112 112 GLY GLY A . n A 1 105 GLU 105 113 113 GLU GLU A . n A 1 106 ILE 106 114 114 ILE ILE A . n A 1 107 PRO 107 115 115 PRO PRO A . n A 1 108 VAL 108 116 116 VAL VAL A . n A 1 109 ALA 109 117 117 ALA ALA A . n A 1 110 TYR 110 118 118 TYR TYR A . n A 1 111 ARG 111 119 119 ARG ARG A . n A 1 112 LYS 112 120 120 LYS LYS A . n A 1 113 VAL 113 121 121 VAL VAL A . n A 1 114 LEU 114 122 122 LEU LEU A . n A 1 115 LEU 115 123 123 LEU LEU A . n A 1 116 ARG 116 124 124 ARG ARG A . n A 1 117 LYS 117 125 125 LYS LYS A . n A 1 118 ASN 118 126 126 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 QO6 1 201 201 QO6 LIG A . C 3 HOH 1 301 165 HOH HOH A . C 3 HOH 2 302 149 HOH HOH A . C 3 HOH 3 303 67 HOH HOH A . C 3 HOH 4 304 121 HOH HOH A . C 3 HOH 5 305 141 HOH HOH A . C 3 HOH 6 306 127 HOH HOH A . C 3 HOH 7 307 139 HOH HOH A . C 3 HOH 8 308 60 HOH HOH A . C 3 HOH 9 309 23 HOH HOH A . C 3 HOH 10 310 3 HOH HOH A . C 3 HOH 11 311 39 HOH HOH A . C 3 HOH 12 312 126 HOH HOH A . C 3 HOH 13 313 130 HOH HOH A . C 3 HOH 14 314 122 HOH HOH A . C 3 HOH 15 315 48 HOH HOH A . C 3 HOH 16 316 27 HOH HOH A . C 3 HOH 17 317 105 HOH HOH A . C 3 HOH 18 318 140 HOH HOH A . C 3 HOH 19 319 34 HOH HOH A . C 3 HOH 20 320 5 HOH HOH A . C 3 HOH 21 321 82 HOH HOH A . C 3 HOH 22 322 13 HOH HOH A . C 3 HOH 23 323 64 HOH HOH A . C 3 HOH 24 324 38 HOH HOH A . C 3 HOH 25 325 55 HOH HOH A . C 3 HOH 26 326 72 HOH HOH A . C 3 HOH 27 327 116 HOH HOH A . C 3 HOH 28 328 73 HOH HOH A . C 3 HOH 29 329 129 HOH HOH A . C 3 HOH 30 330 143 HOH HOH A . C 3 HOH 31 331 41 HOH HOH A . C 3 HOH 32 332 1 HOH HOH A . C 3 HOH 33 333 109 HOH HOH A . C 3 HOH 34 334 54 HOH HOH A . C 3 HOH 35 335 45 HOH HOH A . C 3 HOH 36 336 22 HOH HOH A . C 3 HOH 37 337 6 HOH HOH A . C 3 HOH 38 338 8 HOH HOH A . C 3 HOH 39 339 7 HOH HOH A . C 3 HOH 40 340 28 HOH HOH A . C 3 HOH 41 341 46 HOH HOH A . C 3 HOH 42 342 42 HOH HOH A . C 3 HOH 43 343 2 HOH HOH A . C 3 HOH 44 344 78 HOH HOH A . C 3 HOH 45 345 119 HOH HOH A . C 3 HOH 46 346 84 HOH HOH A . C 3 HOH 47 347 157 HOH HOH A . C 3 HOH 48 348 20 HOH HOH A . C 3 HOH 49 349 37 HOH HOH A . C 3 HOH 50 350 15 HOH HOH A . C 3 HOH 51 351 31 HOH HOH A . C 3 HOH 52 352 26 HOH HOH A . C 3 HOH 53 353 10 HOH HOH A . C 3 HOH 54 354 16 HOH HOH A . C 3 HOH 55 355 4 HOH HOH A . C 3 HOH 56 356 32 HOH HOH A . C 3 HOH 57 357 21 HOH HOH A . C 3 HOH 58 358 17 HOH HOH A . C 3 HOH 59 359 19 HOH HOH A . C 3 HOH 60 360 153 HOH HOH A . C 3 HOH 61 361 30 HOH HOH A . C 3 HOH 62 362 40 HOH HOH A . C 3 HOH 63 363 43 HOH HOH A . C 3 HOH 64 364 89 HOH HOH A . C 3 HOH 65 365 18 HOH HOH A . C 3 HOH 66 366 25 HOH HOH A . C 3 HOH 67 367 62 HOH HOH A . C 3 HOH 68 368 108 HOH HOH A . C 3 HOH 69 369 33 HOH HOH A . C 3 HOH 70 370 12 HOH HOH A . C 3 HOH 71 371 11 HOH HOH A . C 3 HOH 72 372 120 HOH HOH A . C 3 HOH 73 373 52 HOH HOH A . C 3 HOH 74 374 58 HOH HOH A . C 3 HOH 75 375 9 HOH HOH A . C 3 HOH 76 376 29 HOH HOH A . C 3 HOH 77 377 102 HOH HOH A . C 3 HOH 78 378 92 HOH HOH A . C 3 HOH 79 379 111 HOH HOH A . C 3 HOH 80 380 113 HOH HOH A . C 3 HOH 81 381 49 HOH HOH A . C 3 HOH 82 382 137 HOH HOH A . C 3 HOH 83 383 146 HOH HOH A . C 3 HOH 84 384 166 HOH HOH A . C 3 HOH 85 385 36 HOH HOH A . C 3 HOH 86 386 77 HOH HOH A . C 3 HOH 87 387 125 HOH HOH A . C 3 HOH 88 388 114 HOH HOH A . C 3 HOH 89 389 94 HOH HOH A . C 3 HOH 90 390 93 HOH HOH A . C 3 HOH 91 391 115 HOH HOH A . C 3 HOH 92 392 106 HOH HOH A . C 3 HOH 93 393 164 HOH HOH A . C 3 HOH 94 394 51 HOH HOH A . C 3 HOH 95 395 66 HOH HOH A . C 3 HOH 96 396 103 HOH HOH A . C 3 HOH 97 397 24 HOH HOH A . C 3 HOH 98 398 167 HOH HOH A . C 3 HOH 99 399 124 HOH HOH A . C 3 HOH 100 400 50 HOH HOH A . C 3 HOH 101 401 75 HOH HOH A . C 3 HOH 102 402 112 HOH HOH A . C 3 HOH 103 403 128 HOH HOH A . C 3 HOH 104 404 56 HOH HOH A . C 3 HOH 105 405 145 HOH HOH A . C 3 HOH 106 406 80 HOH HOH A . C 3 HOH 107 407 104 HOH HOH A . C 3 HOH 108 408 65 HOH HOH A . C 3 HOH 109 409 123 HOH HOH A . C 3 HOH 110 410 136 HOH HOH A . C 3 HOH 111 411 156 HOH HOH A . C 3 HOH 112 412 117 HOH HOH A . C 3 HOH 113 413 47 HOH HOH A . C 3 HOH 114 414 59 HOH HOH A . C 3 HOH 115 415 68 HOH HOH A . C 3 HOH 116 416 71 HOH HOH A . C 3 HOH 117 417 79 HOH HOH A . C 3 HOH 118 418 142 HOH HOH A . C 3 HOH 119 419 155 HOH HOH A . C 3 HOH 120 420 53 HOH HOH A . C 3 HOH 121 421 138 HOH HOH A . C 3 HOH 122 422 134 HOH HOH A . C 3 HOH 123 423 154 HOH HOH A . C 3 HOH 124 424 158 HOH HOH A . C 3 HOH 125 425 132 HOH HOH A . C 3 HOH 126 426 63 HOH HOH A . C 3 HOH 127 427 148 HOH HOH A . C 3 HOH 128 428 159 HOH HOH A . C 3 HOH 129 429 161 HOH HOH A . C 3 HOH 130 430 151 HOH HOH A . C 3 HOH 131 431 107 HOH HOH A . C 3 HOH 132 432 163 HOH HOH A . C 3 HOH 133 433 160 HOH HOH A . C 3 HOH 134 434 147 HOH HOH A . C 3 HOH 135 435 133 HOH HOH A . C 3 HOH 136 436 87 HOH HOH A . C 3 HOH 137 437 162 HOH HOH A . C 3 HOH 138 438 91 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 10 ? CG ? A GLU 2 CG 2 1 Y 1 A GLU 10 ? CD ? A GLU 2 CD 3 1 Y 1 A GLU 10 ? OE1 ? A GLU 2 OE1 4 1 Y 1 A GLU 10 ? OE2 ? A GLU 2 OE2 5 1 Y 1 A LYS 47 ? NZ ? A LYS 39 NZ 6 1 Y 1 A LYS 58 ? CD ? A LYS 50 CD 7 1 Y 1 A LYS 58 ? CE ? A LYS 50 CE 8 1 Y 1 A LYS 58 ? NZ ? A LYS 50 NZ 9 1 Y 1 A ARG 77 ? CG ? A ARG 69 CG 10 1 Y 1 A ARG 77 ? CD ? A ARG 69 CD 11 1 Y 1 A ARG 77 ? NE ? A ARG 69 NE 12 1 Y 1 A ARG 77 ? CZ ? A ARG 69 CZ 13 1 Y 1 A ARG 77 ? NH1 ? A ARG 69 NH1 14 1 Y 1 A ARG 77 ? NH2 ? A ARG 69 NH2 15 1 Y 1 A ARG 124 ? NE ? A ARG 116 NE 16 1 Y 1 A ARG 124 ? CZ ? A ARG 116 CZ 17 1 Y 1 A ARG 124 ? NH1 ? A ARG 116 NH1 18 1 Y 1 A ARG 124 ? NH2 ? A ARG 116 NH2 19 1 Y 1 A ASN 126 ? CG ? A ASN 118 CG 20 1 Y 1 A ASN 126 ? OD1 ? A ASN 118 OD1 21 1 Y 1 A ASN 126 ? ND2 ? A ASN 118 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19_4092 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? v1.0 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? v1.0 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19_4092 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8A4Y _cell.details ? _cell.formula_units_Z ? _cell.length_a 36.688 _cell.length_a_esd ? _cell.length_b 36.688 _cell.length_b_esd ? _cell.length_c 140.928 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8A4Y _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8A4Y _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.81 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Commercial screen Index 44 (0.1 M HEPES pH 7.5, 25% w/v PEG3350) was chosen for SARS-CoV-2 nsp1 (residues 10 to 126) crystallisation in large quantities using hanging drop method. Frozen stocks of SARS-CoV-2 nsp1 (residues 10 to 126) were thawed on ice and centrifuged in a Thermo Scientific Pico 17 Microcentrifuge, 24-Pl Rotor at 4 degrees, 20000 rpm for 10 min to remove aggregates before the determination of the protein concentration. Subsequently, the protein stock was diluted to 20 mg/mL with precrystallisation buffer (10 mM HEPES and 300 mM NaCl). 400 uL of Index condition 44 was added into each reservoir well. Five protein drops were set on each cover slip by mixing 1 uL of protein solution with 1 uL of the reservoir. The 24-well Linbro plates were incubated at 18 degrees. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-06-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.96546 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.96546 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8A4Y _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.0990 _reflns.d_resolution_low 35.5050 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 40443 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.067 _reflns.pdbx_Rpim_I_all 0.020 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.10 _reflns_shell.d_res_low 1.12 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1953 _reflns_shell.percent_possible_all 98.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.750 _reflns_shell.pdbx_Rpim_I_all 0.291 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.801 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 128.460 _refine.B_iso_mean 23.0262 _refine.B_iso_min 8.440 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8A4Y _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.0990 _refine.ls_d_res_low 35.5050 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 40438 _refine.ls_number_reflns_R_free 2064 _refine.ls_number_reflns_R_work 38374 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8600 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1477 _refine.ls_R_factor_R_free 0.1664 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1468 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7K7P _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 14.0700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.0990 _refine_hist.d_res_low 35.5050 _refine_hist.number_atoms_solvent 138 _refine_hist.number_atoms_total 1063 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 118 _refine_hist.pdbx_B_iso_mean_ligand 51.43 _refine_hist.pdbx_B_iso_mean_solvent 34.71 _refine_hist.pdbx_number_atoms_protein 899 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 ? 966 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.270 ? 1320 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.093 ? 156 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 171 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.113 ? 367 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.0990 1.1243 . . 131 2483 98.0000 . . . 0.2219 0.0000 0.2073 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1243 1.1524 . . 117 2508 100.0000 . . . 0.2070 0.0000 0.1664 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1524 1.1835 . . 148 2530 100.0000 . . . 0.1684 0.0000 0.1556 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1835 1.2184 . . 144 2454 100.0000 . . . 0.1749 0.0000 0.1602 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2184 1.2577 . . 126 2531 100.0000 . . . 0.1852 0.0000 0.1485 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2577 1.3026 . . 163 2507 100.0000 . . . 0.1803 0.0000 0.1471 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3026 1.3548 . . 133 2506 100.0000 . . . 0.1595 0.0000 0.1341 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3548 1.4165 . . 136 2534 100.0000 . . . 0.1689 0.0000 0.1336 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4165 1.4911 . . 141 2525 100.0000 . . . 0.1481 0.0000 0.1220 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4911 1.5846 . . 133 2563 100.0000 . . . 0.1639 0.0000 0.1194 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5846 1.7069 . . 149 2548 100.0000 . . . 0.1479 0.0000 0.1264 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7069 1.8787 . . 125 2585 100.0000 . . . 0.1572 0.0000 0.1383 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8787 2.1505 . . 156 2600 100.0000 . . . 0.1648 0.0000 0.1327 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1505 2.7093 . . 138 2637 100.0000 . . . 0.1663 0.0000 0.1578 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7093 35.5050 . . 124 2863 100.0000 . . . 0.1680 0.0000 0.1553 . . . . . . . . . . . # _struct.entry_id 8A4Y _struct.title 'SARS-CoV-2 non-structural protein-1 (nsp1) in complex with N-(2,3-dihydro-1H-inden-5-yl)acetamide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8A4Y _struct_keywords.text 'SARS-CoV-2, non-structural protein-1, fragment hit, complex, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code R1AB_SARS2 _struct_ref.pdbx_db_accession P0DTD1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELV AELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKN ; _struct_ref.pdbx_align_begin 10 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8A4Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 118 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0DTD1 _struct_ref_seq.db_align_beg 10 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 126 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 126 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8A4Y _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P0DTD1 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 9 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 14 ? VAL A 18 ? GLN A 22 VAL A 26 5 ? 5 HELX_P HELX_P2 AA2 SER A 26 ? GLY A 41 ? SER A 34 GLY A 49 1 ? 16 HELX_P HELX_P3 AA3 VAL A 52 ? LEU A 56 ? VAL A 60 LEU A 64 5 ? 5 HELX_P HELX_P4 AA4 ALA A 71 ? HIS A 75 ? ALA A 79 HIS A 83 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 58 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 66 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 59 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 67 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -9.34 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 87 ? TYR A 89 ? ILE A 95 TYR A 97 AA1 2 VAL A 76 ? LEU A 84 ? VAL A 84 LEU A 92 AA1 3 ALA A 109 ? ARG A 116 ? ALA A 117 ARG A 124 AA1 4 HIS A 5 ? VAL A 12 ? HIS A 13 VAL A 20 AA1 5 CYS A 43 ? VAL A 46 ? CYS A 51 VAL A 54 AA1 6 THR A 95 ? PRO A 101 ? THR A 103 PRO A 109 AA1 7 TYR A 60 ? ARG A 65 ? TYR A 68 ARG A 73 AA1 8 VAL A 76 ? LEU A 84 ? VAL A 84 LEU A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 89 ? O TYR A 97 N ALA A 82 ? N ALA A 90 AA1 2 3 N VAL A 76 ? N VAL A 84 O LEU A 114 ? O LEU A 122 AA1 3 4 O ALA A 109 ? O ALA A 117 N VAL A 12 ? N VAL A 20 AA1 4 5 N PRO A 11 ? N PRO A 19 O LEU A 45 ? O LEU A 53 AA1 5 6 N GLY A 44 ? N GLY A 52 O VAL A 100 ? O VAL A 108 AA1 6 7 O LEU A 99 ? O LEU A 107 N VAL A 61 ? N VAL A 69 AA1 7 8 N PHE A 62 ? N PHE A 70 O VAL A 81 ? O VAL A 89 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 125 ? ? O13 A QO6 201 ? ? 1.53 2 1 O A HOH 369 ? ? O A HOH 423 ? ? 2.04 3 1 O A HOH 372 ? ? O A HOH 382 ? ? 2.06 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 351 ? ? 1_555 O A HOH 436 ? ? 1_545 1.88 2 1 O A HOH 411 ? ? 1_555 O A HOH 411 ? ? 7_645 1.96 3 1 OD2 A ASP 33 ? ? 1_555 OG1 A THR 78 ? ? 4_545 2.13 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 99 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 99 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 99 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 116.61 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.69 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_entry_details.entry_id 8A4Y _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 435 ? 5.82 . 2 1 O ? A HOH 436 ? 6.22 . 3 1 O ? A HOH 437 ? 6.55 . 4 1 O ? A HOH 438 ? 8.58 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 QO6 O13 O N N 290 QO6 C11 C N N 291 QO6 C12 C N N 292 QO6 N10 N N N 293 QO6 C7 C Y N 294 QO6 C3 C Y N 295 QO6 C9 C Y N 296 QO6 C5 C Y N 297 QO6 C2 C Y N 298 QO6 C6 C N N 299 QO6 C8 C N N 300 QO6 C4 C N N 301 QO6 C1 C Y N 302 QO6 H2 H N N 303 QO6 H3 H N N 304 QO6 H1 H N N 305 QO6 H4 H N N 306 QO6 H5 H N N 307 QO6 H7 H N N 308 QO6 H8 H N N 309 QO6 H10 H N N 310 QO6 H102 H N N 311 QO6 H11 H N N 312 QO6 H092 H N N 313 QO6 H12 H N N 314 QO6 H13 H N N 315 SER N N N N 316 SER CA C N S 317 SER C C N N 318 SER O O N N 319 SER CB C N N 320 SER OG O N N 321 SER OXT O N N 322 SER H H N N 323 SER H2 H N N 324 SER HA H N N 325 SER HB2 H N N 326 SER HB3 H N N 327 SER HG H N N 328 SER HXT H N N 329 THR N N N N 330 THR CA C N S 331 THR C C N N 332 THR O O N N 333 THR CB C N R 334 THR OG1 O N N 335 THR CG2 C N N 336 THR OXT O N N 337 THR H H N N 338 THR H2 H N N 339 THR HA H N N 340 THR HB H N N 341 THR HG1 H N N 342 THR HG21 H N N 343 THR HG22 H N N 344 THR HG23 H N N 345 THR HXT H N N 346 TYR N N N N 347 TYR CA C N S 348 TYR C C N N 349 TYR O O N N 350 TYR CB C N N 351 TYR CG C Y N 352 TYR CD1 C Y N 353 TYR CD2 C Y N 354 TYR CE1 C Y N 355 TYR CE2 C Y N 356 TYR CZ C Y N 357 TYR OH O N N 358 TYR OXT O N N 359 TYR H H N N 360 TYR H2 H N N 361 TYR HA H N N 362 TYR HB2 H N N 363 TYR HB3 H N N 364 TYR HD1 H N N 365 TYR HD2 H N N 366 TYR HE1 H N N 367 TYR HE2 H N N 368 TYR HH H N N 369 TYR HXT H N N 370 VAL N N N N 371 VAL CA C N S 372 VAL C C N N 373 VAL O O N N 374 VAL CB C N N 375 VAL CG1 C N N 376 VAL CG2 C N N 377 VAL OXT O N N 378 VAL H H N N 379 VAL H2 H N N 380 VAL HA H N N 381 VAL HB H N N 382 VAL HG11 H N N 383 VAL HG12 H N N 384 VAL HG13 H N N 385 VAL HG21 H N N 386 VAL HG22 H N N 387 VAL HG23 H N N 388 VAL HXT H N N 389 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 QO6 C12 C11 sing N N 277 QO6 C11 O13 doub N N 278 QO6 C11 N10 sing N N 279 QO6 N10 C7 sing N N 280 QO6 C7 C9 doub Y N 281 QO6 C7 C3 sing Y N 282 QO6 C9 C5 sing Y N 283 QO6 C3 C1 doub Y N 284 QO6 C5 C2 doub Y N 285 QO6 C1 C2 sing Y N 286 QO6 C1 C4 sing N N 287 QO6 C2 C6 sing N N 288 QO6 C4 C8 sing N N 289 QO6 C6 C8 sing N N 290 QO6 C12 H2 sing N N 291 QO6 C12 H3 sing N N 292 QO6 C12 H1 sing N N 293 QO6 N10 H4 sing N N 294 QO6 C3 H5 sing N N 295 QO6 C9 H7 sing N N 296 QO6 C5 H8 sing N N 297 QO6 C6 H10 sing N N 298 QO6 C6 H102 sing N N 299 QO6 C8 H11 sing N N 300 QO6 C8 H092 sing N N 301 QO6 C4 H12 sing N N 302 QO6 C4 H13 sing N N 303 SER N CA sing N N 304 SER N H sing N N 305 SER N H2 sing N N 306 SER CA C sing N N 307 SER CA CB sing N N 308 SER CA HA sing N N 309 SER C O doub N N 310 SER C OXT sing N N 311 SER CB OG sing N N 312 SER CB HB2 sing N N 313 SER CB HB3 sing N N 314 SER OG HG sing N N 315 SER OXT HXT sing N N 316 THR N CA sing N N 317 THR N H sing N N 318 THR N H2 sing N N 319 THR CA C sing N N 320 THR CA CB sing N N 321 THR CA HA sing N N 322 THR C O doub N N 323 THR C OXT sing N N 324 THR CB OG1 sing N N 325 THR CB CG2 sing N N 326 THR CB HB sing N N 327 THR OG1 HG1 sing N N 328 THR CG2 HG21 sing N N 329 THR CG2 HG22 sing N N 330 THR CG2 HG23 sing N N 331 THR OXT HXT sing N N 332 TYR N CA sing N N 333 TYR N H sing N N 334 TYR N H2 sing N N 335 TYR CA C sing N N 336 TYR CA CB sing N N 337 TYR CA HA sing N N 338 TYR C O doub N N 339 TYR C OXT sing N N 340 TYR CB CG sing N N 341 TYR CB HB2 sing N N 342 TYR CB HB3 sing N N 343 TYR CG CD1 doub Y N 344 TYR CG CD2 sing Y N 345 TYR CD1 CE1 sing Y N 346 TYR CD1 HD1 sing N N 347 TYR CD2 CE2 doub Y N 348 TYR CD2 HD2 sing N N 349 TYR CE1 CZ doub Y N 350 TYR CE1 HE1 sing N N 351 TYR CE2 CZ sing Y N 352 TYR CE2 HE2 sing N N 353 TYR CZ OH sing N N 354 TYR OH HH sing N N 355 TYR OXT HXT sing N N 356 VAL N CA sing N N 357 VAL N H sing N N 358 VAL N H2 sing N N 359 VAL CA C sing N N 360 VAL CA CB sing N N 361 VAL CA HA sing N N 362 VAL C O doub N N 363 VAL C OXT sing N N 364 VAL CB CG1 sing N N 365 VAL CB CG2 sing N N 366 VAL CB HB sing N N 367 VAL CG1 HG11 sing N N 368 VAL CG1 HG12 sing N N 369 VAL CG1 HG13 sing N N 370 VAL CG2 HG21 sing N N 371 VAL CG2 HG22 sing N N 372 VAL CG2 HG23 sing N N 373 VAL OXT HXT sing N N 374 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id QO6 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id QO6 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7K7P _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8A4Y _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.027257 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027257 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007096 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_