data_8AEJ # _entry.id 8AEJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.376 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8AEJ pdb_00008aej 10.2210/pdb8aej/pdb WWPDB D_1292124230 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8AEJ _pdbx_database_status.recvd_initial_deposition_date 2022-07-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schwartz, M.' 1 ? 'Briand, L.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of dog odorant binding protein' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Glaz, M.' 1 ? primary 'Schwartz, M.' 2 ? primary 'Briand, L.' 3 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8AEJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.075 _cell.length_a_esd ? _cell.length_b 67.075 _cell.length_b_esd ? _cell.length_c 71.985 _cell.length_c_esd ? _cell.volume 280474.901 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8AEJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ;P 31 2" ; _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Lipocalin Can f 6.0101' 21792.520 1 ? ? ? ? 2 non-polymer syn '(+)-menthone' 154.249 1 ? ? ? ? 3 water nat water 18.015 62 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Allergen Can f 6' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRGSHHHHHHTDPHEEENDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVKDIEVLSNSSLIFTMHTKVNGKC TKISLICNKTEKDGEYDVVHDGYNLFRIIETAYEDYIIFHLNNVNQEQEFQLMELYGRKPDVSPKVKEKFVRYCQGMEIP KENILDLTQVDRCLQARQSEAAQVSSAE ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSHHHHHHTDPHEEENDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVKDIEVLSNSSLIFTMHTKVNGKC TKISLICNKTEKDGEYDVVHDGYNLFRIIETAYEDYIIFHLNNVNQEQEFQLMELYGRKPDVSPKVKEKFVRYCQGMEIP KENILDLTQVDRCLQARQSEAAQVSSAE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 THR n 1 12 ASP n 1 13 PRO n 1 14 HIS n 1 15 GLU n 1 16 GLU n 1 17 GLU n 1 18 ASN n 1 19 ASP n 1 20 VAL n 1 21 VAL n 1 22 LYS n 1 23 GLY n 1 24 ASN n 1 25 PHE n 1 26 ASP n 1 27 ILE n 1 28 SER n 1 29 LYS n 1 30 ILE n 1 31 SER n 1 32 GLY n 1 33 ASP n 1 34 TRP n 1 35 TYR n 1 36 SER n 1 37 ILE n 1 38 LEU n 1 39 LEU n 1 40 ALA n 1 41 SER n 1 42 ASP n 1 43 ILE n 1 44 LYS n 1 45 GLU n 1 46 LYS n 1 47 ILE n 1 48 GLU n 1 49 GLU n 1 50 ASN n 1 51 GLY n 1 52 SER n 1 53 MET n 1 54 ARG n 1 55 VAL n 1 56 PHE n 1 57 VAL n 1 58 LYS n 1 59 ASP n 1 60 ILE n 1 61 GLU n 1 62 VAL n 1 63 LEU n 1 64 SER n 1 65 ASN n 1 66 SER n 1 67 SER n 1 68 LEU n 1 69 ILE n 1 70 PHE n 1 71 THR n 1 72 MET n 1 73 HIS n 1 74 THR n 1 75 LYS n 1 76 VAL n 1 77 ASN n 1 78 GLY n 1 79 LYS n 1 80 CYS n 1 81 THR n 1 82 LYS n 1 83 ILE n 1 84 SER n 1 85 LEU n 1 86 ILE n 1 87 CYS n 1 88 ASN n 1 89 LYS n 1 90 THR n 1 91 GLU n 1 92 LYS n 1 93 ASP n 1 94 GLY n 1 95 GLU n 1 96 TYR n 1 97 ASP n 1 98 VAL n 1 99 VAL n 1 100 HIS n 1 101 ASP n 1 102 GLY n 1 103 TYR n 1 104 ASN n 1 105 LEU n 1 106 PHE n 1 107 ARG n 1 108 ILE n 1 109 ILE n 1 110 GLU n 1 111 THR n 1 112 ALA n 1 113 TYR n 1 114 GLU n 1 115 ASP n 1 116 TYR n 1 117 ILE n 1 118 ILE n 1 119 PHE n 1 120 HIS n 1 121 LEU n 1 122 ASN n 1 123 ASN n 1 124 VAL n 1 125 ASN n 1 126 GLN n 1 127 GLU n 1 128 GLN n 1 129 GLU n 1 130 PHE n 1 131 GLN n 1 132 LEU n 1 133 MET n 1 134 GLU n 1 135 LEU n 1 136 TYR n 1 137 GLY n 1 138 ARG n 1 139 LYS n 1 140 PRO n 1 141 ASP n 1 142 VAL n 1 143 SER n 1 144 PRO n 1 145 LYS n 1 146 VAL n 1 147 LYS n 1 148 GLU n 1 149 LYS n 1 150 PHE n 1 151 VAL n 1 152 ARG n 1 153 TYR n 1 154 CYS n 1 155 GLN n 1 156 GLY n 1 157 MET n 1 158 GLU n 1 159 ILE n 1 160 PRO n 1 161 LYS n 1 162 GLU n 1 163 ASN n 1 164 ILE n 1 165 LEU n 1 166 ASP n 1 167 LEU n 1 168 THR n 1 169 GLN n 1 170 VAL n 1 171 ASP n 1 172 ARG n 1 173 CYS n 1 174 LEU n 1 175 GLN n 1 176 ALA n 1 177 ARG n 1 178 GLN n 1 179 SER n 1 180 GLU n 1 181 ALA n 1 182 ALA n 1 183 GLN n 1 184 VAL n 1 185 SER n 1 186 SER n 1 187 ALA n 1 188 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 188 _entity_src_gen.gene_src_common_name dog _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Canis lupus familiaris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9615 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LI601_CANLF _struct_ref.pdbx_db_accession H2B3G5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HEEENDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVKDIEVLSNSSLIFTMHTKVNGKCTKISLICNKTEKD GEYDVVHDGYNLFRIIETAYEDYIIFHLNNVNQEQEFQLMELYGRKPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRC LQARQSEAAQVSSAE ; _struct_ref.pdbx_align_begin 16 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8AEJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 14 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 188 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession H2B3G5 _struct_ref_seq.db_align_beg 16 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 190 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 175 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8AEJ MET A 1 ? UNP H2B3G5 ? ? 'initiating methionine' -12 1 1 8AEJ ARG A 2 ? UNP H2B3G5 ? ? 'expression tag' -11 2 1 8AEJ GLY A 3 ? UNP H2B3G5 ? ? 'expression tag' -10 3 1 8AEJ SER A 4 ? UNP H2B3G5 ? ? 'expression tag' -9 4 1 8AEJ HIS A 5 ? UNP H2B3G5 ? ? 'expression tag' -8 5 1 8AEJ HIS A 6 ? UNP H2B3G5 ? ? 'expression tag' -7 6 1 8AEJ HIS A 7 ? UNP H2B3G5 ? ? 'expression tag' -6 7 1 8AEJ HIS A 8 ? UNP H2B3G5 ? ? 'expression tag' -5 8 1 8AEJ HIS A 9 ? UNP H2B3G5 ? ? 'expression tag' -4 9 1 8AEJ HIS A 10 ? UNP H2B3G5 ? ? 'expression tag' -3 10 1 8AEJ THR A 11 ? UNP H2B3G5 ? ? 'expression tag' -2 11 1 8AEJ ASP A 12 ? UNP H2B3G5 ? ? 'expression tag' -1 12 1 8AEJ PRO A 13 ? UNP H2B3G5 ? ? 'expression tag' 0 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LWE non-polymer . '(+)-menthone' ? 'C10 H18 O' 154.249 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8AEJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG 550, 6% 2-propanol in 0.1 M pH 4.6 sodium acetate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-10-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.978564 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.978564 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate 35.92 _reflns.entry_id 8AEJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.84 _reflns.d_resolution_low 45.21 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16710 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.9 _reflns.pdbx_Rmerge_I_obs 0.034 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 42.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.035 _reflns.pdbx_Rpim_I_all 0.01 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.00 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.84 _reflns_shell.d_res_low 1.88 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 970 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.461 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.473 _reflns_shell.pdbx_Rpim_I_all 0.105 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.985 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 40.64 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8AEJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.84 _refine.ls_d_res_low 45.21 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16661 _refine.ls_number_reflns_R_free 881 _refine.ls_number_reflns_R_work 15780 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.80 _refine.ls_percent_reflns_R_free 5.29 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2222 _refine.ls_R_factor_R_free 0.2608 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2201 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6NRE _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.2439 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2386 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.84 _refine_hist.d_res_low 45.21 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 1377 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1304 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0117 ? 1336 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2192 ? 1797 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0725 ? 201 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0070 ? 230 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 21.3084 ? 514 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.84 1.96 . . 170 2554 99.27 . . . 0.3569 . 0.2851 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.96 2.11 . . 140 2591 99.67 . . . 0.3602 . 0.2744 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.11 2.32 . . 136 2611 99.93 . . . 0.3388 . 0.2651 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.32 2.65 . . 147 2615 99.96 . . . 0.3313 . 0.2659 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.65 3.34 . . 144 2644 99.96 . . . 0.2776 . 0.2367 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.34 45.21 . . 144 2765 99.97 . . . 0.2051 . 0.1839 . . . . . . . . . . . # _struct.entry_id 8AEJ _struct.title 'X-ray structure of Canis familiaris Odorant Binding Protein 3 bound to menthone' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8AEJ _struct_keywords.text 'Odorant binding protein, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 26 ? SER A 31 ? ASP A 13 SER A 18 5 ? 6 HELX_P HELX_P2 AA2 ILE A 43 ? GLU A 48 ? ILE A 30 GLU A 35 5 ? 6 HELX_P HELX_P3 AA3 SER A 143 ? MET A 157 ? SER A 130 MET A 144 1 ? 15 HELX_P HELX_P4 AA4 PRO A 160 ? GLU A 162 ? PRO A 147 GLU A 149 5 ? 3 HELX_P HELX_P5 AA5 THR A 168 ? VAL A 170 ? THR A 155 VAL A 157 5 ? 3 HELX_P HELX_P6 AA6 CYS A 173 ? ARG A 177 ? CYS A 160 ARG A 164 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 80 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 173 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 67 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 160 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.019 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 32 ? ASP A 33 ? GLY A 19 ASP A 20 AA1 2 PHE A 56 ? SER A 64 ? PHE A 43 SER A 51 AA1 3 SER A 67 ? VAL A 76 ? SER A 54 VAL A 63 AA1 4 LYS A 79 ? LYS A 89 ? LYS A 66 LYS A 76 AA1 5 GLU A 95 ? VAL A 99 ? GLU A 82 VAL A 86 AA1 6 TYR A 103 ? ALA A 112 ? TYR A 90 ALA A 99 AA1 7 TYR A 116 ? VAL A 124 ? TYR A 103 VAL A 111 AA1 8 PHE A 130 ? GLY A 137 ? PHE A 117 GLY A 124 AA1 9 TYR A 35 ? SER A 41 ? TYR A 22 SER A 28 AA1 10 ILE A 164 ? ASP A 166 ? ILE A 151 ASP A 153 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 32 ? N GLY A 19 O ILE A 60 ? O ILE A 47 AA1 2 3 N PHE A 56 ? N PHE A 43 O HIS A 73 ? O HIS A 60 AA1 3 4 N THR A 74 ? N THR A 61 O THR A 81 ? O THR A 68 AA1 4 5 N ASN A 88 ? N ASN A 75 O ASP A 97 ? O ASP A 84 AA1 5 6 N TYR A 96 ? N TYR A 83 O PHE A 106 ? O PHE A 93 AA1 6 7 N TYR A 103 ? N TYR A 90 O VAL A 124 ? O VAL A 111 AA1 7 8 N LEU A 121 ? N LEU A 108 O LEU A 132 ? O LEU A 119 AA1 8 9 O MET A 133 ? O MET A 120 N ALA A 40 ? N ALA A 27 AA1 9 10 N LEU A 39 ? N LEU A 26 O LEU A 165 ? O LEU A 152 # _atom_sites.entry_id 8AEJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014909 _atom_sites.fract_transf_matrix[1][2] 0.008608 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017215 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013892 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -12 ? ? ? A . n A 1 2 ARG 2 -11 ? ? ? A . n A 1 3 GLY 3 -10 ? ? ? A . n A 1 4 SER 4 -9 ? ? ? A . n A 1 5 HIS 5 -8 ? ? ? A . n A 1 6 HIS 6 -7 ? ? ? A . n A 1 7 HIS 7 -6 ? ? ? A . n A 1 8 HIS 8 -5 ? ? ? A . n A 1 9 HIS 9 -4 ? ? ? A . n A 1 10 HIS 10 -3 ? ? ? A . n A 1 11 THR 11 -2 ? ? ? A . n A 1 12 ASP 12 -1 ? ? ? A . n A 1 13 PRO 13 0 ? ? ? A . n A 1 14 HIS 14 1 ? ? ? A . n A 1 15 GLU 15 2 ? ? ? A . n A 1 16 GLU 16 3 ? ? ? A . n A 1 17 GLU 17 4 ? ? ? A . n A 1 18 ASN 18 5 ? ? ? A . n A 1 19 ASP 19 6 6 ASP ASP A . n A 1 20 VAL 20 7 7 VAL VAL A . n A 1 21 VAL 21 8 8 VAL VAL A . n A 1 22 LYS 22 9 9 LYS LYS A . n A 1 23 GLY 23 10 10 GLY GLY A . n A 1 24 ASN 24 11 11 ASN ASN A . n A 1 25 PHE 25 12 12 PHE PHE A . n A 1 26 ASP 26 13 13 ASP ASP A . n A 1 27 ILE 27 14 14 ILE ILE A . n A 1 28 SER 28 15 15 SER SER A . n A 1 29 LYS 29 16 16 LYS LYS A . n A 1 30 ILE 30 17 17 ILE ILE A . n A 1 31 SER 31 18 18 SER SER A . n A 1 32 GLY 32 19 19 GLY GLY A . n A 1 33 ASP 33 20 20 ASP ASP A . n A 1 34 TRP 34 21 21 TRP TRP A . n A 1 35 TYR 35 22 22 TYR TYR A . n A 1 36 SER 36 23 23 SER SER A . n A 1 37 ILE 37 24 24 ILE ILE A . n A 1 38 LEU 38 25 25 LEU LEU A . n A 1 39 LEU 39 26 26 LEU LEU A . n A 1 40 ALA 40 27 27 ALA ALA A . n A 1 41 SER 41 28 28 SER SER A . n A 1 42 ASP 42 29 29 ASP ASP A . n A 1 43 ILE 43 30 30 ILE ILE A . n A 1 44 LYS 44 31 31 LYS LYS A . n A 1 45 GLU 45 32 32 GLU GLU A . n A 1 46 LYS 46 33 33 LYS LYS A . n A 1 47 ILE 47 34 34 ILE ILE A . n A 1 48 GLU 48 35 35 GLU GLU A . n A 1 49 GLU 49 36 36 GLU GLU A . n A 1 50 ASN 50 37 37 ASN ASN A . n A 1 51 GLY 51 38 38 GLY GLY A . n A 1 52 SER 52 39 39 SER SER A . n A 1 53 MET 53 40 40 MET MET A . n A 1 54 ARG 54 41 41 ARG ARG A . n A 1 55 VAL 55 42 42 VAL VAL A . n A 1 56 PHE 56 43 43 PHE PHE A . n A 1 57 VAL 57 44 44 VAL VAL A . n A 1 58 LYS 58 45 45 LYS LYS A . n A 1 59 ASP 59 46 46 ASP ASP A . n A 1 60 ILE 60 47 47 ILE ILE A . n A 1 61 GLU 61 48 48 GLU GLU A . n A 1 62 VAL 62 49 49 VAL VAL A . n A 1 63 LEU 63 50 50 LEU LEU A . n A 1 64 SER 64 51 51 SER SER A . n A 1 65 ASN 65 52 52 ASN ASN A . n A 1 66 SER 66 53 53 SER SER A . n A 1 67 SER 67 54 54 SER SER A . n A 1 68 LEU 68 55 55 LEU LEU A . n A 1 69 ILE 69 56 56 ILE ILE A . n A 1 70 PHE 70 57 57 PHE PHE A . n A 1 71 THR 71 58 58 THR THR A . n A 1 72 MET 72 59 59 MET MET A . n A 1 73 HIS 73 60 60 HIS HIS A . n A 1 74 THR 74 61 61 THR THR A . n A 1 75 LYS 75 62 62 LYS LYS A . n A 1 76 VAL 76 63 63 VAL VAL A . n A 1 77 ASN 77 64 64 ASN ASN A . n A 1 78 GLY 78 65 65 GLY GLY A . n A 1 79 LYS 79 66 66 LYS LYS A . n A 1 80 CYS 80 67 67 CYS CYS A . n A 1 81 THR 81 68 68 THR THR A . n A 1 82 LYS 82 69 69 LYS LYS A . n A 1 83 ILE 83 70 70 ILE ILE A . n A 1 84 SER 84 71 71 SER SER A . n A 1 85 LEU 85 72 72 LEU LEU A . n A 1 86 ILE 86 73 73 ILE ILE A . n A 1 87 CYS 87 74 74 CYS CYS A . n A 1 88 ASN 88 75 75 ASN ASN A . n A 1 89 LYS 89 76 76 LYS LYS A . n A 1 90 THR 90 77 77 THR THR A . n A 1 91 GLU 91 78 78 GLU GLU A . n A 1 92 LYS 92 79 79 LYS LYS A . n A 1 93 ASP 93 80 80 ASP ASP A . n A 1 94 GLY 94 81 81 GLY GLY A . n A 1 95 GLU 95 82 82 GLU GLU A . n A 1 96 TYR 96 83 83 TYR TYR A . n A 1 97 ASP 97 84 84 ASP ASP A . n A 1 98 VAL 98 85 85 VAL VAL A . n A 1 99 VAL 99 86 86 VAL VAL A . n A 1 100 HIS 100 87 87 HIS HIS A . n A 1 101 ASP 101 88 88 ASP ASP A . n A 1 102 GLY 102 89 89 GLY GLY A . n A 1 103 TYR 103 90 90 TYR TYR A . n A 1 104 ASN 104 91 91 ASN ASN A . n A 1 105 LEU 105 92 92 LEU LEU A . n A 1 106 PHE 106 93 93 PHE PHE A . n A 1 107 ARG 107 94 94 ARG ARG A . n A 1 108 ILE 108 95 95 ILE ILE A . n A 1 109 ILE 109 96 96 ILE ILE A . n A 1 110 GLU 110 97 97 GLU GLU A . n A 1 111 THR 111 98 98 THR THR A . n A 1 112 ALA 112 99 99 ALA ALA A . n A 1 113 TYR 113 100 100 TYR TYR A . n A 1 114 GLU 114 101 101 GLU GLU A . n A 1 115 ASP 115 102 102 ASP ASP A . n A 1 116 TYR 116 103 103 TYR TYR A . n A 1 117 ILE 117 104 104 ILE ILE A . n A 1 118 ILE 118 105 105 ILE ILE A . n A 1 119 PHE 119 106 106 PHE PHE A . n A 1 120 HIS 120 107 107 HIS HIS A . n A 1 121 LEU 121 108 108 LEU LEU A . n A 1 122 ASN 122 109 109 ASN ASN A . n A 1 123 ASN 123 110 110 ASN ASN A . n A 1 124 VAL 124 111 111 VAL VAL A . n A 1 125 ASN 125 112 112 ASN ASN A . n A 1 126 GLN 126 113 113 GLN GLN A . n A 1 127 GLU 127 114 114 GLU GLU A . n A 1 128 GLN 128 115 115 GLN GLN A . n A 1 129 GLU 129 116 116 GLU GLU A . n A 1 130 PHE 130 117 117 PHE PHE A . n A 1 131 GLN 131 118 118 GLN GLN A . n A 1 132 LEU 132 119 119 LEU LEU A . n A 1 133 MET 133 120 120 MET MET A . n A 1 134 GLU 134 121 121 GLU GLU A . n A 1 135 LEU 135 122 122 LEU LEU A . n A 1 136 TYR 136 123 123 TYR TYR A . n A 1 137 GLY 137 124 124 GLY GLY A . n A 1 138 ARG 138 125 125 ARG ARG A . n A 1 139 LYS 139 126 126 LYS LYS A . n A 1 140 PRO 140 127 127 PRO PRO A . n A 1 141 ASP 141 128 128 ASP ASP A . n A 1 142 VAL 142 129 129 VAL VAL A . n A 1 143 SER 143 130 130 SER SER A . n A 1 144 PRO 144 131 131 PRO PRO A . n A 1 145 LYS 145 132 132 LYS LYS A . n A 1 146 VAL 146 133 133 VAL VAL A . n A 1 147 LYS 147 134 134 LYS LYS A . n A 1 148 GLU 148 135 135 GLU GLU A . n A 1 149 LYS 149 136 136 LYS LYS A . n A 1 150 PHE 150 137 137 PHE PHE A . n A 1 151 VAL 151 138 138 VAL VAL A . n A 1 152 ARG 152 139 139 ARG ARG A . n A 1 153 TYR 153 140 140 TYR TYR A . n A 1 154 CYS 154 141 141 CYS CYS A . n A 1 155 GLN 155 142 142 GLN GLN A . n A 1 156 GLY 156 143 143 GLY GLY A . n A 1 157 MET 157 144 144 MET MET A . n A 1 158 GLU 158 145 145 GLU GLU A . n A 1 159 ILE 159 146 146 ILE ILE A . n A 1 160 PRO 160 147 147 PRO PRO A . n A 1 161 LYS 161 148 148 LYS LYS A . n A 1 162 GLU 162 149 149 GLU GLU A . n A 1 163 ASN 163 150 150 ASN ASN A . n A 1 164 ILE 164 151 151 ILE ILE A . n A 1 165 LEU 165 152 152 LEU LEU A . n A 1 166 ASP 166 153 153 ASP ASP A . n A 1 167 LEU 167 154 154 LEU LEU A . n A 1 168 THR 168 155 155 THR THR A . n A 1 169 GLN 169 156 156 GLN GLN A . n A 1 170 VAL 170 157 157 VAL VAL A . n A 1 171 ASP 171 158 158 ASP ASP A . n A 1 172 ARG 172 159 159 ARG ARG A . n A 1 173 CYS 173 160 160 CYS CYS A . n A 1 174 LEU 174 161 161 LEU LEU A . n A 1 175 GLN 175 162 162 GLN GLN A . n A 1 176 ALA 176 163 163 ALA ALA A . n A 1 177 ARG 177 164 164 ARG ARG A . n A 1 178 GLN 178 165 165 GLN GLN A . n A 1 179 SER 179 166 ? ? ? A . n A 1 180 GLU 180 167 ? ? ? A . n A 1 181 ALA 181 168 ? ? ? A . n A 1 182 ALA 182 169 ? ? ? A . n A 1 183 GLN 183 170 ? ? ? A . n A 1 184 VAL 184 171 ? ? ? A . n A 1 185 SER 185 172 ? ? ? A . n A 1 186 SER 186 173 ? ? ? A . n A 1 187 ALA 187 174 ? ? ? A . n A 1 188 GLU 188 175 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email loic.briand@inrae.fr _pdbx_contact_author.name_first Loic _pdbx_contact_author.name_last Briand _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8175-5936 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 LWE 1 201 201 LWE XXX A . C 3 HOH 1 301 22 HOH HOH A . C 3 HOH 2 302 23 HOH HOH A . C 3 HOH 3 303 3 HOH HOH A . C 3 HOH 4 304 5 HOH HOH A . C 3 HOH 5 305 17 HOH HOH A . C 3 HOH 6 306 11 HOH HOH A . C 3 HOH 7 307 56 HOH HOH A . C 3 HOH 8 308 57 HOH HOH A . C 3 HOH 9 309 47 HOH HOH A . C 3 HOH 10 310 25 HOH HOH A . C 3 HOH 11 311 32 HOH HOH A . C 3 HOH 12 312 61 HOH HOH A . C 3 HOH 13 313 6 HOH HOH A . C 3 HOH 14 314 37 HOH HOH A . C 3 HOH 15 315 48 HOH HOH A . C 3 HOH 16 316 66 HOH HOH A . C 3 HOH 17 317 39 HOH HOH A . C 3 HOH 18 318 70 HOH HOH A . C 3 HOH 19 319 7 HOH HOH A . C 3 HOH 20 320 10 HOH HOH A . C 3 HOH 21 321 49 HOH HOH A . C 3 HOH 22 322 16 HOH HOH A . C 3 HOH 23 323 27 HOH HOH A . C 3 HOH 24 324 36 HOH HOH A . C 3 HOH 25 325 4 HOH HOH A . C 3 HOH 26 326 41 HOH HOH A . C 3 HOH 27 327 26 HOH HOH A . C 3 HOH 28 328 43 HOH HOH A . C 3 HOH 29 329 51 HOH HOH A . C 3 HOH 30 330 60 HOH HOH A . C 3 HOH 31 331 67 HOH HOH A . C 3 HOH 32 332 14 HOH HOH A . C 3 HOH 33 333 29 HOH HOH A . C 3 HOH 34 334 12 HOH HOH A . C 3 HOH 35 335 69 HOH HOH A . C 3 HOH 36 336 31 HOH HOH A . C 3 HOH 37 337 34 HOH HOH A . C 3 HOH 38 338 15 HOH HOH A . C 3 HOH 39 339 18 HOH HOH A . C 3 HOH 40 340 59 HOH HOH A . C 3 HOH 41 341 9 HOH HOH A . C 3 HOH 42 342 55 HOH HOH A . C 3 HOH 43 343 33 HOH HOH A . C 3 HOH 44 344 68 HOH HOH A . C 3 HOH 45 345 38 HOH HOH A . C 3 HOH 46 346 24 HOH HOH A . C 3 HOH 47 347 8 HOH HOH A . C 3 HOH 48 348 52 HOH HOH A . C 3 HOH 49 349 35 HOH HOH A . C 3 HOH 50 350 72 HOH HOH A . C 3 HOH 51 351 44 HOH HOH A . C 3 HOH 52 352 73 HOH HOH A . C 3 HOH 53 353 42 HOH HOH A . C 3 HOH 54 354 71 HOH HOH A . C 3 HOH 55 355 65 HOH HOH A . C 3 HOH 56 356 40 HOH HOH A . C 3 HOH 57 357 30 HOH HOH A . C 3 HOH 58 358 64 HOH HOH A . C 3 HOH 59 359 46 HOH HOH A . C 3 HOH 60 360 74 HOH HOH A . C 3 HOH 61 361 62 HOH HOH A . C 3 HOH 62 362 28 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8230 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-08-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+1/3 3 -x+y,-x,z+2/3 4 x-y,-y,-z+2/3 5 -x,-x+y,-z+1/3 6 y,x,-z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17_3644 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 8AEJ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 37 ? ? 78.59 -4.19 2 1 LYS A 45 ? ? -107.29 -62.86 3 1 SER A 53 ? ? -146.77 12.13 4 1 HIS A 87 ? ? -173.87 117.67 5 1 ASP A 102 ? ? -130.16 -56.55 6 1 PRO A 127 ? ? -56.57 1.55 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -12 ? A MET 1 2 1 Y 1 A ARG -11 ? A ARG 2 3 1 Y 1 A GLY -10 ? A GLY 3 4 1 Y 1 A SER -9 ? A SER 4 5 1 Y 1 A HIS -8 ? A HIS 5 6 1 Y 1 A HIS -7 ? A HIS 6 7 1 Y 1 A HIS -6 ? A HIS 7 8 1 Y 1 A HIS -5 ? A HIS 8 9 1 Y 1 A HIS -4 ? A HIS 9 10 1 Y 1 A HIS -3 ? A HIS 10 11 1 Y 1 A THR -2 ? A THR 11 12 1 Y 1 A ASP -1 ? A ASP 12 13 1 Y 1 A PRO 0 ? A PRO 13 14 1 Y 1 A HIS 1 ? A HIS 14 15 1 Y 1 A GLU 2 ? A GLU 15 16 1 Y 1 A GLU 3 ? A GLU 16 17 1 Y 1 A GLU 4 ? A GLU 17 18 1 Y 1 A ASN 5 ? A ASN 18 19 1 Y 1 A SER 166 ? A SER 179 20 1 Y 1 A GLU 167 ? A GLU 180 21 1 Y 1 A ALA 168 ? A ALA 181 22 1 Y 1 A ALA 169 ? A ALA 182 23 1 Y 1 A GLN 170 ? A GLN 183 24 1 Y 1 A VAL 171 ? A VAL 184 25 1 Y 1 A SER 172 ? A SER 185 26 1 Y 1 A SER 173 ? A SER 186 27 1 Y 1 A ALA 174 ? A ALA 187 28 1 Y 1 A GLU 175 ? A GLU 188 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LWE C7 C N N 205 LWE C8 C N N 206 LWE C9 C N N 207 LWE C1 C N S 208 LWE C5 C N N 209 LWE C6 C N N 210 LWE C4 C N R 211 LWE C3 C N N 212 LWE C2 C N N 213 LWE C C N N 214 LWE O O N N 215 LWE H1 H N N 216 LWE H2 H N N 217 LWE H3 H N N 218 LWE H4 H N N 219 LWE H5 H N N 220 LWE H6 H N N 221 LWE H7 H N N 222 LWE H8 H N N 223 LWE H9 H N N 224 LWE H10 H N N 225 LWE H11 H N N 226 LWE H12 H N N 227 LWE H13 H N N 228 LWE H14 H N N 229 LWE H15 H N N 230 LWE H16 H N N 231 LWE H17 H N N 232 LWE H18 H N N 233 LYS N N N N 234 LYS CA C N S 235 LYS C C N N 236 LYS O O N N 237 LYS CB C N N 238 LYS CG C N N 239 LYS CD C N N 240 LYS CE C N N 241 LYS NZ N N N 242 LYS OXT O N N 243 LYS H H N N 244 LYS H2 H N N 245 LYS HA H N N 246 LYS HB2 H N N 247 LYS HB3 H N N 248 LYS HG2 H N N 249 LYS HG3 H N N 250 LYS HD2 H N N 251 LYS HD3 H N N 252 LYS HE2 H N N 253 LYS HE3 H N N 254 LYS HZ1 H N N 255 LYS HZ2 H N N 256 LYS HZ3 H N N 257 LYS HXT H N N 258 MET N N N N 259 MET CA C N S 260 MET C C N N 261 MET O O N N 262 MET CB C N N 263 MET CG C N N 264 MET SD S N N 265 MET CE C N N 266 MET OXT O N N 267 MET H H N N 268 MET H2 H N N 269 MET HA H N N 270 MET HB2 H N N 271 MET HB3 H N N 272 MET HG2 H N N 273 MET HG3 H N N 274 MET HE1 H N N 275 MET HE2 H N N 276 MET HE3 H N N 277 MET HXT H N N 278 PHE N N N N 279 PHE CA C N S 280 PHE C C N N 281 PHE O O N N 282 PHE CB C N N 283 PHE CG C Y N 284 PHE CD1 C Y N 285 PHE CD2 C Y N 286 PHE CE1 C Y N 287 PHE CE2 C Y N 288 PHE CZ C Y N 289 PHE OXT O N N 290 PHE H H N N 291 PHE H2 H N N 292 PHE HA H N N 293 PHE HB2 H N N 294 PHE HB3 H N N 295 PHE HD1 H N N 296 PHE HD2 H N N 297 PHE HE1 H N N 298 PHE HE2 H N N 299 PHE HZ H N N 300 PHE HXT H N N 301 PRO N N N N 302 PRO CA C N S 303 PRO C C N N 304 PRO O O N N 305 PRO CB C N N 306 PRO CG C N N 307 PRO CD C N N 308 PRO OXT O N N 309 PRO H H N N 310 PRO HA H N N 311 PRO HB2 H N N 312 PRO HB3 H N N 313 PRO HG2 H N N 314 PRO HG3 H N N 315 PRO HD2 H N N 316 PRO HD3 H N N 317 PRO HXT H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TRP N N N N 350 TRP CA C N S 351 TRP C C N N 352 TRP O O N N 353 TRP CB C N N 354 TRP CG C Y N 355 TRP CD1 C Y N 356 TRP CD2 C Y N 357 TRP NE1 N Y N 358 TRP CE2 C Y N 359 TRP CE3 C Y N 360 TRP CZ2 C Y N 361 TRP CZ3 C Y N 362 TRP CH2 C Y N 363 TRP OXT O N N 364 TRP H H N N 365 TRP H2 H N N 366 TRP HA H N N 367 TRP HB2 H N N 368 TRP HB3 H N N 369 TRP HD1 H N N 370 TRP HE1 H N N 371 TRP HE3 H N N 372 TRP HZ2 H N N 373 TRP HZ3 H N N 374 TRP HH2 H N N 375 TRP HXT H N N 376 TYR N N N N 377 TYR CA C N S 378 TYR C C N N 379 TYR O O N N 380 TYR CB C N N 381 TYR CG C Y N 382 TYR CD1 C Y N 383 TYR CD2 C Y N 384 TYR CE1 C Y N 385 TYR CE2 C Y N 386 TYR CZ C Y N 387 TYR OH O N N 388 TYR OXT O N N 389 TYR H H N N 390 TYR H2 H N N 391 TYR HA H N N 392 TYR HB2 H N N 393 TYR HB3 H N N 394 TYR HD1 H N N 395 TYR HD2 H N N 396 TYR HE1 H N N 397 TYR HE2 H N N 398 TYR HH H N N 399 TYR HXT H N N 400 VAL N N N N 401 VAL CA C N S 402 VAL C C N N 403 VAL O O N N 404 VAL CB C N N 405 VAL CG1 C N N 406 VAL CG2 C N N 407 VAL OXT O N N 408 VAL H H N N 409 VAL H2 H N N 410 VAL HA H N N 411 VAL HB H N N 412 VAL HG11 H N N 413 VAL HG12 H N N 414 VAL HG13 H N N 415 VAL HG21 H N N 416 VAL HG22 H N N 417 VAL HG23 H N N 418 VAL HXT H N N 419 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LWE O C5 doub N N 194 LWE C5 C6 sing N N 195 LWE C5 C4 sing N N 196 LWE C1 C sing N N 197 LWE C1 C6 sing N N 198 LWE C1 C2 sing N N 199 LWE C7 C8 sing N N 200 LWE C7 C4 sing N N 201 LWE C7 C9 sing N N 202 LWE C4 C3 sing N N 203 LWE C3 C2 sing N N 204 LWE C7 H1 sing N N 205 LWE C8 H2 sing N N 206 LWE C8 H3 sing N N 207 LWE C8 H4 sing N N 208 LWE C9 H5 sing N N 209 LWE C9 H6 sing N N 210 LWE C9 H7 sing N N 211 LWE C1 H8 sing N N 212 LWE C6 H9 sing N N 213 LWE C6 H10 sing N N 214 LWE C4 H11 sing N N 215 LWE C3 H12 sing N N 216 LWE C3 H13 sing N N 217 LWE C2 H14 sing N N 218 LWE C2 H15 sing N N 219 LWE C H16 sing N N 220 LWE C H17 sing N N 221 LWE C H18 sing N N 222 LYS N CA sing N N 223 LYS N H sing N N 224 LYS N H2 sing N N 225 LYS CA C sing N N 226 LYS CA CB sing N N 227 LYS CA HA sing N N 228 LYS C O doub N N 229 LYS C OXT sing N N 230 LYS CB CG sing N N 231 LYS CB HB2 sing N N 232 LYS CB HB3 sing N N 233 LYS CG CD sing N N 234 LYS CG HG2 sing N N 235 LYS CG HG3 sing N N 236 LYS CD CE sing N N 237 LYS CD HD2 sing N N 238 LYS CD HD3 sing N N 239 LYS CE NZ sing N N 240 LYS CE HE2 sing N N 241 LYS CE HE3 sing N N 242 LYS NZ HZ1 sing N N 243 LYS NZ HZ2 sing N N 244 LYS NZ HZ3 sing N N 245 LYS OXT HXT sing N N 246 MET N CA sing N N 247 MET N H sing N N 248 MET N H2 sing N N 249 MET CA C sing N N 250 MET CA CB sing N N 251 MET CA HA sing N N 252 MET C O doub N N 253 MET C OXT sing N N 254 MET CB CG sing N N 255 MET CB HB2 sing N N 256 MET CB HB3 sing N N 257 MET CG SD sing N N 258 MET CG HG2 sing N N 259 MET CG HG3 sing N N 260 MET SD CE sing N N 261 MET CE HE1 sing N N 262 MET CE HE2 sing N N 263 MET CE HE3 sing N N 264 MET OXT HXT sing N N 265 PHE N CA sing N N 266 PHE N H sing N N 267 PHE N H2 sing N N 268 PHE CA C sing N N 269 PHE CA CB sing N N 270 PHE CA HA sing N N 271 PHE C O doub N N 272 PHE C OXT sing N N 273 PHE CB CG sing N N 274 PHE CB HB2 sing N N 275 PHE CB HB3 sing N N 276 PHE CG CD1 doub Y N 277 PHE CG CD2 sing Y N 278 PHE CD1 CE1 sing Y N 279 PHE CD1 HD1 sing N N 280 PHE CD2 CE2 doub Y N 281 PHE CD2 HD2 sing N N 282 PHE CE1 CZ doub Y N 283 PHE CE1 HE1 sing N N 284 PHE CE2 CZ sing Y N 285 PHE CE2 HE2 sing N N 286 PHE CZ HZ sing N N 287 PHE OXT HXT sing N N 288 PRO N CA sing N N 289 PRO N CD sing N N 290 PRO N H sing N N 291 PRO CA C sing N N 292 PRO CA CB sing N N 293 PRO CA HA sing N N 294 PRO C O doub N N 295 PRO C OXT sing N N 296 PRO CB CG sing N N 297 PRO CB HB2 sing N N 298 PRO CB HB3 sing N N 299 PRO CG CD sing N N 300 PRO CG HG2 sing N N 301 PRO CG HG3 sing N N 302 PRO CD HD2 sing N N 303 PRO CD HD3 sing N N 304 PRO OXT HXT sing N N 305 SER N CA sing N N 306 SER N H sing N N 307 SER N H2 sing N N 308 SER CA C sing N N 309 SER CA CB sing N N 310 SER CA HA sing N N 311 SER C O doub N N 312 SER C OXT sing N N 313 SER CB OG sing N N 314 SER CB HB2 sing N N 315 SER CB HB3 sing N N 316 SER OG HG sing N N 317 SER OXT HXT sing N N 318 THR N CA sing N N 319 THR N H sing N N 320 THR N H2 sing N N 321 THR CA C sing N N 322 THR CA CB sing N N 323 THR CA HA sing N N 324 THR C O doub N N 325 THR C OXT sing N N 326 THR CB OG1 sing N N 327 THR CB CG2 sing N N 328 THR CB HB sing N N 329 THR OG1 HG1 sing N N 330 THR CG2 HG21 sing N N 331 THR CG2 HG22 sing N N 332 THR CG2 HG23 sing N N 333 THR OXT HXT sing N N 334 TRP N CA sing N N 335 TRP N H sing N N 336 TRP N H2 sing N N 337 TRP CA C sing N N 338 TRP CA CB sing N N 339 TRP CA HA sing N N 340 TRP C O doub N N 341 TRP C OXT sing N N 342 TRP CB CG sing N N 343 TRP CB HB2 sing N N 344 TRP CB HB3 sing N N 345 TRP CG CD1 doub Y N 346 TRP CG CD2 sing Y N 347 TRP CD1 NE1 sing Y N 348 TRP CD1 HD1 sing N N 349 TRP CD2 CE2 doub Y N 350 TRP CD2 CE3 sing Y N 351 TRP NE1 CE2 sing Y N 352 TRP NE1 HE1 sing N N 353 TRP CE2 CZ2 sing Y N 354 TRP CE3 CZ3 doub Y N 355 TRP CE3 HE3 sing N N 356 TRP CZ2 CH2 doub Y N 357 TRP CZ2 HZ2 sing N N 358 TRP CZ3 CH2 sing Y N 359 TRP CZ3 HZ3 sing N N 360 TRP CH2 HH2 sing N N 361 TRP OXT HXT sing N N 362 TYR N CA sing N N 363 TYR N H sing N N 364 TYR N H2 sing N N 365 TYR CA C sing N N 366 TYR CA CB sing N N 367 TYR CA HA sing N N 368 TYR C O doub N N 369 TYR C OXT sing N N 370 TYR CB CG sing N N 371 TYR CB HB2 sing N N 372 TYR CB HB3 sing N N 373 TYR CG CD1 doub Y N 374 TYR CG CD2 sing Y N 375 TYR CD1 CE1 sing Y N 376 TYR CD1 HD1 sing N N 377 TYR CD2 CE2 doub Y N 378 TYR CD2 HD2 sing N N 379 TYR CE1 CZ doub Y N 380 TYR CE1 HE1 sing N N 381 TYR CE2 CZ sing Y N 382 TYR CE2 HE2 sing N N 383 TYR CZ OH sing N N 384 TYR OH HH sing N N 385 TYR OXT HXT sing N N 386 VAL N CA sing N N 387 VAL N H sing N N 388 VAL N H2 sing N N 389 VAL CA C sing N N 390 VAL CA CB sing N N 391 VAL CA HA sing N N 392 VAL C O doub N N 393 VAL C OXT sing N N 394 VAL CB CG1 sing N N 395 VAL CB CG2 sing N N 396 VAL CB HB sing N N 397 VAL CG1 HG11 sing N N 398 VAL CG1 HG12 sing N N 399 VAL CG1 HG13 sing N N 400 VAL CG2 HG21 sing N N 401 VAL CG2 HG22 sing N N 402 VAL CG2 HG23 sing N N 403 VAL OXT HXT sing N N 404 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id LWE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id LWE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(+)-menthone' LWE 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 31 2 1' _space_group.name_Hall ;P 31 2" ; _space_group.IT_number 152 _space_group.crystal_system trigonal _space_group.id 1 #