data_8AHA # _entry.id 8AHA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8AHA pdb_00008aha 10.2210/pdb8aha/pdb WWPDB D_1292124193 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-07-19 2 'Structure model' 1 1 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8AHA _pdbx_database_status.recvd_initial_deposition_date 2022-07-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email virgile.adam@ibs.fr _pdbx_contact_author.name_first Virgile _pdbx_contact_author.name_last ADAM _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2209-7846 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mantovanelli, A.' 1 ? 'Adam, V.' 2 0000-0003-2209-7846 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 145 _citation.language ? _citation.page_first 14636 _citation.page_last 14646 _citation.title 'Photophysical Studies at Cryogenic Temperature Reveal a Novel Photoswitching Mechanism of rsEGFP2.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.3c01500 _citation.pdbx_database_id_PubMed 37389576 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mantovanelli, A.M.R.' 1 ? primary 'Glushonkov, O.' 2 ? primary 'Adam, V.' 3 0000-0003-2209-7846 primary 'Wulffele, J.' 4 ? primary 'Thedie, D.' 5 ? primary 'Byrdin, M.' 6 0000-0002-6389-8714 primary 'Gregor, I.' 7 0000-0002-1775-2159 primary 'Nevskyi, O.' 8 0000-0003-2893-481X primary 'Enderlein, J.' 9 0000-0001-5091-7157 primary 'Bourgeois, D.' 10 0000-0002-1862-7712 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Green fluorescent protein' 28532.203 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 8 ? ? ? ? 3 water nat water 18.015 62 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MRGSHHHHHHTDPMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTL (PIA)VLCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLE YNYNSHNVYIMADKQKNGIKSNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLE FVTAAGITLGMDELYK ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSHHHHHHTDPMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTL AYGVLCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN YNSHNVYIMADKQKNGIKSNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFV TAAGITLGMDELYK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 THR n 1 12 ASP n 1 13 PRO n 1 14 MET n 1 15 VAL n 1 16 SER n 1 17 LYS n 1 18 GLY n 1 19 GLU n 1 20 GLU n 1 21 LEU n 1 22 PHE n 1 23 THR n 1 24 GLY n 1 25 VAL n 1 26 VAL n 1 27 PRO n 1 28 ILE n 1 29 LEU n 1 30 VAL n 1 31 GLU n 1 32 LEU n 1 33 ASP n 1 34 GLY n 1 35 ASP n 1 36 VAL n 1 37 ASN n 1 38 GLY n 1 39 HIS n 1 40 LYS n 1 41 PHE n 1 42 SER n 1 43 VAL n 1 44 SER n 1 45 GLY n 1 46 GLU n 1 47 GLY n 1 48 GLU n 1 49 GLY n 1 50 ASP n 1 51 ALA n 1 52 THR n 1 53 TYR n 1 54 GLY n 1 55 LYS n 1 56 LEU n 1 57 THR n 1 58 LEU n 1 59 LYS n 1 60 PHE n 1 61 ILE n 1 62 CYS n 1 63 THR n 1 64 THR n 1 65 GLY n 1 66 LYS n 1 67 LEU n 1 68 PRO n 1 69 VAL n 1 70 PRO n 1 71 TRP n 1 72 PRO n 1 73 THR n 1 74 LEU n 1 75 VAL n 1 76 THR n 1 77 THR n 1 78 LEU n 1 79 PIA n 1 80 VAL n 1 81 LEU n 1 82 CYS n 1 83 PHE n 1 84 SER n 1 85 ARG n 1 86 TYR n 1 87 PRO n 1 88 ASP n 1 89 HIS n 1 90 MET n 1 91 LYS n 1 92 GLN n 1 93 HIS n 1 94 ASP n 1 95 PHE n 1 96 PHE n 1 97 LYS n 1 98 SER n 1 99 ALA n 1 100 MET n 1 101 PRO n 1 102 GLU n 1 103 GLY n 1 104 TYR n 1 105 VAL n 1 106 GLN n 1 107 GLU n 1 108 ARG n 1 109 THR n 1 110 ILE n 1 111 PHE n 1 112 PHE n 1 113 LYS n 1 114 ASP n 1 115 ASP n 1 116 GLY n 1 117 ASN n 1 118 TYR n 1 119 LYS n 1 120 THR n 1 121 ARG n 1 122 ALA n 1 123 GLU n 1 124 VAL n 1 125 LYS n 1 126 PHE n 1 127 GLU n 1 128 GLY n 1 129 ASP n 1 130 THR n 1 131 LEU n 1 132 VAL n 1 133 ASN n 1 134 ARG n 1 135 ILE n 1 136 GLU n 1 137 LEU n 1 138 LYS n 1 139 GLY n 1 140 ILE n 1 141 ASP n 1 142 PHE n 1 143 LYS n 1 144 GLU n 1 145 ASP n 1 146 GLY n 1 147 ASN n 1 148 ILE n 1 149 LEU n 1 150 GLY n 1 151 HIS n 1 152 LYS n 1 153 LEU n 1 154 GLU n 1 155 TYR n 1 156 ASN n 1 157 TYR n 1 158 ASN n 1 159 SER n 1 160 HIS n 1 161 ASN n 1 162 VAL n 1 163 TYR n 1 164 ILE n 1 165 MET n 1 166 ALA n 1 167 ASP n 1 168 LYS n 1 169 GLN n 1 170 LYS n 1 171 ASN n 1 172 GLY n 1 173 ILE n 1 174 LYS n 1 175 SER n 1 176 ASN n 1 177 PHE n 1 178 LYS n 1 179 ILE n 1 180 ARG n 1 181 HIS n 1 182 ASN n 1 183 ILE n 1 184 GLU n 1 185 ASP n 1 186 GLY n 1 187 SER n 1 188 VAL n 1 189 GLN n 1 190 LEU n 1 191 ALA n 1 192 ASP n 1 193 HIS n 1 194 TYR n 1 195 GLN n 1 196 GLN n 1 197 ASN n 1 198 THR n 1 199 PRO n 1 200 ILE n 1 201 GLY n 1 202 ASP n 1 203 GLY n 1 204 PRO n 1 205 VAL n 1 206 LEU n 1 207 LEU n 1 208 PRO n 1 209 ASP n 1 210 ASN n 1 211 HIS n 1 212 TYR n 1 213 LEU n 1 214 SER n 1 215 THR n 1 216 GLN n 1 217 SER n 1 218 LYS n 1 219 LEU n 1 220 SER n 1 221 LYS n 1 222 ASP n 1 223 PRO n 1 224 ASN n 1 225 GLU n 1 226 LYS n 1 227 ARG n 1 228 ASP n 1 229 HIS n 1 230 MET n 1 231 VAL n 1 232 LEU n 1 233 LEU n 1 234 GLU n 1 235 PHE n 1 236 VAL n 1 237 THR n 1 238 ALA n 1 239 ALA n 1 240 GLY n 1 241 ILE n 1 242 THR n 1 243 LEU n 1 244 GLY n 1 245 MET n 1 246 ASP n 1 247 GLU n 1 248 LEU n 1 249 TYR n 1 250 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 250 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GFP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aequorea victoria' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6100 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PIA 'L-peptide linking' n '[(4Z)-2-[(1S)-1-aminoethyl]-4-(4-hydroxybenzylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl]acetic acid' ? 'C14 H15 N3 O4' 289.287 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -12 ? ? ? A . n A 1 2 ARG 2 -11 ? ? ? A . n A 1 3 GLY 3 -10 ? ? ? A . n A 1 4 SER 4 -9 ? ? ? A . n A 1 5 HIS 5 -8 ? ? ? A . n A 1 6 HIS 6 -7 ? ? ? A . n A 1 7 HIS 7 -6 -6 HIS HIS A . n A 1 8 HIS 8 -5 -5 HIS HIS A . n A 1 9 HIS 9 -4 -4 HIS HIS A . n A 1 10 HIS 10 -3 -3 HIS HIS A . n A 1 11 THR 11 -2 -2 THR THR A . n A 1 12 ASP 12 -1 -1 ASP ASP A . n A 1 13 PRO 13 0 0 PRO PRO A . n A 1 14 MET 14 1 1 MET MET A . n A 1 15 VAL 15 2 2 VAL VAL A . n A 1 16 SER 16 3 3 SER SER A . n A 1 17 LYS 17 4 4 LYS LYS A . n A 1 18 GLY 18 5 5 GLY GLY A . n A 1 19 GLU 19 6 6 GLU GLU A . n A 1 20 GLU 20 7 7 GLU GLU A . n A 1 21 LEU 21 8 8 LEU LEU A . n A 1 22 PHE 22 9 9 PHE PHE A . n A 1 23 THR 23 10 10 THR THR A . n A 1 24 GLY 24 11 11 GLY GLY A . n A 1 25 VAL 25 12 12 VAL VAL A . n A 1 26 VAL 26 13 13 VAL VAL A . n A 1 27 PRO 27 14 14 PRO PRO A . n A 1 28 ILE 28 15 15 ILE ILE A . n A 1 29 LEU 29 16 16 LEU LEU A . n A 1 30 VAL 30 17 17 VAL VAL A . n A 1 31 GLU 31 18 18 GLU GLU A . n A 1 32 LEU 32 19 19 LEU LEU A . n A 1 33 ASP 33 20 20 ASP ASP A . n A 1 34 GLY 34 21 21 GLY GLY A . n A 1 35 ASP 35 22 22 ASP ASP A . n A 1 36 VAL 36 23 23 VAL VAL A . n A 1 37 ASN 37 24 24 ASN ASN A . n A 1 38 GLY 38 25 25 GLY GLY A . n A 1 39 HIS 39 26 26 HIS HIS A . n A 1 40 LYS 40 27 27 LYS LYS A . n A 1 41 PHE 41 28 28 PHE PHE A . n A 1 42 SER 42 29 29 SER SER A . n A 1 43 VAL 43 30 30 VAL VAL A . n A 1 44 SER 44 31 31 SER SER A . n A 1 45 GLY 45 32 32 GLY GLY A . n A 1 46 GLU 46 33 33 GLU GLU A . n A 1 47 GLY 47 34 34 GLY GLY A . n A 1 48 GLU 48 35 35 GLU GLU A . n A 1 49 GLY 49 36 36 GLY GLY A . n A 1 50 ASP 50 37 37 ASP ASP A . n A 1 51 ALA 51 38 38 ALA ALA A . n A 1 52 THR 52 39 39 THR THR A . n A 1 53 TYR 53 40 40 TYR TYR A . n A 1 54 GLY 54 41 41 GLY GLY A . n A 1 55 LYS 55 42 42 LYS LYS A . n A 1 56 LEU 56 43 43 LEU LEU A . n A 1 57 THR 57 44 44 THR THR A . n A 1 58 LEU 58 45 45 LEU LEU A . n A 1 59 LYS 59 46 46 LYS LYS A . n A 1 60 PHE 60 47 47 PHE PHE A . n A 1 61 ILE 61 48 48 ILE ILE A . n A 1 62 CYS 62 49 49 CYS CYS A . n A 1 63 THR 63 50 50 THR THR A . n A 1 64 THR 64 51 51 THR THR A . n A 1 65 GLY 65 52 52 GLY GLY A . n A 1 66 LYS 66 53 53 LYS LYS A . n A 1 67 LEU 67 54 54 LEU LEU A . n A 1 68 PRO 68 55 55 PRO PRO A . n A 1 69 VAL 69 56 56 VAL VAL A . n A 1 70 PRO 70 57 57 PRO PRO A . n A 1 71 TRP 71 58 58 TRP TRP A . n A 1 72 PRO 72 59 59 PRO PRO A . n A 1 73 THR 73 60 60 THR THR A . n A 1 74 LEU 74 61 61 LEU LEU A . n A 1 75 VAL 75 62 62 VAL VAL A . n A 1 76 THR 76 63 63 THR THR A . n A 1 77 THR 77 64 64 THR THR A . n A 1 78 LEU 78 65 65 LEU LEU A . n A 1 79 PIA 79 68 68 PIA PIA A . n A 1 80 VAL 80 69 69 VAL VAL A . n A 1 81 LEU 81 70 70 LEU LEU A . n A 1 82 CYS 82 71 71 CYS CYS A . n A 1 83 PHE 83 72 72 PHE PHE A . n A 1 84 SER 84 73 73 SER SER A . n A 1 85 ARG 85 74 74 ARG ARG A . n A 1 86 TYR 86 75 75 TYR TYR A . n A 1 87 PRO 87 76 76 PRO PRO A . n A 1 88 ASP 88 77 77 ASP ASP A . n A 1 89 HIS 89 78 78 HIS HIS A . n A 1 90 MET 90 79 79 MET MET A . n A 1 91 LYS 91 80 80 LYS LYS A . n A 1 92 GLN 92 81 81 GLN GLN A . n A 1 93 HIS 93 82 82 HIS HIS A . n A 1 94 ASP 94 83 83 ASP ASP A . n A 1 95 PHE 95 84 84 PHE PHE A . n A 1 96 PHE 96 85 85 PHE PHE A . n A 1 97 LYS 97 86 86 LYS LYS A . n A 1 98 SER 98 87 87 SER SER A . n A 1 99 ALA 99 88 88 ALA ALA A . n A 1 100 MET 100 89 89 MET MET A . n A 1 101 PRO 101 90 90 PRO PRO A . n A 1 102 GLU 102 91 91 GLU GLU A . n A 1 103 GLY 103 92 92 GLY GLY A . n A 1 104 TYR 104 93 93 TYR TYR A . n A 1 105 VAL 105 94 94 VAL VAL A . n A 1 106 GLN 106 95 95 GLN GLN A . n A 1 107 GLU 107 96 96 GLU GLU A . n A 1 108 ARG 108 97 97 ARG ARG A . n A 1 109 THR 109 98 98 THR THR A . n A 1 110 ILE 110 99 99 ILE ILE A . n A 1 111 PHE 111 100 100 PHE PHE A . n A 1 112 PHE 112 101 101 PHE PHE A . n A 1 113 LYS 113 102 102 LYS LYS A . n A 1 114 ASP 114 103 103 ASP ASP A . n A 1 115 ASP 115 104 104 ASP ASP A . n A 1 116 GLY 116 105 105 GLY GLY A . n A 1 117 ASN 117 106 106 ASN ASN A . n A 1 118 TYR 118 107 107 TYR TYR A . n A 1 119 LYS 119 108 108 LYS LYS A . n A 1 120 THR 120 109 109 THR THR A . n A 1 121 ARG 121 110 110 ARG ARG A . n A 1 122 ALA 122 111 111 ALA ALA A . n A 1 123 GLU 123 112 112 GLU GLU A . n A 1 124 VAL 124 113 113 VAL VAL A . n A 1 125 LYS 125 114 114 LYS LYS A . n A 1 126 PHE 126 115 115 PHE PHE A . n A 1 127 GLU 127 116 116 GLU GLU A . n A 1 128 GLY 128 117 117 GLY GLY A . n A 1 129 ASP 129 118 118 ASP ASP A . n A 1 130 THR 130 119 119 THR THR A . n A 1 131 LEU 131 120 120 LEU LEU A . n A 1 132 VAL 132 121 121 VAL VAL A . n A 1 133 ASN 133 122 122 ASN ASN A . n A 1 134 ARG 134 123 123 ARG ARG A . n A 1 135 ILE 135 124 124 ILE ILE A . n A 1 136 GLU 136 125 125 GLU GLU A . n A 1 137 LEU 137 126 126 LEU LEU A . n A 1 138 LYS 138 127 127 LYS LYS A . n A 1 139 GLY 139 128 128 GLY GLY A . n A 1 140 ILE 140 129 129 ILE ILE A . n A 1 141 ASP 141 130 130 ASP ASP A . n A 1 142 PHE 142 131 131 PHE PHE A . n A 1 143 LYS 143 132 132 LYS LYS A . n A 1 144 GLU 144 133 133 GLU GLU A . n A 1 145 ASP 145 134 134 ASP ASP A . n A 1 146 GLY 146 135 135 GLY GLY A . n A 1 147 ASN 147 136 136 ASN ASN A . n A 1 148 ILE 148 137 137 ILE ILE A . n A 1 149 LEU 149 138 138 LEU LEU A . n A 1 150 GLY 150 139 139 GLY GLY A . n A 1 151 HIS 151 140 140 HIS HIS A . n A 1 152 LYS 152 141 141 LYS LYS A . n A 1 153 LEU 153 142 142 LEU LEU A . n A 1 154 GLU 154 143 143 GLU GLU A . n A 1 155 TYR 155 144 144 TYR TYR A . n A 1 156 ASN 156 145 145 ASN ASN A . n A 1 157 TYR 157 146 146 TYR TYR A . n A 1 158 ASN 158 147 147 ASN ASN A . n A 1 159 SER 159 148 148 SER SER A . n A 1 160 HIS 160 149 149 HIS HIS A . n A 1 161 ASN 161 150 150 ASN ASN A . n A 1 162 VAL 162 151 151 VAL VAL A . n A 1 163 TYR 163 152 152 TYR TYR A . n A 1 164 ILE 164 153 153 ILE ILE A . n A 1 165 MET 165 154 154 MET MET A . n A 1 166 ALA 166 155 155 ALA ALA A . n A 1 167 ASP 167 156 156 ASP ASP A . n A 1 168 LYS 168 157 157 LYS LYS A . n A 1 169 GLN 169 158 158 GLN GLN A . n A 1 170 LYS 170 159 159 LYS LYS A . n A 1 171 ASN 171 160 160 ASN ASN A . n A 1 172 GLY 172 161 161 GLY GLY A . n A 1 173 ILE 173 162 162 ILE ILE A . n A 1 174 LYS 174 163 163 LYS LYS A . n A 1 175 SER 175 164 164 SER SER A . n A 1 176 ASN 176 165 165 ASN ASN A . n A 1 177 PHE 177 166 166 PHE PHE A . n A 1 178 LYS 178 167 167 LYS LYS A . n A 1 179 ILE 179 168 168 ILE ILE A . n A 1 180 ARG 180 169 169 ARG ARG A . n A 1 181 HIS 181 170 170 HIS HIS A . n A 1 182 ASN 182 171 171 ASN ASN A . n A 1 183 ILE 183 172 172 ILE ILE A . n A 1 184 GLU 184 173 173 GLU GLU A . n A 1 185 ASP 185 174 174 ASP ASP A . n A 1 186 GLY 186 175 175 GLY GLY A . n A 1 187 SER 187 176 176 SER SER A . n A 1 188 VAL 188 177 177 VAL VAL A . n A 1 189 GLN 189 178 178 GLN GLN A . n A 1 190 LEU 190 179 179 LEU LEU A . n A 1 191 ALA 191 180 180 ALA ALA A . n A 1 192 ASP 192 181 181 ASP ASP A . n A 1 193 HIS 193 182 182 HIS HIS A . n A 1 194 TYR 194 183 183 TYR TYR A . n A 1 195 GLN 195 184 184 GLN GLN A . n A 1 196 GLN 196 185 185 GLN GLN A . n A 1 197 ASN 197 186 186 ASN ASN A . n A 1 198 THR 198 187 187 THR THR A . n A 1 199 PRO 199 188 188 PRO PRO A . n A 1 200 ILE 200 189 189 ILE ILE A . n A 1 201 GLY 201 190 190 GLY GLY A . n A 1 202 ASP 202 191 191 ASP ASP A . n A 1 203 GLY 203 192 192 GLY GLY A . n A 1 204 PRO 204 193 193 PRO PRO A . n A 1 205 VAL 205 194 194 VAL VAL A . n A 1 206 LEU 206 195 195 LEU LEU A . n A 1 207 LEU 207 196 196 LEU LEU A . n A 1 208 PRO 208 197 197 PRO PRO A . n A 1 209 ASP 209 198 198 ASP ASP A . n A 1 210 ASN 210 199 199 ASN ASN A . n A 1 211 HIS 211 200 200 HIS HIS A . n A 1 212 TYR 212 201 201 TYR TYR A . n A 1 213 LEU 213 202 202 LEU LEU A . n A 1 214 SER 214 203 203 SER SER A . n A 1 215 THR 215 204 204 THR THR A . n A 1 216 GLN 216 205 205 GLN GLN A . n A 1 217 SER 217 206 206 SER SER A . n A 1 218 LYS 218 207 207 LYS LYS A . n A 1 219 LEU 219 208 208 LEU LEU A . n A 1 220 SER 220 209 209 SER SER A . n A 1 221 LYS 221 210 210 LYS LYS A . n A 1 222 ASP 222 211 211 ASP ASP A . n A 1 223 PRO 223 212 212 PRO PRO A . n A 1 224 ASN 224 213 213 ASN ASN A . n A 1 225 GLU 225 214 214 GLU GLU A . n A 1 226 LYS 226 215 215 LYS LYS A . n A 1 227 ARG 227 216 216 ARG ARG A . n A 1 228 ASP 228 217 217 ASP ASP A . n A 1 229 HIS 229 218 218 HIS HIS A . n A 1 230 MET 230 219 219 MET MET A . n A 1 231 VAL 231 220 220 VAL VAL A . n A 1 232 LEU 232 221 221 LEU LEU A . n A 1 233 LEU 233 222 222 LEU LEU A . n A 1 234 GLU 234 223 223 GLU GLU A . n A 1 235 PHE 235 224 224 PHE PHE A . n A 1 236 VAL 236 225 225 VAL VAL A . n A 1 237 THR 237 226 226 THR THR A . n A 1 238 ALA 238 227 227 ALA ALA A . n A 1 239 ALA 239 228 228 ALA ALA A . n A 1 240 GLY 240 229 229 GLY GLY A . n A 1 241 ILE 241 230 230 ILE ILE A . n A 1 242 THR 242 231 231 THR THR A . n A 1 243 LEU 243 232 232 LEU LEU A . n A 1 244 GLY 244 233 233 GLY GLY A . n A 1 245 MET 245 234 ? ? ? A . n A 1 246 ASP 246 235 ? ? ? A . n A 1 247 GLU 247 236 ? ? ? A . n A 1 248 LEU 248 237 ? ? ? A . n A 1 249 TYR 249 238 ? ? ? A . n A 1 250 LYS 250 239 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 1 SO4 SO4 A . C 2 SO4 1 302 2 SO4 SO4 A . D 2 SO4 1 303 3 SO4 SO4 A . E 2 SO4 1 304 5 SO4 SO4 A . F 2 SO4 1 305 6 SO4 SO4 A . G 2 SO4 1 306 7 SO4 SO4 A . H 2 SO4 1 307 8 SO4 SO4 A . I 2 SO4 1 308 9 SO4 SO4 A . J 3 HOH 1 401 59 HOH HOH A . J 3 HOH 2 402 37 HOH HOH A . J 3 HOH 3 403 61 HOH HOH A . J 3 HOH 4 404 67 HOH HOH A . J 3 HOH 5 405 38 HOH HOH A . J 3 HOH 6 406 45 HOH HOH A . J 3 HOH 7 407 19 HOH HOH A . J 3 HOH 8 408 22 HOH HOH A . J 3 HOH 9 409 39 HOH HOH A . J 3 HOH 10 410 57 HOH HOH A . J 3 HOH 11 411 43 HOH HOH A . J 3 HOH 12 412 13 HOH HOH A . J 3 HOH 13 413 40 HOH HOH A . J 3 HOH 14 414 62 HOH HOH A . J 3 HOH 15 415 7 HOH HOH A . J 3 HOH 16 416 47 HOH HOH A . J 3 HOH 17 417 14 HOH HOH A . J 3 HOH 18 418 33 HOH HOH A . J 3 HOH 19 419 26 HOH HOH A . J 3 HOH 20 420 28 HOH HOH A . J 3 HOH 21 421 8 HOH HOH A . J 3 HOH 22 422 18 HOH HOH A . J 3 HOH 23 423 36 HOH HOH A . J 3 HOH 24 424 5 HOH HOH A . J 3 HOH 25 425 27 HOH HOH A . J 3 HOH 26 426 41 HOH HOH A . J 3 HOH 27 427 25 HOH HOH A . J 3 HOH 28 428 9 HOH HOH A . J 3 HOH 29 429 63 HOH HOH A . J 3 HOH 30 430 35 HOH HOH A . J 3 HOH 31 431 4 HOH HOH A . J 3 HOH 32 432 1 HOH HOH A . J 3 HOH 33 433 17 HOH HOH A . J 3 HOH 34 434 65 HOH HOH A . J 3 HOH 35 435 11 HOH HOH A . J 3 HOH 36 436 23 HOH HOH A . J 3 HOH 37 437 29 HOH HOH A . J 3 HOH 38 438 10 HOH HOH A . J 3 HOH 39 439 64 HOH HOH A . J 3 HOH 40 440 56 HOH HOH A . J 3 HOH 41 441 34 HOH HOH A . J 3 HOH 42 442 2 HOH HOH A . J 3 HOH 43 443 50 HOH HOH A . J 3 HOH 44 444 58 HOH HOH A . J 3 HOH 45 445 32 HOH HOH A . J 3 HOH 46 446 6 HOH HOH A . J 3 HOH 47 447 21 HOH HOH A . J 3 HOH 48 448 66 HOH HOH A . J 3 HOH 49 449 31 HOH HOH A . J 3 HOH 50 450 42 HOH HOH A . J 3 HOH 51 451 15 HOH HOH A . J 3 HOH 52 452 24 HOH HOH A . J 3 HOH 53 453 3 HOH HOH A . J 3 HOH 54 454 16 HOH HOH A . J 3 HOH 55 455 30 HOH HOH A . J 3 HOH 56 456 54 HOH HOH A . J 3 HOH 57 457 20 HOH HOH A . J 3 HOH 58 458 60 HOH HOH A . J 3 HOH 59 459 52 HOH HOH A . J 3 HOH 60 460 49 HOH HOH A . J 3 HOH 61 461 53 HOH HOH A . J 3 HOH 62 462 12 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? 3 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? 1.1.7 2 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.9.6 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? 11.7.03 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 5 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 6 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? 1.1.7 7 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8AHA _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.400 _cell.length_a_esd ? _cell.length_b 60.755 _cell.length_b_esd ? _cell.length_c 71.580 _cell.length_c_esd ? _cell.volume 227879.368 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8AHA _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8AHA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.99 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.31 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.1 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;100 mM HEPES buffer, pH 8.1 1.9 M ammonium sulfate ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-02-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9677 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9677 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 33.79 _reflns.entry_id 8AHA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.38 _reflns.d_resolution_low 46.32 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 124380 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.88 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.44 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.07113 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.38 _reflns_shell.d_res_low 2.465 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.23 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 12739 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.4082 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.714 _reflns_shell.pdbx_CC_star 0.913 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 36.21 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8AHA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.38 _refine.ls_d_res_low 46.32 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9638 _refine.ls_number_reflns_R_free 493 _refine.ls_number_reflns_R_work 9145 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.87 _refine.ls_percent_reflns_R_free 5.12 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1882 _refine.ls_R_factor_R_free 0.2234 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1862 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5DTX _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.9299 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.38 _refine_hist.d_res_low 46.32 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 2007 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1905 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0077 ? 1984 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9994 ? 2687 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0590 ? 284 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0066 ? 342 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.9249 ? 717 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.38 2.62 . . 117 2239 100.00 . . . 0.3048 . 0.1860 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.62 2.99 . . 129 2230 99.70 . . . 0.2584 . 0.1975 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.99 3.77 . . 120 2288 100.00 . . . 0.2272 . 0.1723 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.77 46.32 . . 127 2388 99.80 . . . 0.1896 . 0.1912 . . . . . . . . . . . # _struct.entry_id 8AHA _struct.title 'rsEGFP2 photoswitched to its off-state at 100K' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8AHA _struct_keywords.text 'RSFP, Switchable, PTFP, rsEGFP2, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GFP_AEQVI _struct_ref.pdbx_db_accession P42212 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8AHA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 14 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 250 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P42212 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 239 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8AHA MET A 1 ? UNP P42212 ? ? 'initiating methionine' -12 1 1 8AHA ARG A 2 ? UNP P42212 ? ? 'expression tag' -11 2 1 8AHA GLY A 3 ? UNP P42212 ? ? 'expression tag' -10 3 1 8AHA SER A 4 ? UNP P42212 ? ? 'expression tag' -9 4 1 8AHA HIS A 5 ? UNP P42212 ? ? 'expression tag' -8 5 1 8AHA HIS A 6 ? UNP P42212 ? ? 'expression tag' -7 6 1 8AHA HIS A 7 ? UNP P42212 ? ? 'expression tag' -6 7 1 8AHA HIS A 8 ? UNP P42212 ? ? 'expression tag' -5 8 1 8AHA HIS A 9 ? UNP P42212 ? ? 'expression tag' -4 9 1 8AHA HIS A 10 ? UNP P42212 ? ? 'expression tag' -3 10 1 8AHA THR A 11 ? UNP P42212 ? ? 'expression tag' -2 11 1 8AHA ASP A 12 ? UNP P42212 ? ? 'expression tag' -1 12 1 8AHA PRO A 13 ? UNP P42212 ? ? 'expression tag' 0 13 1 8AHA VAL A 15 ? UNP P42212 ? ? insertion 2 14 1 8AHA LEU A 78 ? UNP P42212 PHE 64 'engineered mutation' 65 15 1 8AHA PIA A 79 ? UNP P42212 SER 65 chromophore 68 16 1 8AHA PIA A 79 ? UNP P42212 TYR 66 chromophore 68 17 1 8AHA PIA A 79 ? UNP P42212 GLY 67 chromophore 68 18 1 8AHA LEU A 81 ? UNP P42212 GLN 69 'engineered mutation' 70 19 1 8AHA SER A 175 ? UNP P42212 VAL 163 'engineered mutation' 164 20 1 8AHA LYS A 218 ? UNP P42212 ALA 206 'engineered mutation' 207 21 1 8AHA LEU A 243 ? UNP P42212 HIS 231 'engineered mutation' 232 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2220 ? 1 MORE -123 ? 1 'SSA (A^2)' 11030 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 12 ? PHE A 22 ? ASP A -1 PHE A 9 1 ? 11 HELX_P HELX_P2 AA2 ALA A 51 ? TYR A 53 ? ALA A 38 TYR A 40 5 ? 3 HELX_P HELX_P3 AA3 PRO A 70 ? VAL A 75 ? PRO A 57 VAL A 62 5 ? 6 HELX_P HELX_P4 AA4 VAL A 80 ? SER A 84 ? VAL A 69 SER A 73 5 ? 5 HELX_P HELX_P5 AA5 PRO A 87 ? HIS A 93 ? PRO A 76 HIS A 82 5 ? 7 HELX_P HELX_P6 AA6 ASP A 94 ? ALA A 99 ? ASP A 83 ALA A 88 1 ? 6 HELX_P HELX_P7 AA7 LYS A 168 ? ASN A 171 ? LYS A 157 ASN A 160 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 78 C ? ? ? 1_555 A PIA 79 N1 ? ? A LEU 65 A PIA 68 1_555 ? ? ? ? ? ? ? 1.429 ? ? covale2 covale both ? A PIA 79 C3 ? ? ? 1_555 A VAL 80 N ? ? A PIA 68 A VAL 69 1_555 ? ? ? ? ? ? ? 1.431 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 100 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 89 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 101 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 90 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.69 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 26 ? VAL A 36 ? VAL A 13 VAL A 23 AA1 2 HIS A 39 ? ASP A 50 ? HIS A 26 ASP A 37 AA1 3 LYS A 55 ? CYS A 62 ? LYS A 42 CYS A 49 AA1 4 HIS A 229 ? ALA A 239 ? HIS A 218 ALA A 228 AA1 5 HIS A 211 ? SER A 220 ? HIS A 200 SER A 209 AA1 6 HIS A 160 ? ASP A 167 ? HIS A 149 ASP A 156 AA1 7 GLY A 172 ? ASN A 182 ? GLY A 161 ASN A 171 AA1 8 VAL A 188 ? PRO A 199 ? VAL A 177 PRO A 188 AA1 9 TYR A 104 ? PHE A 112 ? TYR A 93 PHE A 101 AA1 10 ASN A 117 ? GLU A 127 ? ASN A 106 GLU A 116 AA1 11 THR A 130 ? ILE A 140 ? THR A 119 ILE A 129 AA1 12 VAL A 26 ? VAL A 36 ? VAL A 13 VAL A 23 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 30 ? N VAL A 17 O GLY A 45 ? O GLY A 32 AA1 2 3 N ASP A 50 ? N ASP A 37 O LYS A 55 ? O LYS A 42 AA1 3 4 N LEU A 58 ? N LEU A 45 O LEU A 232 ? O LEU A 221 AA1 4 5 O ALA A 239 ? O ALA A 228 N TYR A 212 ? N TYR A 201 AA1 5 6 O HIS A 211 ? O HIS A 200 N ILE A 164 ? N ILE A 153 AA1 6 7 N ASP A 167 ? N ASP A 156 O GLY A 172 ? O GLY A 161 AA1 7 8 N PHE A 177 ? N PHE A 166 O HIS A 193 ? O HIS A 182 AA1 8 9 O THR A 198 ? O THR A 187 N VAL A 105 ? N VAL A 94 AA1 9 10 N ILE A 110 ? N ILE A 99 O TYR A 118 ? O TYR A 107 AA1 10 11 N LYS A 125 ? N LYS A 114 O VAL A 132 ? O VAL A 121 AA1 11 12 O GLY A 139 ? O GLY A 128 N ASP A 35 ? N ASP A 22 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 181 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 401 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A -4 ? ? -161.86 106.14 2 1 ASP A 104 ? ? -150.47 -155.77 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A PIA 79 A PIA 68 ? SER chromophore 2 A PIA 79 A PIA 68 ? TYR chromophore 3 A PIA 79 A PIA 68 ? GLY chromophore # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # _pdbx_entry_details.entry_id 8AHA _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -12 ? A MET 1 2 1 Y 1 A ARG -11 ? A ARG 2 3 1 Y 1 A GLY -10 ? A GLY 3 4 1 Y 1 A SER -9 ? A SER 4 5 1 Y 1 A HIS -8 ? A HIS 5 6 1 Y 1 A HIS -7 ? A HIS 6 7 1 Y 1 A MET 234 ? A MET 245 8 1 Y 1 A ASP 235 ? A ASP 246 9 1 Y 1 A GLU 236 ? A GLU 247 10 1 Y 1 A LEU 237 ? A LEU 248 11 1 Y 1 A TYR 238 ? A TYR 249 12 1 Y 1 A LYS 239 ? A LYS 250 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PIA N1 N N N 273 PIA CA1 C N S 274 PIA CB1 C N N 275 PIA C1 C N N 276 PIA N2 N N N 277 PIA N3 N N N 278 PIA C2 C N N 279 PIA O2 O N N 280 PIA CA2 C N N 281 PIA CA3 C N N 282 PIA C3 C N N 283 PIA O3 O N N 284 PIA CB2 C N N 285 PIA CG2 C Y N 286 PIA CD1 C Y N 287 PIA CD2 C Y N 288 PIA CE1 C Y N 289 PIA CE2 C Y N 290 PIA CZ C Y N 291 PIA OH O N N 292 PIA OXT O N N 293 PIA H H N N 294 PIA H2 H N N 295 PIA HA1 H N N 296 PIA HB11 H N N 297 PIA HB12 H N N 298 PIA HB13 H N N 299 PIA HA31 H N N 300 PIA HA32 H N N 301 PIA HB2 H N N 302 PIA HD1 H N N 303 PIA HD2 H N N 304 PIA HE1 H N N 305 PIA HE2 H N N 306 PIA HH H N N 307 PIA HXT H N N 308 PRO N N N N 309 PRO CA C N S 310 PRO C C N N 311 PRO O O N N 312 PRO CB C N N 313 PRO CG C N N 314 PRO CD C N N 315 PRO OXT O N N 316 PRO H H N N 317 PRO HA H N N 318 PRO HB2 H N N 319 PRO HB3 H N N 320 PRO HG2 H N N 321 PRO HG3 H N N 322 PRO HD2 H N N 323 PRO HD3 H N N 324 PRO HXT H N N 325 SER N N N N 326 SER CA C N S 327 SER C C N N 328 SER O O N N 329 SER CB C N N 330 SER OG O N N 331 SER OXT O N N 332 SER H H N N 333 SER H2 H N N 334 SER HA H N N 335 SER HB2 H N N 336 SER HB3 H N N 337 SER HG H N N 338 SER HXT H N N 339 SO4 S S N N 340 SO4 O1 O N N 341 SO4 O2 O N N 342 SO4 O3 O N N 343 SO4 O4 O N N 344 THR N N N N 345 THR CA C N S 346 THR C C N N 347 THR O O N N 348 THR CB C N R 349 THR OG1 O N N 350 THR CG2 C N N 351 THR OXT O N N 352 THR H H N N 353 THR H2 H N N 354 THR HA H N N 355 THR HB H N N 356 THR HG1 H N N 357 THR HG21 H N N 358 THR HG22 H N N 359 THR HG23 H N N 360 THR HXT H N N 361 TRP N N N N 362 TRP CA C N S 363 TRP C C N N 364 TRP O O N N 365 TRP CB C N N 366 TRP CG C Y N 367 TRP CD1 C Y N 368 TRP CD2 C Y N 369 TRP NE1 N Y N 370 TRP CE2 C Y N 371 TRP CE3 C Y N 372 TRP CZ2 C Y N 373 TRP CZ3 C Y N 374 TRP CH2 C Y N 375 TRP OXT O N N 376 TRP H H N N 377 TRP H2 H N N 378 TRP HA H N N 379 TRP HB2 H N N 380 TRP HB3 H N N 381 TRP HD1 H N N 382 TRP HE1 H N N 383 TRP HE3 H N N 384 TRP HZ2 H N N 385 TRP HZ3 H N N 386 TRP HH2 H N N 387 TRP HXT H N N 388 TYR N N N N 389 TYR CA C N S 390 TYR C C N N 391 TYR O O N N 392 TYR CB C N N 393 TYR CG C Y N 394 TYR CD1 C Y N 395 TYR CD2 C Y N 396 TYR CE1 C Y N 397 TYR CE2 C Y N 398 TYR CZ C Y N 399 TYR OH O N N 400 TYR OXT O N N 401 TYR H H N N 402 TYR H2 H N N 403 TYR HA H N N 404 TYR HB2 H N N 405 TYR HB3 H N N 406 TYR HD1 H N N 407 TYR HD2 H N N 408 TYR HE1 H N N 409 TYR HE2 H N N 410 TYR HH H N N 411 TYR HXT H N N 412 VAL N N N N 413 VAL CA C N S 414 VAL C C N N 415 VAL O O N N 416 VAL CB C N N 417 VAL CG1 C N N 418 VAL CG2 C N N 419 VAL OXT O N N 420 VAL H H N N 421 VAL H2 H N N 422 VAL HA H N N 423 VAL HB H N N 424 VAL HG11 H N N 425 VAL HG12 H N N 426 VAL HG13 H N N 427 VAL HG21 H N N 428 VAL HG22 H N N 429 VAL HG23 H N N 430 VAL HXT H N N 431 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PIA N1 CA1 sing N N 260 PIA N1 H sing N N 261 PIA N1 H2 sing N N 262 PIA CA1 CB1 sing N N 263 PIA CA1 C1 sing N N 264 PIA CA1 HA1 sing N N 265 PIA CB1 HB11 sing N N 266 PIA CB1 HB12 sing N N 267 PIA CB1 HB13 sing N N 268 PIA C1 N2 doub N N 269 PIA C1 N3 sing N N 270 PIA N2 CA2 sing N N 271 PIA N3 C2 sing N N 272 PIA N3 CA3 sing N N 273 PIA C2 O2 doub N N 274 PIA C2 CA2 sing N N 275 PIA CA2 CB2 doub N Z 276 PIA CA3 C3 sing N N 277 PIA CA3 HA31 sing N N 278 PIA CA3 HA32 sing N N 279 PIA C3 O3 doub N N 280 PIA C3 OXT sing N N 281 PIA CB2 CG2 sing N N 282 PIA CB2 HB2 sing N N 283 PIA CG2 CD1 doub Y N 284 PIA CG2 CD2 sing Y N 285 PIA CD1 CE1 sing Y N 286 PIA CD1 HD1 sing N N 287 PIA CD2 CE2 doub Y N 288 PIA CD2 HD2 sing N N 289 PIA CE1 CZ doub Y N 290 PIA CE1 HE1 sing N N 291 PIA CE2 CZ sing Y N 292 PIA CE2 HE2 sing N N 293 PIA CZ OH sing N N 294 PIA OH HH sing N N 295 PIA OXT HXT sing N N 296 PRO N CA sing N N 297 PRO N CD sing N N 298 PRO N H sing N N 299 PRO CA C sing N N 300 PRO CA CB sing N N 301 PRO CA HA sing N N 302 PRO C O doub N N 303 PRO C OXT sing N N 304 PRO CB CG sing N N 305 PRO CB HB2 sing N N 306 PRO CB HB3 sing N N 307 PRO CG CD sing N N 308 PRO CG HG2 sing N N 309 PRO CG HG3 sing N N 310 PRO CD HD2 sing N N 311 PRO CD HD3 sing N N 312 PRO OXT HXT sing N N 313 SER N CA sing N N 314 SER N H sing N N 315 SER N H2 sing N N 316 SER CA C sing N N 317 SER CA CB sing N N 318 SER CA HA sing N N 319 SER C O doub N N 320 SER C OXT sing N N 321 SER CB OG sing N N 322 SER CB HB2 sing N N 323 SER CB HB3 sing N N 324 SER OG HG sing N N 325 SER OXT HXT sing N N 326 SO4 S O1 doub N N 327 SO4 S O2 doub N N 328 SO4 S O3 sing N N 329 SO4 S O4 sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # _pdbx_audit_support.funding_organization 'Agence Nationale de la Recherche (ANR)' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ANR-17-CE11-0047-01 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id PIA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id PIA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5DTX _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 8AHA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019084 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016460 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013970 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_