data_8AGG # _entry.id 8AGG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8AGG pdb_00008agg 10.2210/pdb8agg/pdb WWPDB D_1292124390 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-04-12 2 'Structure model' 1 1 2023-05-03 3 'Structure model' 1 2 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8AGG _pdbx_database_status.recvd_initial_deposition_date 2022-07-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email a.itzen@uke.de _pdbx_contact_author.name_first Aymelt _pdbx_contact_author.name_last Itzen _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4249-5617 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kaspers, M.S.' 1 0000-0003-3649-0016 'Itzen, A.' 2 0000-0002-4249-5617 'Pogenberg, V.' 3 0000-0002-1021-6804 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 2245 _citation.page_last 2245 _citation.title 'Dephosphocholination by Legionella effector Lem3 functions through remodelling of the switch II region of Rab1b.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-023-37621-7 _citation.pdbx_database_id_PubMed 37076474 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kaspers, M.S.' 1 ? primary 'Pogenberg, V.' 2 ? primary 'Pett, C.' 3 ? primary 'Ernst, S.' 4 ? primary 'Ecker, F.' 5 ? primary 'Ochtrop, P.' 6 ? primary 'Groll, M.' 7 ? primary 'Hedberg, C.' 8 ? primary 'Itzen, A.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Phosphocholine hydrolase Lem3' 65020.664 1 3.1.3.- ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dephosphocholinase Lem3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMKLRYIINENKLVFTSCNMRDKIITGKKIIFSQSVAKDQTKNLSSFLSERFYSVNQSHNHSIIIGSSLSHQENDIEHD TILDTSGVLVTTDTNGIVNGARVAITDGLGGGNGDQEEDDEIYRVSHSSCENFLNCDQNIDTTLSLITQPKASDKKQTAP KTLQHTEASMAAFIYQNHPGKGYIGEFANIGDGLIIILDKRFKIKHMVSACHIYRGFGTWTPPSLQALATTANKDALLVR QTLKLAEGDIIISMTDGVWGELKTSLIAQTNDRRDIGVDKEYFKTLFDELTDAPYPSSFDIARIITQRAMSRSLERRKTL IKLINEIEQQHFHEKSVKTINEVLEYFIKTGHVETAQTLKAILFEDGLSDGITYFENIEIPLEMVMHDLKSRTVGDCSTI NVTRIPYHLDELIRGFINYPEKHQILAPLFKARVKSEADLEEAFHRLSLEMVQPEIECPISETHFERAFKKETLDKTQAV LTHYFRISTGLDSKKNYQERLNDLSAYLSKESSLEKNDIKLLLSMLDSEIKPKTGVFQTLFGENQNKLYKAFHKKIELQL LDSEIENKNELK ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMKLRYIINENKLVFTSCNMRDKIITGKKIIFSQSVAKDQTKNLSSFLSERFYSVNQSHNHSIIIGSSLSHQENDIEHD TILDTSGVLVTTDTNGIVNGARVAITDGLGGGNGDQEEDDEIYRVSHSSCENFLNCDQNIDTTLSLITQPKASDKKQTAP KTLQHTEASMAAFIYQNHPGKGYIGEFANIGDGLIIILDKRFKIKHMVSACHIYRGFGTWTPPSLQALATTANKDALLVR QTLKLAEGDIIISMTDGVWGELKTSLIAQTNDRRDIGVDKEYFKTLFDELTDAPYPSSFDIARIITQRAMSRSLERRKTL IKLINEIEQQHFHEKSVKTINEVLEYFIKTGHVETAQTLKAILFEDGLSDGITYFENIEIPLEMVMHDLKSRTVGDCSTI NVTRIPYHLDELIRGFINYPEKHQILAPLFKARVKSEADLEEAFHRLSLEMVQPEIECPISETHFERAFKKETLDKTQAV LTHYFRISTGLDSKKNYQERLNDLSAYLSKESSLEKNDIKLLLSMLDSEIKPKTGVFQTLFGENQNKLYKAFHKKIELQL LDSEIENKNELK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'MAGNESIUM ION' _pdbx_entity_nonpoly.comp_id MG # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 LYS n 1 5 LEU n 1 6 ARG n 1 7 TYR n 1 8 ILE n 1 9 ILE n 1 10 ASN n 1 11 GLU n 1 12 ASN n 1 13 LYS n 1 14 LEU n 1 15 VAL n 1 16 PHE n 1 17 THR n 1 18 SER n 1 19 CYS n 1 20 ASN n 1 21 MET n 1 22 ARG n 1 23 ASP n 1 24 LYS n 1 25 ILE n 1 26 ILE n 1 27 THR n 1 28 GLY n 1 29 LYS n 1 30 LYS n 1 31 ILE n 1 32 ILE n 1 33 PHE n 1 34 SER n 1 35 GLN n 1 36 SER n 1 37 VAL n 1 38 ALA n 1 39 LYS n 1 40 ASP n 1 41 GLN n 1 42 THR n 1 43 LYS n 1 44 ASN n 1 45 LEU n 1 46 SER n 1 47 SER n 1 48 PHE n 1 49 LEU n 1 50 SER n 1 51 GLU n 1 52 ARG n 1 53 PHE n 1 54 TYR n 1 55 SER n 1 56 VAL n 1 57 ASN n 1 58 GLN n 1 59 SER n 1 60 HIS n 1 61 ASN n 1 62 HIS n 1 63 SER n 1 64 ILE n 1 65 ILE n 1 66 ILE n 1 67 GLY n 1 68 SER n 1 69 SER n 1 70 LEU n 1 71 SER n 1 72 HIS n 1 73 GLN n 1 74 GLU n 1 75 ASN n 1 76 ASP n 1 77 ILE n 1 78 GLU n 1 79 HIS n 1 80 ASP n 1 81 THR n 1 82 ILE n 1 83 LEU n 1 84 ASP n 1 85 THR n 1 86 SER n 1 87 GLY n 1 88 VAL n 1 89 LEU n 1 90 VAL n 1 91 THR n 1 92 THR n 1 93 ASP n 1 94 THR n 1 95 ASN n 1 96 GLY n 1 97 ILE n 1 98 VAL n 1 99 ASN n 1 100 GLY n 1 101 ALA n 1 102 ARG n 1 103 VAL n 1 104 ALA n 1 105 ILE n 1 106 THR n 1 107 ASP n 1 108 GLY n 1 109 LEU n 1 110 GLY n 1 111 GLY n 1 112 GLY n 1 113 ASN n 1 114 GLY n 1 115 ASP n 1 116 GLN n 1 117 GLU n 1 118 GLU n 1 119 ASP n 1 120 ASP n 1 121 GLU n 1 122 ILE n 1 123 TYR n 1 124 ARG n 1 125 VAL n 1 126 SER n 1 127 HIS n 1 128 SER n 1 129 SER n 1 130 CYS n 1 131 GLU n 1 132 ASN n 1 133 PHE n 1 134 LEU n 1 135 ASN n 1 136 CYS n 1 137 ASP n 1 138 GLN n 1 139 ASN n 1 140 ILE n 1 141 ASP n 1 142 THR n 1 143 THR n 1 144 LEU n 1 145 SER n 1 146 LEU n 1 147 ILE n 1 148 THR n 1 149 GLN n 1 150 PRO n 1 151 LYS n 1 152 ALA n 1 153 SER n 1 154 ASP n 1 155 LYS n 1 156 LYS n 1 157 GLN n 1 158 THR n 1 159 ALA n 1 160 PRO n 1 161 LYS n 1 162 THR n 1 163 LEU n 1 164 GLN n 1 165 HIS n 1 166 THR n 1 167 GLU n 1 168 ALA n 1 169 SER n 1 170 MET n 1 171 ALA n 1 172 ALA n 1 173 PHE n 1 174 ILE n 1 175 TYR n 1 176 GLN n 1 177 ASN n 1 178 HIS n 1 179 PRO n 1 180 GLY n 1 181 LYS n 1 182 GLY n 1 183 TYR n 1 184 ILE n 1 185 GLY n 1 186 GLU n 1 187 PHE n 1 188 ALA n 1 189 ASN n 1 190 ILE n 1 191 GLY n 1 192 ASP n 1 193 GLY n 1 194 LEU n 1 195 ILE n 1 196 ILE n 1 197 ILE n 1 198 LEU n 1 199 ASP n 1 200 LYS n 1 201 ARG n 1 202 PHE n 1 203 LYS n 1 204 ILE n 1 205 LYS n 1 206 HIS n 1 207 MET n 1 208 VAL n 1 209 SER n 1 210 ALA n 1 211 CYS n 1 212 HIS n 1 213 ILE n 1 214 TYR n 1 215 ARG n 1 216 GLY n 1 217 PHE n 1 218 GLY n 1 219 THR n 1 220 TRP n 1 221 THR n 1 222 PRO n 1 223 PRO n 1 224 SER n 1 225 LEU n 1 226 GLN n 1 227 ALA n 1 228 LEU n 1 229 ALA n 1 230 THR n 1 231 THR n 1 232 ALA n 1 233 ASN n 1 234 LYS n 1 235 ASP n 1 236 ALA n 1 237 LEU n 1 238 LEU n 1 239 VAL n 1 240 ARG n 1 241 GLN n 1 242 THR n 1 243 LEU n 1 244 LYS n 1 245 LEU n 1 246 ALA n 1 247 GLU n 1 248 GLY n 1 249 ASP n 1 250 ILE n 1 251 ILE n 1 252 ILE n 1 253 SER n 1 254 MET n 1 255 THR n 1 256 ASP n 1 257 GLY n 1 258 VAL n 1 259 TRP n 1 260 GLY n 1 261 GLU n 1 262 LEU n 1 263 LYS n 1 264 THR n 1 265 SER n 1 266 LEU n 1 267 ILE n 1 268 ALA n 1 269 GLN n 1 270 THR n 1 271 ASN n 1 272 ASP n 1 273 ARG n 1 274 ARG n 1 275 ASP n 1 276 ILE n 1 277 GLY n 1 278 VAL n 1 279 ASP n 1 280 LYS n 1 281 GLU n 1 282 TYR n 1 283 PHE n 1 284 LYS n 1 285 THR n 1 286 LEU n 1 287 PHE n 1 288 ASP n 1 289 GLU n 1 290 LEU n 1 291 THR n 1 292 ASP n 1 293 ALA n 1 294 PRO n 1 295 TYR n 1 296 PRO n 1 297 SER n 1 298 SER n 1 299 PHE n 1 300 ASP n 1 301 ILE n 1 302 ALA n 1 303 ARG n 1 304 ILE n 1 305 ILE n 1 306 THR n 1 307 GLN n 1 308 ARG n 1 309 ALA n 1 310 MET n 1 311 SER n 1 312 ARG n 1 313 SER n 1 314 LEU n 1 315 GLU n 1 316 ARG n 1 317 ARG n 1 318 LYS n 1 319 THR n 1 320 LEU n 1 321 ILE n 1 322 LYS n 1 323 LEU n 1 324 ILE n 1 325 ASN n 1 326 GLU n 1 327 ILE n 1 328 GLU n 1 329 GLN n 1 330 GLN n 1 331 HIS n 1 332 PHE n 1 333 HIS n 1 334 GLU n 1 335 LYS n 1 336 SER n 1 337 VAL n 1 338 LYS n 1 339 THR n 1 340 ILE n 1 341 ASN n 1 342 GLU n 1 343 VAL n 1 344 LEU n 1 345 GLU n 1 346 TYR n 1 347 PHE n 1 348 ILE n 1 349 LYS n 1 350 THR n 1 351 GLY n 1 352 HIS n 1 353 VAL n 1 354 GLU n 1 355 THR n 1 356 ALA n 1 357 GLN n 1 358 THR n 1 359 LEU n 1 360 LYS n 1 361 ALA n 1 362 ILE n 1 363 LEU n 1 364 PHE n 1 365 GLU n 1 366 ASP n 1 367 GLY n 1 368 LEU n 1 369 SER n 1 370 ASP n 1 371 GLY n 1 372 ILE n 1 373 THR n 1 374 TYR n 1 375 PHE n 1 376 GLU n 1 377 ASN n 1 378 ILE n 1 379 GLU n 1 380 ILE n 1 381 PRO n 1 382 LEU n 1 383 GLU n 1 384 MET n 1 385 VAL n 1 386 MET n 1 387 HIS n 1 388 ASP n 1 389 LEU n 1 390 LYS n 1 391 SER n 1 392 ARG n 1 393 THR n 1 394 VAL n 1 395 GLY n 1 396 ASP n 1 397 CYS n 1 398 SER n 1 399 THR n 1 400 ILE n 1 401 ASN n 1 402 VAL n 1 403 THR n 1 404 ARG n 1 405 ILE n 1 406 PRO n 1 407 TYR n 1 408 HIS n 1 409 LEU n 1 410 ASP n 1 411 GLU n 1 412 LEU n 1 413 ILE n 1 414 ARG n 1 415 GLY n 1 416 PHE n 1 417 ILE n 1 418 ASN n 1 419 TYR n 1 420 PRO n 1 421 GLU n 1 422 LYS n 1 423 HIS n 1 424 GLN n 1 425 ILE n 1 426 LEU n 1 427 ALA n 1 428 PRO n 1 429 LEU n 1 430 PHE n 1 431 LYS n 1 432 ALA n 1 433 ARG n 1 434 VAL n 1 435 LYS n 1 436 SER n 1 437 GLU n 1 438 ALA n 1 439 ASP n 1 440 LEU n 1 441 GLU n 1 442 GLU n 1 443 ALA n 1 444 PHE n 1 445 HIS n 1 446 ARG n 1 447 LEU n 1 448 SER n 1 449 LEU n 1 450 GLU n 1 451 MET n 1 452 VAL n 1 453 GLN n 1 454 PRO n 1 455 GLU n 1 456 ILE n 1 457 GLU n 1 458 CYS n 1 459 PRO n 1 460 ILE n 1 461 SER n 1 462 GLU n 1 463 THR n 1 464 HIS n 1 465 PHE n 1 466 GLU n 1 467 ARG n 1 468 ALA n 1 469 PHE n 1 470 LYS n 1 471 LYS n 1 472 GLU n 1 473 THR n 1 474 LEU n 1 475 ASP n 1 476 LYS n 1 477 THR n 1 478 GLN n 1 479 ALA n 1 480 VAL n 1 481 LEU n 1 482 THR n 1 483 HIS n 1 484 TYR n 1 485 PHE n 1 486 ARG n 1 487 ILE n 1 488 SER n 1 489 THR n 1 490 GLY n 1 491 LEU n 1 492 ASP n 1 493 SER n 1 494 LYS n 1 495 LYS n 1 496 ASN n 1 497 TYR n 1 498 GLN n 1 499 GLU n 1 500 ARG n 1 501 LEU n 1 502 ASN n 1 503 ASP n 1 504 LEU n 1 505 SER n 1 506 ALA n 1 507 TYR n 1 508 LEU n 1 509 SER n 1 510 LYS n 1 511 GLU n 1 512 SER n 1 513 SER n 1 514 LEU n 1 515 GLU n 1 516 LYS n 1 517 ASN n 1 518 ASP n 1 519 ILE n 1 520 LYS n 1 521 LEU n 1 522 LEU n 1 523 LEU n 1 524 SER n 1 525 MET n 1 526 LEU n 1 527 ASP n 1 528 SER n 1 529 GLU n 1 530 ILE n 1 531 LYS n 1 532 PRO n 1 533 LYS n 1 534 THR n 1 535 GLY n 1 536 VAL n 1 537 PHE n 1 538 GLN n 1 539 THR n 1 540 LEU n 1 541 PHE n 1 542 GLY n 1 543 GLU n 1 544 ASN n 1 545 GLN n 1 546 ASN n 1 547 LYS n 1 548 LEU n 1 549 TYR n 1 550 LYS n 1 551 ALA n 1 552 PHE n 1 553 HIS n 1 554 LYS n 1 555 LYS n 1 556 ILE n 1 557 GLU n 1 558 LEU n 1 559 GLN n 1 560 LEU n 1 561 LEU n 1 562 ASP n 1 563 SER n 1 564 GLU n 1 565 ILE n 1 566 GLU n 1 567 ASN n 1 568 LYS n 1 569 ASN n 1 570 GLU n 1 571 LEU n 1 572 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 572 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'lem3, lpg0696' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Philadelphia 1 / ATCC 33152 / DSM 7513' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Legionella pneumophila' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 446 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant RIL _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 HIS 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 LYS 4 2 ? ? ? A . n A 1 5 LEU 5 3 ? ? ? A . n A 1 6 ARG 6 4 ? ? ? A . n A 1 7 TYR 7 5 ? ? ? A . n A 1 8 ILE 8 6 ? ? ? A . n A 1 9 ILE 9 7 ? ? ? A . n A 1 10 ASN 10 8 ? ? ? A . n A 1 11 GLU 11 9 ? ? ? A . n A 1 12 ASN 12 10 ? ? ? A . n A 1 13 LYS 13 11 ? ? ? A . n A 1 14 LEU 14 12 ? ? ? A . n A 1 15 VAL 15 13 ? ? ? A . n A 1 16 PHE 16 14 ? ? ? A . n A 1 17 THR 17 15 ? ? ? A . n A 1 18 SER 18 16 ? ? ? A . n A 1 19 CYS 19 17 ? ? ? A . n A 1 20 ASN 20 18 ? ? ? A . n A 1 21 MET 21 19 19 MET MET A . n A 1 22 ARG 22 20 20 ARG ARG A . n A 1 23 ASP 23 21 21 ASP ASP A . n A 1 24 LYS 24 22 22 LYS LYS A . n A 1 25 ILE 25 23 23 ILE ILE A . n A 1 26 ILE 26 24 24 ILE ILE A . n A 1 27 THR 27 25 25 THR THR A . n A 1 28 GLY 28 26 26 GLY GLY A . n A 1 29 LYS 29 27 27 LYS LYS A . n A 1 30 LYS 30 28 28 LYS LYS A . n A 1 31 ILE 31 29 29 ILE ILE A . n A 1 32 ILE 32 30 30 ILE ILE A . n A 1 33 PHE 33 31 31 PHE PHE A . n A 1 34 SER 34 32 32 SER SER A . n A 1 35 GLN 35 33 33 GLN GLN A . n A 1 36 SER 36 34 34 SER SER A . n A 1 37 VAL 37 35 35 VAL VAL A . n A 1 38 ALA 38 36 36 ALA ALA A . n A 1 39 LYS 39 37 37 LYS LYS A . n A 1 40 ASP 40 38 38 ASP ASP A . n A 1 41 GLN 41 39 39 GLN GLN A . n A 1 42 THR 42 40 40 THR THR A . n A 1 43 LYS 43 41 41 LYS LYS A . n A 1 44 ASN 44 42 42 ASN ASN A . n A 1 45 LEU 45 43 43 LEU LEU A . n A 1 46 SER 46 44 44 SER SER A . n A 1 47 SER 47 45 45 SER SER A . n A 1 48 PHE 48 46 46 PHE PHE A . n A 1 49 LEU 49 47 47 LEU LEU A . n A 1 50 SER 50 48 48 SER SER A . n A 1 51 GLU 51 49 49 GLU GLU A . n A 1 52 ARG 52 50 50 ARG ARG A . n A 1 53 PHE 53 51 51 PHE PHE A . n A 1 54 TYR 54 52 52 TYR TYR A . n A 1 55 SER 55 53 53 SER SER A . n A 1 56 VAL 56 54 54 VAL VAL A . n A 1 57 ASN 57 55 55 ASN ASN A . n A 1 58 GLN 58 56 56 GLN GLN A . n A 1 59 SER 59 57 57 SER SER A . n A 1 60 HIS 60 58 58 HIS HIS A . n A 1 61 ASN 61 59 59 ASN ASN A . n A 1 62 HIS 62 60 60 HIS HIS A . n A 1 63 SER 63 61 61 SER SER A . n A 1 64 ILE 64 62 62 ILE ILE A . n A 1 65 ILE 65 63 63 ILE ILE A . n A 1 66 ILE 66 64 64 ILE ILE A . n A 1 67 GLY 67 65 65 GLY GLY A . n A 1 68 SER 68 66 66 SER SER A . n A 1 69 SER 69 67 67 SER SER A . n A 1 70 LEU 70 68 68 LEU LEU A . n A 1 71 SER 71 69 69 SER SER A . n A 1 72 HIS 72 70 70 HIS HIS A . n A 1 73 GLN 73 71 71 GLN GLN A . n A 1 74 GLU 74 72 72 GLU GLU A . n A 1 75 ASN 75 73 73 ASN ASN A . n A 1 76 ASP 76 74 74 ASP ASP A . n A 1 77 ILE 77 75 75 ILE ILE A . n A 1 78 GLU 78 76 76 GLU GLU A . n A 1 79 HIS 79 77 77 HIS HIS A . n A 1 80 ASP 80 78 78 ASP ASP A . n A 1 81 THR 81 79 79 THR THR A . n A 1 82 ILE 82 80 80 ILE ILE A . n A 1 83 LEU 83 81 81 LEU LEU A . n A 1 84 ASP 84 82 82 ASP ASP A . n A 1 85 THR 85 83 83 THR THR A . n A 1 86 SER 86 84 84 SER SER A . n A 1 87 GLY 87 85 85 GLY GLY A . n A 1 88 VAL 88 86 86 VAL VAL A . n A 1 89 LEU 89 87 87 LEU LEU A . n A 1 90 VAL 90 88 88 VAL VAL A . n A 1 91 THR 91 89 89 THR THR A . n A 1 92 THR 92 90 90 THR THR A . n A 1 93 ASP 93 91 91 ASP ASP A . n A 1 94 THR 94 92 92 THR THR A . n A 1 95 ASN 95 93 93 ASN ASN A . n A 1 96 GLY 96 94 94 GLY GLY A . n A 1 97 ILE 97 95 95 ILE ILE A . n A 1 98 VAL 98 96 96 VAL VAL A . n A 1 99 ASN 99 97 97 ASN ASN A . n A 1 100 GLY 100 98 98 GLY GLY A . n A 1 101 ALA 101 99 99 ALA ALA A . n A 1 102 ARG 102 100 100 ARG ARG A . n A 1 103 VAL 103 101 101 VAL VAL A . n A 1 104 ALA 104 102 102 ALA ALA A . n A 1 105 ILE 105 103 103 ILE ILE A . n A 1 106 THR 106 104 104 THR THR A . n A 1 107 ASP 107 105 105 ASP ASP A . n A 1 108 GLY 108 106 106 GLY GLY A . n A 1 109 LEU 109 107 107 LEU LEU A . n A 1 110 GLY 110 108 108 GLY GLY A . n A 1 111 GLY 111 109 109 GLY GLY A . n A 1 112 GLY 112 110 110 GLY GLY A . n A 1 113 ASN 113 111 111 ASN ASN A . n A 1 114 GLY 114 112 112 GLY GLY A . n A 1 115 ASP 115 113 113 ASP ASP A . n A 1 116 GLN 116 114 114 GLN GLN A . n A 1 117 GLU 117 115 115 GLU GLU A . n A 1 118 GLU 118 116 116 GLU GLU A . n A 1 119 ASP 119 117 117 ASP ASP A . n A 1 120 ASP 120 118 118 ASP ASP A . n A 1 121 GLU 121 119 119 GLU GLU A . n A 1 122 ILE 122 120 120 ILE ILE A . n A 1 123 TYR 123 121 121 TYR TYR A . n A 1 124 ARG 124 122 122 ARG ARG A . n A 1 125 VAL 125 123 123 VAL VAL A . n A 1 126 SER 126 124 124 SER SER A . n A 1 127 HIS 127 125 125 HIS HIS A . n A 1 128 SER 128 126 126 SER SER A . n A 1 129 SER 129 127 127 SER SER A . n A 1 130 CYS 130 128 128 CYS CYS A . n A 1 131 GLU 131 129 129 GLU GLU A . n A 1 132 ASN 132 130 130 ASN ASN A . n A 1 133 PHE 133 131 131 PHE PHE A . n A 1 134 LEU 134 132 132 LEU LEU A . n A 1 135 ASN 135 133 133 ASN ASN A . n A 1 136 CYS 136 134 134 CYS CYS A . n A 1 137 ASP 137 135 135 ASP ASP A . n A 1 138 GLN 138 136 136 GLN GLN A . n A 1 139 ASN 139 137 137 ASN ASN A . n A 1 140 ILE 140 138 138 ILE ILE A . n A 1 141 ASP 141 139 139 ASP ASP A . n A 1 142 THR 142 140 140 THR THR A . n A 1 143 THR 143 141 141 THR THR A . n A 1 144 LEU 144 142 142 LEU LEU A . n A 1 145 SER 145 143 143 SER SER A . n A 1 146 LEU 146 144 144 LEU LEU A . n A 1 147 ILE 147 145 145 ILE ILE A . n A 1 148 THR 148 146 146 THR THR A . n A 1 149 GLN 149 147 147 GLN GLN A . n A 1 150 PRO 150 148 ? ? ? A . n A 1 151 LYS 151 149 ? ? ? A . n A 1 152 ALA 152 150 ? ? ? A . n A 1 153 SER 153 151 ? ? ? A . n A 1 154 ASP 154 152 ? ? ? A . n A 1 155 LYS 155 153 ? ? ? A . n A 1 156 LYS 156 154 ? ? ? A . n A 1 157 GLN 157 155 ? ? ? A . n A 1 158 THR 158 156 ? ? ? A . n A 1 159 ALA 159 157 ? ? ? A . n A 1 160 PRO 160 158 ? ? ? A . n A 1 161 LYS 161 159 ? ? ? A . n A 1 162 THR 162 160 ? ? ? A . n A 1 163 LEU 163 161 ? ? ? A . n A 1 164 GLN 164 162 ? ? ? A . n A 1 165 HIS 165 163 ? ? ? A . n A 1 166 THR 166 164 164 THR THR A . n A 1 167 GLU 167 165 165 GLU GLU A . n A 1 168 ALA 168 166 166 ALA ALA A . n A 1 169 SER 169 167 167 SER SER A . n A 1 170 MET 170 168 168 MET MET A . n A 1 171 ALA 171 169 169 ALA ALA A . n A 1 172 ALA 172 170 170 ALA ALA A . n A 1 173 PHE 173 171 171 PHE PHE A . n A 1 174 ILE 174 172 172 ILE ILE A . n A 1 175 TYR 175 173 173 TYR TYR A . n A 1 176 GLN 176 174 174 GLN GLN A . n A 1 177 ASN 177 175 175 ASN ASN A . n A 1 178 HIS 178 176 176 HIS HIS A . n A 1 179 PRO 179 177 177 PRO PRO A . n A 1 180 GLY 180 178 178 GLY GLY A . n A 1 181 LYS 181 179 179 LYS LYS A . n A 1 182 GLY 182 180 180 GLY GLY A . n A 1 183 TYR 183 181 181 TYR TYR A . n A 1 184 ILE 184 182 182 ILE ILE A . n A 1 185 GLY 185 183 183 GLY GLY A . n A 1 186 GLU 186 184 184 GLU GLU A . n A 1 187 PHE 187 185 185 PHE PHE A . n A 1 188 ALA 188 186 186 ALA ALA A . n A 1 189 ASN 189 187 187 ASN ASN A . n A 1 190 ILE 190 188 188 ILE ILE A . n A 1 191 GLY 191 189 189 GLY GLY A . n A 1 192 ASP 192 190 190 ASP ASP A . n A 1 193 GLY 193 191 191 GLY GLY A . n A 1 194 LEU 194 192 192 LEU LEU A . n A 1 195 ILE 195 193 193 ILE ILE A . n A 1 196 ILE 196 194 194 ILE ILE A . n A 1 197 ILE 197 195 195 ILE ILE A . n A 1 198 LEU 198 196 196 LEU LEU A . n A 1 199 ASP 199 197 197 ASP ASP A . n A 1 200 LYS 200 198 198 LYS LYS A . n A 1 201 ARG 201 199 199 ARG ARG A . n A 1 202 PHE 202 200 200 PHE PHE A . n A 1 203 LYS 203 201 201 LYS LYS A . n A 1 204 ILE 204 202 202 ILE ILE A . n A 1 205 LYS 205 203 203 LYS LYS A . n A 1 206 HIS 206 204 204 HIS HIS A . n A 1 207 MET 207 205 205 MET MET A . n A 1 208 VAL 208 206 206 VAL VAL A . n A 1 209 SER 209 207 207 SER SER A . n A 1 210 ALA 210 208 208 ALA ALA A . n A 1 211 CYS 211 209 209 CYS CYS A . n A 1 212 HIS 212 210 210 HIS HIS A . n A 1 213 ILE 213 211 211 ILE ILE A . n A 1 214 TYR 214 212 212 TYR TYR A . n A 1 215 ARG 215 213 213 ARG ARG A . n A 1 216 GLY 216 214 214 GLY GLY A . n A 1 217 PHE 217 215 215 PHE PHE A . n A 1 218 GLY 218 216 216 GLY GLY A . n A 1 219 THR 219 217 217 THR THR A . n A 1 220 TRP 220 218 218 TRP TRP A . n A 1 221 THR 221 219 219 THR THR A . n A 1 222 PRO 222 220 220 PRO PRO A . n A 1 223 PRO 223 221 221 PRO PRO A . n A 1 224 SER 224 222 222 SER SER A . n A 1 225 LEU 225 223 223 LEU LEU A . n A 1 226 GLN 226 224 224 GLN GLN A . n A 1 227 ALA 227 225 225 ALA ALA A . n A 1 228 LEU 228 226 226 LEU LEU A . n A 1 229 ALA 229 227 227 ALA ALA A . n A 1 230 THR 230 228 228 THR THR A . n A 1 231 THR 231 229 229 THR THR A . n A 1 232 ALA 232 230 230 ALA ALA A . n A 1 233 ASN 233 231 231 ASN ASN A . n A 1 234 LYS 234 232 232 LYS LYS A . n A 1 235 ASP 235 233 233 ASP ASP A . n A 1 236 ALA 236 234 ? ? ? A . n A 1 237 LEU 237 235 ? ? ? A . n A 1 238 LEU 238 236 ? ? ? A . n A 1 239 VAL 239 237 ? ? ? A . n A 1 240 ARG 240 238 ? ? ? A . n A 1 241 GLN 241 239 ? ? ? A . n A 1 242 THR 242 240 ? ? ? A . n A 1 243 LEU 243 241 ? ? ? A . n A 1 244 LYS 244 242 242 LYS LYS A . n A 1 245 LEU 245 243 243 LEU LEU A . n A 1 246 ALA 246 244 244 ALA ALA A . n A 1 247 GLU 247 245 245 GLU GLU A . n A 1 248 GLY 248 246 246 GLY GLY A . n A 1 249 ASP 249 247 247 ASP ASP A . n A 1 250 ILE 250 248 248 ILE ILE A . n A 1 251 ILE 251 249 249 ILE ILE A . n A 1 252 ILE 252 250 250 ILE ILE A . n A 1 253 SER 253 251 251 SER SER A . n A 1 254 MET 254 252 252 MET MET A . n A 1 255 THR 255 253 253 THR THR A . n A 1 256 ASP 256 254 254 ASP ASP A . n A 1 257 GLY 257 255 255 GLY GLY A . n A 1 258 VAL 258 256 256 VAL VAL A . n A 1 259 TRP 259 257 257 TRP TRP A . n A 1 260 GLY 260 258 258 GLY GLY A . n A 1 261 GLU 261 259 259 GLU GLU A . n A 1 262 LEU 262 260 260 LEU LEU A . n A 1 263 LYS 263 261 261 LYS LYS A . n A 1 264 THR 264 262 262 THR THR A . n A 1 265 SER 265 263 263 SER SER A . n A 1 266 LEU 266 264 264 LEU LEU A . n A 1 267 ILE 267 265 265 ILE ILE A . n A 1 268 ALA 268 266 266 ALA ALA A . n A 1 269 GLN 269 267 267 GLN GLN A . n A 1 270 THR 270 268 268 THR THR A . n A 1 271 ASN 271 269 269 ASN ASN A . n A 1 272 ASP 272 270 270 ASP ASP A . n A 1 273 ARG 273 271 271 ARG ARG A . n A 1 274 ARG 274 272 272 ARG ARG A . n A 1 275 ASP 275 273 273 ASP ASP A . n A 1 276 ILE 276 274 274 ILE ILE A . n A 1 277 GLY 277 275 275 GLY GLY A . n A 1 278 VAL 278 276 276 VAL VAL A . n A 1 279 ASP 279 277 277 ASP ASP A . n A 1 280 LYS 280 278 278 LYS LYS A . n A 1 281 GLU 281 279 279 GLU GLU A . n A 1 282 TYR 282 280 280 TYR TYR A . n A 1 283 PHE 283 281 281 PHE PHE A . n A 1 284 LYS 284 282 282 LYS LYS A . n A 1 285 THR 285 283 283 THR THR A . n A 1 286 LEU 286 284 284 LEU LEU A . n A 1 287 PHE 287 285 285 PHE PHE A . n A 1 288 ASP 288 286 286 ASP ASP A . n A 1 289 GLU 289 287 287 GLU GLU A . n A 1 290 LEU 290 288 288 LEU LEU A . n A 1 291 THR 291 289 289 THR THR A . n A 1 292 ASP 292 290 290 ASP ASP A . n A 1 293 ALA 293 291 291 ALA ALA A . n A 1 294 PRO 294 292 292 PRO PRO A . n A 1 295 TYR 295 293 293 TYR TYR A . n A 1 296 PRO 296 294 294 PRO PRO A . n A 1 297 SER 297 295 295 SER SER A . n A 1 298 SER 298 296 296 SER SER A . n A 1 299 PHE 299 297 297 PHE PHE A . n A 1 300 ASP 300 298 298 ASP ASP A . n A 1 301 ILE 301 299 299 ILE ILE A . n A 1 302 ALA 302 300 300 ALA ALA A . n A 1 303 ARG 303 301 301 ARG ARG A . n A 1 304 ILE 304 302 302 ILE ILE A . n A 1 305 ILE 305 303 303 ILE ILE A . n A 1 306 THR 306 304 304 THR THR A . n A 1 307 GLN 307 305 305 GLN GLN A . n A 1 308 ARG 308 306 306 ARG ARG A . n A 1 309 ALA 309 307 307 ALA ALA A . n A 1 310 MET 310 308 308 MET MET A . n A 1 311 SER 311 309 309 SER SER A . n A 1 312 ARG 312 310 310 ARG ARG A . n A 1 313 SER 313 311 311 SER SER A . n A 1 314 LEU 314 312 312 LEU LEU A . n A 1 315 GLU 315 313 313 GLU GLU A . n A 1 316 ARG 316 314 314 ARG ARG A . n A 1 317 ARG 317 315 315 ARG ARG A . n A 1 318 LYS 318 316 316 LYS LYS A . n A 1 319 THR 319 317 317 THR THR A . n A 1 320 LEU 320 318 318 LEU LEU A . n A 1 321 ILE 321 319 319 ILE ILE A . n A 1 322 LYS 322 320 320 LYS LYS A . n A 1 323 LEU 323 321 321 LEU LEU A . n A 1 324 ILE 324 322 322 ILE ILE A . n A 1 325 ASN 325 323 323 ASN ASN A . n A 1 326 GLU 326 324 324 GLU GLU A . n A 1 327 ILE 327 325 325 ILE ILE A . n A 1 328 GLU 328 326 326 GLU GLU A . n A 1 329 GLN 329 327 327 GLN GLN A . n A 1 330 GLN 330 328 328 GLN GLN A . n A 1 331 HIS 331 329 329 HIS HIS A . n A 1 332 PHE 332 330 330 PHE PHE A . n A 1 333 HIS 333 331 331 HIS HIS A . n A 1 334 GLU 334 332 332 GLU GLU A . n A 1 335 LYS 335 333 333 LYS LYS A . n A 1 336 SER 336 334 334 SER SER A . n A 1 337 VAL 337 335 335 VAL VAL A . n A 1 338 LYS 338 336 336 LYS LYS A . n A 1 339 THR 339 337 337 THR THR A . n A 1 340 ILE 340 338 338 ILE ILE A . n A 1 341 ASN 341 339 339 ASN ASN A . n A 1 342 GLU 342 340 340 GLU GLU A . n A 1 343 VAL 343 341 341 VAL VAL A . n A 1 344 LEU 344 342 342 LEU LEU A . n A 1 345 GLU 345 343 343 GLU GLU A . n A 1 346 TYR 346 344 344 TYR TYR A . n A 1 347 PHE 347 345 345 PHE PHE A . n A 1 348 ILE 348 346 346 ILE ILE A . n A 1 349 LYS 349 347 347 LYS LYS A . n A 1 350 THR 350 348 348 THR THR A . n A 1 351 GLY 351 349 349 GLY GLY A . n A 1 352 HIS 352 350 350 HIS HIS A . n A 1 353 VAL 353 351 351 VAL VAL A . n A 1 354 GLU 354 352 352 GLU GLU A . n A 1 355 THR 355 353 353 THR THR A . n A 1 356 ALA 356 354 354 ALA ALA A . n A 1 357 GLN 357 355 355 GLN GLN A . n A 1 358 THR 358 356 356 THR THR A . n A 1 359 LEU 359 357 357 LEU LEU A . n A 1 360 LYS 360 358 358 LYS LYS A . n A 1 361 ALA 361 359 359 ALA ALA A . n A 1 362 ILE 362 360 360 ILE ILE A . n A 1 363 LEU 363 361 361 LEU LEU A . n A 1 364 PHE 364 362 362 PHE PHE A . n A 1 365 GLU 365 363 363 GLU GLU A . n A 1 366 ASP 366 364 364 ASP ASP A . n A 1 367 GLY 367 365 ? ? ? A . n A 1 368 LEU 368 366 ? ? ? A . n A 1 369 SER 369 367 ? ? ? A . n A 1 370 ASP 370 368 ? ? ? A . n A 1 371 GLY 371 369 ? ? ? A . n A 1 372 ILE 372 370 ? ? ? A . n A 1 373 THR 373 371 ? ? ? A . n A 1 374 TYR 374 372 ? ? ? A . n A 1 375 PHE 375 373 ? ? ? A . n A 1 376 GLU 376 374 ? ? ? A . n A 1 377 ASN 377 375 375 ASN ASN A . n A 1 378 ILE 378 376 376 ILE ILE A . n A 1 379 GLU 379 377 377 GLU GLU A . n A 1 380 ILE 380 378 378 ILE ILE A . n A 1 381 PRO 381 379 379 PRO PRO A . n A 1 382 LEU 382 380 380 LEU LEU A . n A 1 383 GLU 383 381 381 GLU GLU A . n A 1 384 MET 384 382 382 MET MET A . n A 1 385 VAL 385 383 383 VAL VAL A . n A 1 386 MET 386 384 384 MET MET A . n A 1 387 HIS 387 385 385 HIS HIS A . n A 1 388 ASP 388 386 386 ASP ASP A . n A 1 389 LEU 389 387 387 LEU LEU A . n A 1 390 LYS 390 388 388 LYS LYS A . n A 1 391 SER 391 389 389 SER SER A . n A 1 392 ARG 392 390 390 ARG ARG A . n A 1 393 THR 393 391 391 THR THR A . n A 1 394 VAL 394 392 392 VAL VAL A . n A 1 395 GLY 395 393 393 GLY GLY A . n A 1 396 ASP 396 394 394 ASP ASP A . n A 1 397 CYS 397 395 395 CYS CYS A . n A 1 398 SER 398 396 396 SER SER A . n A 1 399 THR 399 397 397 THR THR A . n A 1 400 ILE 400 398 398 ILE ILE A . n A 1 401 ASN 401 399 399 ASN ASN A . n A 1 402 VAL 402 400 400 VAL VAL A . n A 1 403 THR 403 401 401 THR THR A . n A 1 404 ARG 404 402 402 ARG ARG A . n A 1 405 ILE 405 403 403 ILE ILE A . n A 1 406 PRO 406 404 404 PRO PRO A . n A 1 407 TYR 407 405 405 TYR TYR A . n A 1 408 HIS 408 406 406 HIS HIS A . n A 1 409 LEU 409 407 407 LEU LEU A . n A 1 410 ASP 410 408 408 ASP ASP A . n A 1 411 GLU 411 409 409 GLU GLU A . n A 1 412 LEU 412 410 410 LEU LEU A . n A 1 413 ILE 413 411 411 ILE ILE A . n A 1 414 ARG 414 412 412 ARG ARG A . n A 1 415 GLY 415 413 413 GLY GLY A . n A 1 416 PHE 416 414 414 PHE PHE A . n A 1 417 ILE 417 415 415 ILE ILE A . n A 1 418 ASN 418 416 416 ASN ASN A . n A 1 419 TYR 419 417 417 TYR TYR A . n A 1 420 PRO 420 418 418 PRO PRO A . n A 1 421 GLU 421 419 419 GLU GLU A . n A 1 422 LYS 422 420 420 LYS LYS A . n A 1 423 HIS 423 421 421 HIS HIS A . n A 1 424 GLN 424 422 422 GLN GLN A . n A 1 425 ILE 425 423 423 ILE ILE A . n A 1 426 LEU 426 424 424 LEU LEU A . n A 1 427 ALA 427 425 425 ALA ALA A . n A 1 428 PRO 428 426 426 PRO PRO A . n A 1 429 LEU 429 427 427 LEU LEU A . n A 1 430 PHE 430 428 428 PHE PHE A . n A 1 431 LYS 431 429 429 LYS LYS A . n A 1 432 ALA 432 430 430 ALA ALA A . n A 1 433 ARG 433 431 431 ARG ARG A . n A 1 434 VAL 434 432 432 VAL VAL A . n A 1 435 LYS 435 433 433 LYS LYS A . n A 1 436 SER 436 434 434 SER SER A . n A 1 437 GLU 437 435 435 GLU GLU A . n A 1 438 ALA 438 436 436 ALA ALA A . n A 1 439 ASP 439 437 437 ASP ASP A . n A 1 440 LEU 440 438 438 LEU LEU A . n A 1 441 GLU 441 439 439 GLU GLU A . n A 1 442 GLU 442 440 440 GLU GLU A . n A 1 443 ALA 443 441 441 ALA ALA A . n A 1 444 PHE 444 442 442 PHE PHE A . n A 1 445 HIS 445 443 443 HIS HIS A . n A 1 446 ARG 446 444 444 ARG ARG A . n A 1 447 LEU 447 445 445 LEU LEU A . n A 1 448 SER 448 446 446 SER SER A . n A 1 449 LEU 449 447 447 LEU LEU A . n A 1 450 GLU 450 448 448 GLU GLU A . n A 1 451 MET 451 449 449 MET MET A . n A 1 452 VAL 452 450 450 VAL VAL A . n A 1 453 GLN 453 451 451 GLN GLN A . n A 1 454 PRO 454 452 452 PRO PRO A . n A 1 455 GLU 455 453 453 GLU GLU A . n A 1 456 ILE 456 454 454 ILE ILE A . n A 1 457 GLU 457 455 455 GLU GLU A . n A 1 458 CYS 458 456 456 CYS CYS A . n A 1 459 PRO 459 457 457 PRO PRO A . n A 1 460 ILE 460 458 458 ILE ILE A . n A 1 461 SER 461 459 459 SER SER A . n A 1 462 GLU 462 460 460 GLU GLU A . n A 1 463 THR 463 461 461 THR THR A . n A 1 464 HIS 464 462 462 HIS HIS A . n A 1 465 PHE 465 463 463 PHE PHE A . n A 1 466 GLU 466 464 464 GLU GLU A . n A 1 467 ARG 467 465 465 ARG ARG A . n A 1 468 ALA 468 466 466 ALA ALA A . n A 1 469 PHE 469 467 467 PHE PHE A . n A 1 470 LYS 470 468 468 LYS LYS A . n A 1 471 LYS 471 469 469 LYS LYS A . n A 1 472 GLU 472 470 470 GLU GLU A . n A 1 473 THR 473 471 471 THR THR A . n A 1 474 LEU 474 472 472 LEU LEU A . n A 1 475 ASP 475 473 473 ASP ASP A . n A 1 476 LYS 476 474 474 LYS LYS A . n A 1 477 THR 477 475 475 THR THR A . n A 1 478 GLN 478 476 476 GLN GLN A . n A 1 479 ALA 479 477 477 ALA ALA A . n A 1 480 VAL 480 478 478 VAL VAL A . n A 1 481 LEU 481 479 479 LEU LEU A . n A 1 482 THR 482 480 480 THR THR A . n A 1 483 HIS 483 481 481 HIS HIS A . n A 1 484 TYR 484 482 482 TYR TYR A . n A 1 485 PHE 485 483 483 PHE PHE A . n A 1 486 ARG 486 484 484 ARG ARG A . n A 1 487 ILE 487 485 485 ILE ILE A . n A 1 488 SER 488 486 486 SER SER A . n A 1 489 THR 489 487 ? ? ? A . n A 1 490 GLY 490 488 ? ? ? A . n A 1 491 LEU 491 489 ? ? ? A . n A 1 492 ASP 492 490 ? ? ? A . n A 1 493 SER 493 491 ? ? ? A . n A 1 494 LYS 494 492 ? ? ? A . n A 1 495 LYS 495 493 ? ? ? A . n A 1 496 ASN 496 494 494 ASN ASN A . n A 1 497 TYR 497 495 495 TYR TYR A . n A 1 498 GLN 498 496 496 GLN GLN A . n A 1 499 GLU 499 497 497 GLU GLU A . n A 1 500 ARG 500 498 498 ARG ARG A . n A 1 501 LEU 501 499 499 LEU LEU A . n A 1 502 ASN 502 500 500 ASN ASN A . n A 1 503 ASP 503 501 501 ASP ASP A . n A 1 504 LEU 504 502 502 LEU LEU A . n A 1 505 SER 505 503 503 SER SER A . n A 1 506 ALA 506 504 504 ALA ALA A . n A 1 507 TYR 507 505 505 TYR TYR A . n A 1 508 LEU 508 506 506 LEU LEU A . n A 1 509 SER 509 507 507 SER SER A . n A 1 510 LYS 510 508 508 LYS LYS A . n A 1 511 GLU 511 509 509 GLU GLU A . n A 1 512 SER 512 510 510 SER SER A . n A 1 513 SER 513 511 511 SER SER A . n A 1 514 LEU 514 512 512 LEU LEU A . n A 1 515 GLU 515 513 513 GLU GLU A . n A 1 516 LYS 516 514 514 LYS LYS A . n A 1 517 ASN 517 515 515 ASN ASN A . n A 1 518 ASP 518 516 516 ASP ASP A . n A 1 519 ILE 519 517 517 ILE ILE A . n A 1 520 LYS 520 518 518 LYS LYS A . n A 1 521 LEU 521 519 519 LEU LEU A . n A 1 522 LEU 522 520 520 LEU LEU A . n A 1 523 LEU 523 521 521 LEU LEU A . n A 1 524 SER 524 522 522 SER SER A . n A 1 525 MET 525 523 523 MET MET A . n A 1 526 LEU 526 524 524 LEU LEU A . n A 1 527 ASP 527 525 525 ASP ASP A . n A 1 528 SER 528 526 526 SER SER A . n A 1 529 GLU 529 527 ? ? ? A . n A 1 530 ILE 530 528 ? ? ? A . n A 1 531 LYS 531 529 ? ? ? A . n A 1 532 PRO 532 530 ? ? ? A . n A 1 533 LYS 533 531 ? ? ? A . n A 1 534 THR 534 532 ? ? ? A . n A 1 535 GLY 535 533 ? ? ? A . n A 1 536 VAL 536 534 ? ? ? A . n A 1 537 PHE 537 535 ? ? ? A . n A 1 538 GLN 538 536 ? ? ? A . n A 1 539 THR 539 537 ? ? ? A . n A 1 540 LEU 540 538 ? ? ? A . n A 1 541 PHE 541 539 ? ? ? A . n A 1 542 GLY 542 540 ? ? ? A . n A 1 543 GLU 543 541 ? ? ? A . n A 1 544 ASN 544 542 ? ? ? A . n A 1 545 GLN 545 543 ? ? ? A . n A 1 546 ASN 546 544 544 ASN ASN A . n A 1 547 LYS 547 545 545 LYS LYS A . n A 1 548 LEU 548 546 546 LEU LEU A . n A 1 549 TYR 549 547 547 TYR TYR A . n A 1 550 LYS 550 548 548 LYS LYS A . n A 1 551 ALA 551 549 549 ALA ALA A . n A 1 552 PHE 552 550 550 PHE PHE A . n A 1 553 HIS 553 551 551 HIS HIS A . n A 1 554 LYS 554 552 552 LYS LYS A . n A 1 555 LYS 555 553 553 LYS LYS A . n A 1 556 ILE 556 554 554 ILE ILE A . n A 1 557 GLU 557 555 555 GLU GLU A . n A 1 558 LEU 558 556 556 LEU LEU A . n A 1 559 GLN 559 557 557 GLN GLN A . n A 1 560 LEU 560 558 558 LEU LEU A . n A 1 561 LEU 561 559 559 LEU LEU A . n A 1 562 ASP 562 560 560 ASP ASP A . n A 1 563 SER 563 561 561 SER SER A . n A 1 564 GLU 564 562 562 GLU GLU A . n A 1 565 ILE 565 563 563 ILE ILE A . n A 1 566 GLU 566 564 564 GLU GLU A . n A 1 567 ASN 567 565 565 ASN ASN A . n A 1 568 LYS 568 566 ? ? ? A . n A 1 569 ASN 569 567 ? ? ? A . n A 1 570 GLU 570 568 ? ? ? A . n A 1 571 LEU 571 569 ? ? ? A . n A 1 572 LYS 572 570 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id MG _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 601 _pdbx_nonpoly_scheme.auth_seq_num 2 _pdbx_nonpoly_scheme.pdb_mon_id MG _pdbx_nonpoly_scheme.auth_mon_id MG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 19 ? CG ? A MET 21 CG 2 1 Y 1 A MET 19 ? SD ? A MET 21 SD 3 1 Y 1 A MET 19 ? CE ? A MET 21 CE 4 1 Y 1 A PHE 46 ? CG ? A PHE 48 CG 5 1 Y 1 A PHE 46 ? CD1 ? A PHE 48 CD1 6 1 Y 1 A PHE 46 ? CD2 ? A PHE 48 CD2 7 1 Y 1 A PHE 46 ? CE1 ? A PHE 48 CE1 8 1 Y 1 A PHE 46 ? CE2 ? A PHE 48 CE2 9 1 Y 1 A PHE 46 ? CZ ? A PHE 48 CZ 10 1 Y 1 A LYS 179 ? CG ? A LYS 181 CG 11 1 Y 1 A LYS 179 ? CD ? A LYS 181 CD 12 1 Y 1 A LYS 179 ? CE ? A LYS 181 CE 13 1 Y 1 A LYS 179 ? NZ ? A LYS 181 NZ 14 1 Y 1 A TYR 212 ? CG ? A TYR 214 CG 15 1 Y 1 A TYR 212 ? CD1 ? A TYR 214 CD1 16 1 Y 1 A TYR 212 ? CD2 ? A TYR 214 CD2 17 1 Y 1 A TYR 212 ? CE1 ? A TYR 214 CE1 18 1 Y 1 A TYR 212 ? CE2 ? A TYR 214 CE2 19 1 Y 1 A TYR 212 ? CZ ? A TYR 214 CZ 20 1 Y 1 A TYR 212 ? OH ? A TYR 214 OH 21 1 Y 1 A ARG 213 ? CG ? A ARG 215 CG 22 1 Y 1 A ARG 213 ? CD ? A ARG 215 CD 23 1 Y 1 A ARG 213 ? NE ? A ARG 215 NE 24 1 Y 1 A ARG 213 ? CZ ? A ARG 215 CZ 25 1 Y 1 A ARG 213 ? NH1 ? A ARG 215 NH1 26 1 Y 1 A ARG 213 ? NH2 ? A ARG 215 NH2 27 1 Y 1 A LYS 242 ? CG ? A LYS 244 CG 28 1 Y 1 A LYS 242 ? CD ? A LYS 244 CD 29 1 Y 1 A LYS 242 ? CE ? A LYS 244 CE 30 1 Y 1 A LYS 242 ? NZ ? A LYS 244 NZ 31 1 Y 1 A GLN 327 ? CG ? A GLN 329 CG 32 1 Y 1 A GLN 327 ? CD ? A GLN 329 CD 33 1 Y 1 A GLN 327 ? OE1 ? A GLN 329 OE1 34 1 Y 1 A GLN 327 ? NE2 ? A GLN 329 NE2 35 1 Y 1 A HIS 385 ? CG ? A HIS 387 CG 36 1 Y 1 A HIS 385 ? ND1 ? A HIS 387 ND1 37 1 Y 1 A HIS 385 ? CD2 ? A HIS 387 CD2 38 1 Y 1 A HIS 385 ? CE1 ? A HIS 387 CE1 39 1 Y 1 A HIS 385 ? NE2 ? A HIS 387 NE2 40 1 Y 1 A LEU 424 ? CG ? A LEU 426 CG 41 1 Y 1 A LEU 424 ? CD1 ? A LEU 426 CD1 42 1 Y 1 A LEU 424 ? CD2 ? A LEU 426 CD2 43 1 Y 1 A ASN 494 ? CG ? A ASN 496 CG 44 1 Y 1 A ASN 494 ? OD1 ? A ASN 496 OD1 45 1 Y 1 A ASN 494 ? ND2 ? A ASN 496 ND2 46 1 Y 1 A TYR 495 ? CG ? A TYR 497 CG 47 1 Y 1 A TYR 495 ? CD1 ? A TYR 497 CD1 48 1 Y 1 A TYR 495 ? CD2 ? A TYR 497 CD2 49 1 Y 1 A TYR 495 ? CE1 ? A TYR 497 CE1 50 1 Y 1 A TYR 495 ? CE2 ? A TYR 497 CE2 51 1 Y 1 A TYR 495 ? CZ ? A TYR 497 CZ 52 1 Y 1 A TYR 495 ? OH ? A TYR 497 OH 53 1 Y 1 A LYS 552 ? CG ? A LYS 554 CG 54 1 Y 1 A LYS 552 ? CD ? A LYS 554 CD 55 1 Y 1 A LYS 552 ? CE ? A LYS 554 CE 56 1 Y 1 A LYS 552 ? NZ ? A LYS 554 NZ 57 1 Y 1 A GLU 562 ? CG ? A GLU 564 CG 58 1 Y 1 A GLU 562 ? CD ? A GLU 564 CD 59 1 Y 1 A GLU 562 ? OE1 ? A GLU 564 OE1 60 1 Y 1 A GLU 562 ? OE2 ? A GLU 564 OE2 61 1 Y 1 A GLU 564 ? CG ? A GLU 566 CG 62 1 Y 1 A GLU 564 ? CD ? A GLU 566 CD 63 1 Y 1 A GLU 564 ? OE1 ? A GLU 566 OE1 64 1 Y 1 A GLU 564 ? OE2 ? A GLU 566 OE2 65 1 Y 1 A ASN 565 ? CG ? A ASN 567 CG 66 1 Y 1 A ASN 565 ? OD1 ? A ASN 567 OD1 67 1 Y 1 A ASN 565 ? ND2 ? A ASN 567 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.9 5 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8AGG _cell.details ? _cell.formula_units_Z ? _cell.length_a 78.022 _cell.length_a_esd ? _cell.length_b 78.022 _cell.length_b_esd ? _cell.length_c 382.014 _cell.length_c_esd ? _cell.volume 2013928.595 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8AGG _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall 'P 61 2 (x,y,z+5/12)' _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8AGG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.6 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.65 _exptl_crystal.description hexagonal _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'MES 0.1M pH 5, PEG6000 5%' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-11-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976240 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976240 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P13 (MX1)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8AGG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.60 _reflns.d_resolution_low 67.57 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8684 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.71 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 24.6 _reflns.pdbx_Rmerge_I_obs 0.1709 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 3.60 _reflns_shell.d_res_low 3.94 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2009 _reflns_shell.percent_possible_all 99.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.076 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 24.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.673 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 171.29 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8AGG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.60 _refine.ls_d_res_low 66.54 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8675 _refine.ls_number_reflns_R_free 409 _refine.ls_number_reflns_R_work 8266 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.73 _refine.ls_percent_reflns_R_free 4.71 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2643 _refine.ls_R_factor_R_free 0.2988 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2626 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model Lem3_apo _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.4503 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5653 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.60 _refine_hist.d_res_low 66.54 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3843 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3842 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0014 ? 3900 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.3764 ? 5263 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0378 ? 613 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0021 ? 676 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.4055 ? 1443 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.60 4.12 . . 130 2669 99.26 . . . 0.3720 . 0.2929 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.12 5.19 . . 145 2697 99.09 . . . 0.3507 . 0.2682 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.19 66.54 . . 134 2900 97.90 . . . 0.2515 . 0.2523 . . . . . . . . . . . # _struct.entry_id 8AGG _struct.title 'Structure of the Legionella phosphocholine hydrolase Lem3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8AGG _struct_keywords.text 'Bacterial effector, dephosphocholinase, Legionella pneumophila, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LEM3_LEGPH _struct_ref.pdbx_db_accession Q5ZXN5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKLRYIINENKLVFTSCNMRDKIITGKKIIFSQSVAKDQTKNLSSFLSERFYSVNQSHNHSIIIGSSLSHQENDIEHDTI LDTSGVLVTTDTNGIVNGARVAITDGLGGGNGDQEEDDEIYRVSHSSCENFLNCDQNIDTTLSLITQPKASDKKQTAPKT LQHTEASMAAFIYQNHPGKGYIGEFANIGDGLIIILDKRFKIKHMVSACHIYRGFGTWTPPSLQALATTANKDALLVRQT LKLAEGDIIISMTDGVWGELKTSLIAQTNDRRDIGVDKEYFKTLFDELTDAPYPSSFDIARIITQRAMSRSLERRKTLIK LINEIEQQHFHEKSVKTINEVLEYFIKTGHVETAQTLKAILFEDGLSDGITYFENIEIPLEMVMHDLKSRTVGDCSTINV TRIPYHLDELIRGFINYPEKHQILAPLFKARVKSEADLEEAFHRLSLEMVQPEIECPISETHFERAFKKETLDKTQAVLT HYFRISTGLDSKKNYQERLNDLSAYLSKESSLEKNDIKLLLSMLDSEIKPKTGVFQTLFGENQNKLYKAFHKKIELQLLD SEIENKNELK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8AGG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 572 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5ZXN5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 570 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 570 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8AGG GLY A 1 ? UNP Q5ZXN5 ? ? 'expression tag' -1 1 1 8AGG HIS A 2 ? UNP Q5ZXN5 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE -10 ? 1 'SSA (A^2)' 24720 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 36 ? GLN A 41 ? SER A 34 GLN A 39 1 ? 6 HELX_P HELX_P2 AA2 ASN A 44 ? ARG A 52 ? ASN A 42 ARG A 50 1 ? 9 HELX_P HELX_P3 AA3 ASP A 115 ? CYS A 136 ? ASP A 113 CYS A 134 1 ? 22 HELX_P HELX_P4 AA4 ASN A 139 ? THR A 148 ? ASN A 137 THR A 146 1 ? 10 HELX_P HELX_P5 AA5 SER A 224 ? ALA A 229 ? SER A 222 ALA A 227 5 ? 6 HELX_P HELX_P6 AA6 THR A 255 ? GLY A 260 ? THR A 253 GLY A 258 1 ? 6 HELX_P HELX_P7 AA7 ASP A 279 ? LEU A 286 ? ASP A 277 LEU A 284 1 ? 8 HELX_P HELX_P8 AA8 PHE A 287 ? THR A 291 ? PHE A 285 THR A 289 5 ? 5 HELX_P HELX_P9 AA9 SER A 297 ? GLN A 329 ? SER A 295 GLN A 327 1 ? 33 HELX_P HELX_P10 AB1 THR A 339 ? GLY A 351 ? THR A 337 GLY A 349 1 ? 13 HELX_P HELX_P11 AB2 HIS A 352 ? ASP A 366 ? HIS A 350 ASP A 364 1 ? 15 HELX_P HELX_P12 AB3 PRO A 381 ? SER A 391 ? PRO A 379 SER A 389 1 ? 11 HELX_P HELX_P13 AB4 TYR A 407 ? TYR A 419 ? TYR A 405 TYR A 417 1 ? 13 HELX_P HELX_P14 AB5 PRO A 420 ? HIS A 423 ? PRO A 418 HIS A 421 5 ? 4 HELX_P HELX_P15 AB6 LEU A 426 ? VAL A 434 ? LEU A 424 VAL A 432 1 ? 9 HELX_P HELX_P16 AB7 SER A 436 ? LEU A 449 ? SER A 434 LEU A 447 1 ? 14 HELX_P HELX_P17 AB8 LYS A 470 ? SER A 488 ? LYS A 468 SER A 486 1 ? 19 HELX_P HELX_P18 AB9 TYR A 497 ? GLU A 511 ? TYR A 495 GLU A 509 1 ? 15 HELX_P HELX_P19 AC1 GLU A 515 ? ASN A 517 ? GLU A 513 ASN A 515 5 ? 3 HELX_P HELX_P20 AC2 ASP A 518 ? SER A 528 ? ASP A 516 SER A 526 1 ? 11 HELX_P HELX_P21 AC3 LYS A 547 ? GLU A 566 ? LYS A 545 GLU A 564 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 107 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 105 A MG 601 1_555 ? ? ? ? ? ? ? 2.231 ? ? metalc2 metalc ? ? A ASP 107 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 105 A MG 601 1_555 ? ? ? ? ? ? ? 2.113 ? ? metalc3 metalc ? ? A ASP 256 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 254 A MG 601 1_555 ? ? ? ? ? ? ? 2.125 ? ? metalc4 metalc ? ? A ASP 256 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 254 A MG 601 1_555 ? ? ? ? ? ? ? 2.121 ? ? metalc5 metalc ? ? A ASP 396 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 394 A MG 601 1_555 ? ? ? ? ? ? ? 2.169 ? ? metalc6 metalc ? ? A ASP 396 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 394 A MG 601 1_555 ? ? ? ? ? ? ? 2.177 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 107 ? A ASP 105 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 107 ? A ASP 105 ? 1_555 60.3 ? 2 OD1 ? A ASP 107 ? A ASP 105 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 256 ? A ASP 254 ? 1_555 128.7 ? 3 OD2 ? A ASP 107 ? A ASP 105 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 256 ? A ASP 254 ? 1_555 68.4 ? 4 OD1 ? A ASP 107 ? A ASP 105 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 256 ? A ASP 254 ? 1_555 113.4 ? 5 OD2 ? A ASP 107 ? A ASP 105 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 256 ? A ASP 254 ? 1_555 85.8 ? 6 OD1 ? A ASP 256 ? A ASP 254 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 256 ? A ASP 254 ? 1_555 62.1 ? 7 OD1 ? A ASP 107 ? A ASP 105 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 396 ? A ASP 394 ? 1_555 116.3 ? 8 OD2 ? A ASP 107 ? A ASP 105 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 396 ? A ASP 394 ? 1_555 133.2 ? 9 OD1 ? A ASP 256 ? A ASP 254 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 396 ? A ASP 394 ? 1_555 97.0 ? 10 OD2 ? A ASP 256 ? A ASP 254 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 396 ? A ASP 394 ? 1_555 127.7 ? 11 OD1 ? A ASP 107 ? A ASP 105 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 396 ? A ASP 394 ? 1_555 142.7 ? 12 OD2 ? A ASP 107 ? A ASP 105 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 396 ? A ASP 394 ? 1_555 152.2 ? 13 OD1 ? A ASP 256 ? A ASP 254 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 396 ? A ASP 394 ? 1_555 87.1 ? 14 OD2 ? A ASP 256 ? A ASP 254 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 396 ? A ASP 394 ? 1_555 70.7 ? 15 OD1 ? A ASP 396 ? A ASP 394 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 396 ? A ASP 394 ? 1_555 60.2 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 7 ? AA4 ? 2 ? AA5 ? 2 ? AA6 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 24 ? ILE A 26 ? LYS A 22 ILE A 24 AA1 2 ASP A 84 ? THR A 92 ? ASP A 82 THR A 90 AA1 3 VAL A 98 ? GLY A 108 ? VAL A 96 GLY A 106 AA1 4 ALA A 168 ? HIS A 178 ? ALA A 166 HIS A 176 AA1 5 GLY A 182 ? ILE A 190 ? GLY A 180 ILE A 188 AA2 1 ILE A 31 ? SER A 34 ? ILE A 29 SER A 32 AA2 2 ILE A 77 ? THR A 81 ? ILE A 75 THR A 79 AA3 1 ILE A 204 ? VAL A 208 ? ILE A 202 VAL A 206 AA3 2 LEU A 194 ? LEU A 198 ? LEU A 192 LEU A 196 AA3 3 ILE A 250 ? MET A 254 ? ILE A 248 MET A 252 AA3 4 CYS A 397 ? ARG A 404 ? CYS A 395 ARG A 402 AA3 5 HIS A 62 ? SER A 68 ? HIS A 60 SER A 66 AA3 6 PHE A 53 ? SER A 59 ? PHE A 51 SER A 57 AA3 7 GLU A 457 ? PRO A 459 ? GLU A 455 PRO A 457 AA4 1 ILE A 213 ? TYR A 214 ? ILE A 211 TYR A 212 AA4 2 TRP A 220 ? THR A 221 ? TRP A 218 THR A 219 AA5 1 THR A 264 ? GLN A 269 ? THR A 262 GLN A 267 AA5 2 ARG A 274 ? VAL A 278 ? ARG A 272 VAL A 276 AA6 1 MET A 451 ? VAL A 452 ? MET A 449 VAL A 450 AA6 2 GLU A 466 ? ARG A 467 ? GLU A 464 ARG A 465 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 25 ? N ILE A 23 O VAL A 88 ? O VAL A 86 AA1 2 3 N GLY A 87 ? N GLY A 85 O ALA A 104 ? O ALA A 102 AA1 3 4 N ILE A 105 ? N ILE A 103 O ALA A 171 ? O ALA A 169 AA1 4 5 N GLN A 176 ? N GLN A 174 O ILE A 184 ? O ILE A 182 AA2 1 2 N SER A 34 ? N SER A 32 O ILE A 77 ? O ILE A 75 AA3 1 2 O LYS A 205 ? O LYS A 203 N ILE A 197 ? N ILE A 195 AA3 2 3 N LEU A 198 ? N LEU A 196 O ILE A 250 ? O ILE A 248 AA3 3 4 N ILE A 251 ? N ILE A 249 O THR A 403 ? O THR A 401 AA3 4 5 O SER A 398 ? O SER A 396 N GLY A 67 ? N GLY A 65 AA3 5 6 O ILE A 64 ? O ILE A 62 N VAL A 56 ? N VAL A 54 AA3 6 7 N SER A 55 ? N SER A 53 O CYS A 458 ? O CYS A 456 AA4 1 2 N ILE A 213 ? N ILE A 211 O THR A 221 ? O THR A 219 AA5 1 2 N ALA A 268 ? N ALA A 266 O ASP A 275 ? O ASP A 273 AA6 1 2 N VAL A 452 ? N VAL A 450 O GLU A 466 ? O GLU A 464 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 57 ? ? -166.32 -169.78 2 1 ASP A 91 ? ? -81.83 -151.61 3 1 ALA A 166 ? ? -164.03 117.56 4 1 ASP A 197 ? ? -115.91 -162.26 5 1 THR A 217 ? ? -112.50 70.33 6 1 VAL A 256 ? ? -102.74 -71.13 7 1 THR A 268 ? ? -94.71 -146.76 8 1 ASP A 270 ? ? -148.16 15.08 9 1 LEU A 288 ? ? -141.44 18.30 10 1 TYR A 293 ? ? 55.54 73.46 11 1 SER A 334 ? ? 54.50 71.56 12 1 LYS A 336 ? ? -131.52 -30.89 13 1 HIS A 350 ? ? -92.68 58.71 14 1 GLU A 460 ? ? -102.75 47.17 15 1 TYR A 495 ? ? -107.33 -115.98 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/6 3 y,-x+y,z+5/6 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 x-y,-y,-z 7 -x,-x+y,-z+2/3 8 -x,-y,z+1/2 9 y,x,-z+1/3 10 -y,-x,-z+5/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+1/6 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 5.29215333084 -27.0372174407 -1.73328433371 1.29482595671 ? -0.0189507091589 ? 0.0889858079047 ? 1.47545099049 ? 0.500196933071 ? 1.6653728717 ? 1.28775149814 ? -0.88023875454 ? 1.80124441259 ? 3.9288091671 ? -2.34287498988 ? 4.0614873804 ? -0.064367771972 ? 0.240760738173 ? -0.329829886703 ? -0.000223882213629 ? 0.294503704816 ? -0.0299100041027 ? -0.222116062116 ? 0.114370654889 ? 6.94730583746e-05 ? 2 'X-RAY DIFFRACTION' ? refined 6.20145507639 -65.8715839019 25.3958380805 1.97912002127 ? 0.202767795728 ? 0.133132214294 ? 1.5608071778 ? 0.90477737864 ? 2.91952251528 ? 0.684015432031 ? 0.0591680273001 ? -0.547380975086 ? 0.530194487602 ? -0.289308479837 ? 0.489262135766 ? -0.400221298731 ? 0.371623488393 ? -0.994835426324 ? 0.151481787884 ? -0.087381207804 ? 0.427509621566 ? 0.996620300425 ? -0.444258127628 ? -0.15916698416 ? 3 'X-RAY DIFFRACTION' ? refined 14.4127320608 -70.3610557278 28.8404012125 1.98613858362 ? 0.146293535821 ? -0.106891116492 ? 1.50388720952 ? 0.561950486694 ? 2.3571405213 ? 0.462326019153 ? 0.0851534095853 ? 0.151754782187 ? 0.06537427239 ? -0.108038716317 ? 0.173923902362 ? -0.334497721795 ? 0.496470198063 ? -0.989144078679 ? -0.00725803035542 ? -0.595118316524 ? 0.414506524155 ? 1.26479586029 ? 0.15810739367 ? -0.00817037353626 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 19 ? A 416 A 468 ? ? ;chain 'A' and (resid 19 through 468 ) ; 2 'X-RAY DIFFRACTION' 2 A 417 A 469 ? A 449 A 508 ? ? ;chain 'A' and (resid 469 through 508 ) ; 3 'X-RAY DIFFRACTION' 3 A 450 A 509 ? A 489 A 565 ? ? ;chain 'A' and (resid 509 through 565 ) ; # _pdbx_entry_details.entry_id 8AGG _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A HIS 0 ? A HIS 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A LYS 2 ? A LYS 4 5 1 Y 1 A LEU 3 ? A LEU 5 6 1 Y 1 A ARG 4 ? A ARG 6 7 1 Y 1 A TYR 5 ? A TYR 7 8 1 Y 1 A ILE 6 ? A ILE 8 9 1 Y 1 A ILE 7 ? A ILE 9 10 1 Y 1 A ASN 8 ? A ASN 10 11 1 Y 1 A GLU 9 ? A GLU 11 12 1 Y 1 A ASN 10 ? A ASN 12 13 1 Y 1 A LYS 11 ? A LYS 13 14 1 Y 1 A LEU 12 ? A LEU 14 15 1 Y 1 A VAL 13 ? A VAL 15 16 1 Y 1 A PHE 14 ? A PHE 16 17 1 Y 1 A THR 15 ? A THR 17 18 1 Y 1 A SER 16 ? A SER 18 19 1 Y 1 A CYS 17 ? A CYS 19 20 1 Y 1 A ASN 18 ? A ASN 20 21 1 Y 1 A PRO 148 ? A PRO 150 22 1 Y 1 A LYS 149 ? A LYS 151 23 1 Y 1 A ALA 150 ? A ALA 152 24 1 Y 1 A SER 151 ? A SER 153 25 1 Y 1 A ASP 152 ? A ASP 154 26 1 Y 1 A LYS 153 ? A LYS 155 27 1 Y 1 A LYS 154 ? A LYS 156 28 1 Y 1 A GLN 155 ? A GLN 157 29 1 Y 1 A THR 156 ? A THR 158 30 1 Y 1 A ALA 157 ? A ALA 159 31 1 Y 1 A PRO 158 ? A PRO 160 32 1 Y 1 A LYS 159 ? A LYS 161 33 1 Y 1 A THR 160 ? A THR 162 34 1 Y 1 A LEU 161 ? A LEU 163 35 1 Y 1 A GLN 162 ? A GLN 164 36 1 Y 1 A HIS 163 ? A HIS 165 37 1 Y 1 A ALA 234 ? A ALA 236 38 1 Y 1 A LEU 235 ? A LEU 237 39 1 Y 1 A LEU 236 ? A LEU 238 40 1 Y 1 A VAL 237 ? A VAL 239 41 1 Y 1 A ARG 238 ? A ARG 240 42 1 Y 1 A GLN 239 ? A GLN 241 43 1 Y 1 A THR 240 ? A THR 242 44 1 Y 1 A LEU 241 ? A LEU 243 45 1 Y 1 A GLY 365 ? A GLY 367 46 1 Y 1 A LEU 366 ? A LEU 368 47 1 Y 1 A SER 367 ? A SER 369 48 1 Y 1 A ASP 368 ? A ASP 370 49 1 Y 1 A GLY 369 ? A GLY 371 50 1 Y 1 A ILE 370 ? A ILE 372 51 1 Y 1 A THR 371 ? A THR 373 52 1 Y 1 A TYR 372 ? A TYR 374 53 1 Y 1 A PHE 373 ? A PHE 375 54 1 Y 1 A GLU 374 ? A GLU 376 55 1 Y 1 A THR 487 ? A THR 489 56 1 Y 1 A GLY 488 ? A GLY 490 57 1 Y 1 A LEU 489 ? A LEU 491 58 1 Y 1 A ASP 490 ? A ASP 492 59 1 Y 1 A SER 491 ? A SER 493 60 1 Y 1 A LYS 492 ? A LYS 494 61 1 Y 1 A LYS 493 ? A LYS 495 62 1 Y 1 A GLU 527 ? A GLU 529 63 1 Y 1 A ILE 528 ? A ILE 530 64 1 Y 1 A LYS 529 ? A LYS 531 65 1 Y 1 A PRO 530 ? A PRO 532 66 1 Y 1 A LYS 531 ? A LYS 533 67 1 Y 1 A THR 532 ? A THR 534 68 1 Y 1 A GLY 533 ? A GLY 535 69 1 Y 1 A VAL 534 ? A VAL 536 70 1 Y 1 A PHE 535 ? A PHE 537 71 1 Y 1 A GLN 536 ? A GLN 538 72 1 Y 1 A THR 537 ? A THR 539 73 1 Y 1 A LEU 538 ? A LEU 540 74 1 Y 1 A PHE 539 ? A PHE 541 75 1 Y 1 A GLY 540 ? A GLY 542 76 1 Y 1 A GLU 541 ? A GLU 543 77 1 Y 1 A ASN 542 ? A ASN 544 78 1 Y 1 A GLN 543 ? A GLN 545 79 1 Y 1 A LYS 566 ? A LYS 568 80 1 Y 1 A ASN 567 ? A ASN 569 81 1 Y 1 A GLU 568 ? A GLU 570 82 1 Y 1 A LEU 569 ? A LEU 571 83 1 Y 1 A LYS 570 ? A LYS 572 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 MG MG MG N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details Lem3_apo # _space_group.name_H-M_alt 'P 61 2 2' _space_group.name_Hall 'P 61 2 (x,y,z+5/12)' _space_group.IT_number 178 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 8AGG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012817 _atom_sites.fract_transf_matrix[1][2] 0.007400 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014800 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002618 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 5.96793 ? ? ? 14.89577 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 15.91112 ? ? ? 10.84690 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #