data_8ALL # _entry.id 8ALL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.368 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8ALL pdb_00008all 10.2210/pdb8all/pdb WWPDB D_1292124590 ? ? BMRB 34744 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of holo-acp' _pdbx_database_related.db_id 34744 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8ALL _pdbx_database_status.recvd_initial_deposition_date 2022-08-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Collin, S.' 1 ? 'Weissman, K.J.' 2 ? 'Chagot, B.' 3 ? 'Gruez, A.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 1327 _citation.page_last 1327 _citation.title 'Decrypting the programming of beta-methylation in virginiamycin M biosynthesis.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-023-36974-3 _citation.pdbx_database_id_PubMed 36899003 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Collin, S.' 1 0000-0002-8565-8244 primary 'Cox, R.J.' 2 0000-0002-1844-0157 primary 'Paris, C.' 3 0000-0001-8673-3130 primary 'Jacob, C.' 4 0000-0001-8522-2865 primary 'Chagot, B.' 5 0000-0002-9153-0060 primary 'Weissman, K.J.' 6 0000-0002-3012-2960 primary 'Gruez, A.' 7 0000-0002-5828-5526 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hybrid non ribosomal peptide synthetase-polyketide synthase' 8938.062 1 ? ? ? ? 2 non-polymer syn "4'-PHOSPHOPANTETHEINE" 358.348 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGSMYGEAVTEQLSRLVAGFVPDAAGSVDPDRTLLEHGIDSINLMNLRFEITERFGRTLPLQLLSESTVPVLAAHLSAD RAH ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSMYGEAVTEQLSRLVAGFVPDAAGSVDPDRTLLEHGIDSINLMNLRFEITERFGRTLPLQLLSESTVPVLAAHLSAD RAH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 TYR n 1 7 GLY n 1 8 GLU n 1 9 ALA n 1 10 VAL n 1 11 THR n 1 12 GLU n 1 13 GLN n 1 14 LEU n 1 15 SER n 1 16 ARG n 1 17 LEU n 1 18 VAL n 1 19 ALA n 1 20 GLY n 1 21 PHE n 1 22 VAL n 1 23 PRO n 1 24 ASP n 1 25 ALA n 1 26 ALA n 1 27 GLY n 1 28 SER n 1 29 VAL n 1 30 ASP n 1 31 PRO n 1 32 ASP n 1 33 ARG n 1 34 THR n 1 35 LEU n 1 36 LEU n 1 37 GLU n 1 38 HIS n 1 39 GLY n 1 40 ILE n 1 41 ASP n 1 42 SER n 1 43 ILE n 1 44 ASN n 1 45 LEU n 1 46 MET n 1 47 ASN n 1 48 LEU n 1 49 ARG n 1 50 PHE n 1 51 GLU n 1 52 ILE n 1 53 THR n 1 54 GLU n 1 55 ARG n 1 56 PHE n 1 57 GLY n 1 58 ARG n 1 59 THR n 1 60 LEU n 1 61 PRO n 1 62 LEU n 1 63 GLN n 1 64 LEU n 1 65 LEU n 1 66 SER n 1 67 GLU n 1 68 SER n 1 69 THR n 1 70 VAL n 1 71 PRO n 1 72 VAL n 1 73 LEU n 1 74 ALA n 1 75 ALA n 1 76 HIS n 1 77 LEU n 1 78 SER n 1 79 ALA n 1 80 ASP n 1 81 ARG n 1 82 ALA n 1 83 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 83 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene virG _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces virginiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1961 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A4PHM4_STRVG _struct_ref.pdbx_db_accession A4PHM4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GEAVTEQLSRLVAGFVPDAAGSVDPDRTLLEHGIDSINLMNLRFEITERFGRTLPLQLLSESTVPVLAAHLSADRAH _struct_ref.pdbx_align_begin 1128 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8ALL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A4PHM4 _struct_ref_seq.db_align_beg 1128 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1204 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1874 _struct_ref_seq.pdbx_auth_seq_align_end 1950 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8ALL GLY A 1 ? UNP A4PHM4 ? ? 'expression tag' -6 1 1 8ALL PRO A 2 ? UNP A4PHM4 ? ? 'expression tag' -5 2 1 8ALL GLY A 3 ? UNP A4PHM4 ? ? 'expression tag' -4 3 1 8ALL SER A 4 ? UNP A4PHM4 ? ? 'expression tag' -3 4 1 8ALL MET A 5 ? UNP A4PHM4 ? ? 'expression tag' -2 5 1 8ALL TYR A 6 ? UNP A4PHM4 ? ? 'expression tag' -1 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PNS non-polymer . "4'-PHOSPHOPANTETHEINE" ? 'C11 H23 N2 O7 P S' 358.348 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC' 1 isotropic 2 1 1 '2D 1H-15N HSQC' 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '3D HNCA' 1 isotropic 11 1 1 '3D 1H-15N NOESY' 1 isotropic 10 1 1 '3D 1H-13C NOESY' 1 isotropic 9 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 8 1 1 '3D HCCH-TOCSY' 1 isotropic 7 1 1 '3D CCH-TOCSY' 1 isotropic 6 1 1 '3D HNHA' 1 isotropic 15 1 1 '2D 1H(C12 N14) -1H(C12 N14) TOCSY' 1 isotropic 14 1 1 '2D 1H-1H(C12 N14) NOESY' 1 isotropic 13 1 1 '2D 1H(C12 N14)-1H(C12 N14) NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.6 mM [U-100% 13C; U-100% 15N] Hybrid polyketide synthase-non ribosomal peptide synthetase ACP7, 100 mM sodium phosphate, 1 mM TCEP, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 8ALL _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 8ALL _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8ALL _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 4 'peak picking' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8ALL _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8ALL _struct.title 'NMR structure of holo-acp' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8ALL _struct_keywords.text 'Acyl carrier protein, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 9 ? ALA A 19 ? ALA A 1876 ALA A 1886 1 ? 11 HELX_P HELX_P2 AA2 ASP A 41 ? GLY A 57 ? ASP A 1908 GLY A 1924 1 ? 17 HELX_P HELX_P3 AA3 PRO A 61 ? SER A 68 ? PRO A 1928 SER A 1935 1 ? 8 HELX_P HELX_P4 AA4 THR A 69 ? SER A 78 ? THR A 1936 SER A 1945 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 42 _struct_conn.ptnr1_label_atom_id OG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id PNS _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id P24 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 1909 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PNS _struct_conn.ptnr2_auth_seq_id 2001 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.596 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 81 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 1948 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ALA _struct_mon_prot_cis.pdbx_label_seq_id_2 82 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ALA _struct_mon_prot_cis.pdbx_auth_seq_id_2 1949 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 12 _struct_mon_prot_cis.pdbx_omega_angle -4.78 # _atom_sites.entry_id 8ALL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -6 -6 GLY GLY A . n A 1 2 PRO 2 -5 -5 PRO PRO A . n A 1 3 GLY 3 -4 -4 GLY GLY A . n A 1 4 SER 4 -3 -3 SER SER A . n A 1 5 MET 5 -2 -2 MET MET A . n A 1 6 TYR 6 -1 -1 TYR TYR A . n A 1 7 GLY 7 1874 1874 GLY GLY A . n A 1 8 GLU 8 1875 1875 GLU GLU A . n A 1 9 ALA 9 1876 1876 ALA ALA A . n A 1 10 VAL 10 1877 1877 VAL VAL A . n A 1 11 THR 11 1878 1878 THR THR A . n A 1 12 GLU 12 1879 1879 GLU GLU A . n A 1 13 GLN 13 1880 1880 GLN GLN A . n A 1 14 LEU 14 1881 1881 LEU LEU A . n A 1 15 SER 15 1882 1882 SER SER A . n A 1 16 ARG 16 1883 1883 ARG ARG A . n A 1 17 LEU 17 1884 1884 LEU LEU A . n A 1 18 VAL 18 1885 1885 VAL VAL A . n A 1 19 ALA 19 1886 1886 ALA ALA A . n A 1 20 GLY 20 1887 1887 GLY GLY A . n A 1 21 PHE 21 1888 1888 PHE PHE A . n A 1 22 VAL 22 1889 1889 VAL VAL A . n A 1 23 PRO 23 1890 1890 PRO PRO A . n A 1 24 ASP 24 1891 1891 ASP ASP A . n A 1 25 ALA 25 1892 1892 ALA ALA A . n A 1 26 ALA 26 1893 1893 ALA ALA A . n A 1 27 GLY 27 1894 1894 GLY GLY A . n A 1 28 SER 28 1895 1895 SER SER A . n A 1 29 VAL 29 1896 1896 VAL VAL A . n A 1 30 ASP 30 1897 1897 ASP ASP A . n A 1 31 PRO 31 1898 1898 PRO PRO A . n A 1 32 ASP 32 1899 1899 ASP ASP A . n A 1 33 ARG 33 1900 1900 ARG ARG A . n A 1 34 THR 34 1901 1901 THR THR A . n A 1 35 LEU 35 1902 1902 LEU LEU A . n A 1 36 LEU 36 1903 1903 LEU LEU A . n A 1 37 GLU 37 1904 1904 GLU GLU A . n A 1 38 HIS 38 1905 1905 HIS HIS A . n A 1 39 GLY 39 1906 1906 GLY GLY A . n A 1 40 ILE 40 1907 1907 ILE ILE A . n A 1 41 ASP 41 1908 1908 ASP ASP A . n A 1 42 SER 42 1909 1909 SER SER A . n A 1 43 ILE 43 1910 1910 ILE ILE A . n A 1 44 ASN 44 1911 1911 ASN ASN A . n A 1 45 LEU 45 1912 1912 LEU LEU A . n A 1 46 MET 46 1913 1913 MET MET A . n A 1 47 ASN 47 1914 1914 ASN ASN A . n A 1 48 LEU 48 1915 1915 LEU LEU A . n A 1 49 ARG 49 1916 1916 ARG ARG A . n A 1 50 PHE 50 1917 1917 PHE PHE A . n A 1 51 GLU 51 1918 1918 GLU GLU A . n A 1 52 ILE 52 1919 1919 ILE ILE A . n A 1 53 THR 53 1920 1920 THR THR A . n A 1 54 GLU 54 1921 1921 GLU GLU A . n A 1 55 ARG 55 1922 1922 ARG ARG A . n A 1 56 PHE 56 1923 1923 PHE PHE A . n A 1 57 GLY 57 1924 1924 GLY GLY A . n A 1 58 ARG 58 1925 1925 ARG ARG A . n A 1 59 THR 59 1926 1926 THR THR A . n A 1 60 LEU 60 1927 1927 LEU LEU A . n A 1 61 PRO 61 1928 1928 PRO PRO A . n A 1 62 LEU 62 1929 1929 LEU LEU A . n A 1 63 GLN 63 1930 1930 GLN GLN A . n A 1 64 LEU 64 1931 1931 LEU LEU A . n A 1 65 LEU 65 1932 1932 LEU LEU A . n A 1 66 SER 66 1933 1933 SER SER A . n A 1 67 GLU 67 1934 1934 GLU GLU A . n A 1 68 SER 68 1935 1935 SER SER A . n A 1 69 THR 69 1936 1936 THR THR A . n A 1 70 VAL 70 1937 1937 VAL VAL A . n A 1 71 PRO 71 1938 1938 PRO PRO A . n A 1 72 VAL 72 1939 1939 VAL VAL A . n A 1 73 LEU 73 1940 1940 LEU LEU A . n A 1 74 ALA 74 1941 1941 ALA ALA A . n A 1 75 ALA 75 1942 1942 ALA ALA A . n A 1 76 HIS 76 1943 1943 HIS HIS A . n A 1 77 LEU 77 1944 1944 LEU LEU A . n A 1 78 SER 78 1945 1945 SER SER A . n A 1 79 ALA 79 1946 1946 ALA ALA A . n A 1 80 ASP 80 1947 1947 ASP ASP A . n A 1 81 ARG 81 1948 1948 ARG ARG A . n A 1 82 ALA 82 1949 1949 ALA ALA A . n A 1 83 HIS 83 1950 1950 HIS HIS A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email kira.weissman@univ-lorraine.fr _pdbx_contact_author.name_first Kira _pdbx_contact_author.name_last Weissman _pdbx_contact_author.name_mi J _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3012-2960 # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id PNS _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 2001 _pdbx_nonpoly_scheme.auth_seq_num 1951 _pdbx_nonpoly_scheme.pdb_mon_id PNS _pdbx_nonpoly_scheme.auth_mon_id PNS _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 290 ? 1 MORE -4 ? 1 'SSA (A^2)' 5890 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-22 2 'Structure model' 1 1 2023-03-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_entry_details.entry_id 8ALL _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Hybrid polyketide synthase-non ribosomal peptide synthetase ACP7' 1.6 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate' 100 ? mM 'natural abundance' 1 TCEP 1 ? mM 'natural abundance' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 1900 ? ? CZ A ARG 1900 ? ? NH1 A ARG 1900 ? ? 123.95 120.30 3.65 0.50 N 2 1 NE A ARG 1925 ? ? CZ A ARG 1925 ? ? NH1 A ARG 1925 ? ? 124.14 120.30 3.84 0.50 N 3 3 NE A ARG 1900 ? ? CZ A ARG 1900 ? ? NH1 A ARG 1900 ? ? 123.66 120.30 3.36 0.50 N 4 6 NE A ARG 1900 ? ? CZ A ARG 1900 ? ? NH1 A ARG 1900 ? ? 123.87 120.30 3.57 0.50 N 5 7 NE A ARG 1900 ? ? CZ A ARG 1900 ? ? NH1 A ARG 1900 ? ? 123.46 120.30 3.16 0.50 N 6 7 NE A ARG 1925 ? ? CZ A ARG 1925 ? ? NH1 A ARG 1925 ? ? 123.48 120.30 3.18 0.50 N 7 8 NE A ARG 1900 ? ? CZ A ARG 1900 ? ? NH1 A ARG 1900 ? ? 123.45 120.30 3.15 0.50 N 8 8 NE A ARG 1922 ? ? CZ A ARG 1922 ? ? NH2 A ARG 1922 ? ? 123.41 120.30 3.11 0.50 N 9 9 NE A ARG 1883 ? ? CZ A ARG 1883 ? ? NH1 A ARG 1883 ? ? 123.59 120.30 3.29 0.50 N 10 9 NE A ARG 1900 ? ? CZ A ARG 1900 ? ? NH1 A ARG 1900 ? ? 123.68 120.30 3.38 0.50 N 11 9 NE A ARG 1925 ? ? CZ A ARG 1925 ? ? NH1 A ARG 1925 ? ? 123.77 120.30 3.47 0.50 N 12 11 NE A ARG 1900 ? ? CZ A ARG 1900 ? ? NH1 A ARG 1900 ? ? 124.42 120.30 4.12 0.50 N 13 11 NE A ARG 1925 ? ? CZ A ARG 1925 ? ? NH1 A ARG 1925 ? ? 123.50 120.30 3.20 0.50 N 14 13 NE A ARG 1900 ? ? CZ A ARG 1900 ? ? NH1 A ARG 1900 ? ? 123.68 120.30 3.38 0.50 N 15 14 NE A ARG 1883 ? ? CZ A ARG 1883 ? ? NH1 A ARG 1883 ? ? 123.62 120.30 3.32 0.50 N 16 14 NE A ARG 1900 ? ? CZ A ARG 1900 ? ? NH2 A ARG 1900 ? ? 124.05 120.30 3.75 0.50 N 17 14 NE A ARG 1922 ? ? CZ A ARG 1922 ? ? NH1 A ARG 1922 ? ? 123.77 120.30 3.47 0.50 N 18 14 NE A ARG 1925 ? ? CZ A ARG 1925 ? ? NH1 A ARG 1925 ? ? 124.79 120.30 4.49 0.50 N 19 15 NE A ARG 1900 ? ? CZ A ARG 1900 ? ? NH1 A ARG 1900 ? ? 123.43 120.30 3.13 0.50 N 20 15 NE A ARG 1922 ? ? CZ A ARG 1922 ? ? NH1 A ARG 1922 ? ? 123.70 120.30 3.40 0.50 N 21 16 NE A ARG 1925 ? ? CZ A ARG 1925 ? ? NH1 A ARG 1925 ? ? 123.46 120.30 3.16 0.50 N 22 17 NE A ARG 1922 ? ? CZ A ARG 1922 ? ? NH1 A ARG 1922 ? ? 123.81 120.30 3.51 0.50 N 23 17 NE A ARG 1925 ? ? CZ A ARG 1925 ? ? NH1 A ARG 1925 ? ? 123.45 120.30 3.15 0.50 N 24 17 NE A ARG 1948 ? ? CZ A ARG 1948 ? ? NH1 A ARG 1948 ? ? 123.33 120.30 3.03 0.50 N 25 19 NE A ARG 1948 ? ? CZ A ARG 1948 ? ? NH1 A ARG 1948 ? ? 123.47 120.30 3.17 0.50 N 26 20 NE A ARG 1883 ? ? CZ A ARG 1883 ? ? NH1 A ARG 1883 ? ? 123.53 120.30 3.23 0.50 N 27 20 NE A ARG 1900 ? ? CZ A ARG 1900 ? ? NH1 A ARG 1900 ? ? 123.81 120.30 3.51 0.50 N 28 20 NE A ARG 1948 ? ? CZ A ARG 1948 ? ? NH1 A ARG 1948 ? ? 123.62 120.30 3.32 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 1892 ? ? -65.89 0.04 2 2 SER A -3 ? ? 62.55 -4.00 3 2 ALA A 1892 ? ? -66.21 11.08 4 3 TYR A -1 ? ? -100.77 69.74 5 3 ALA A 1892 ? ? -66.89 7.15 6 3 ALA A 1946 ? ? 55.99 14.33 7 4 ALA A 1892 ? ? -66.21 2.55 8 5 ALA A 1892 ? ? -73.42 42.66 9 5 THR A 1926 ? ? 65.17 128.27 10 6 GLU A 1875 ? ? 60.79 167.23 11 6 ALA A 1892 ? ? -71.20 31.27 12 7 GLU A 1875 ? ? 64.73 143.19 13 8 SER A -3 ? ? -147.87 52.35 14 8 ALA A 1892 ? ? -73.27 39.44 15 8 ALA A 1946 ? ? -74.42 38.27 16 9 ALA A 1892 ? ? -69.84 29.24 17 9 ALA A 1949 ? ? -146.79 27.09 18 11 MET A -2 ? ? 56.94 -7.32 19 11 ALA A 1892 ? ? -68.29 7.37 20 12 ALA A 1892 ? ? -72.72 37.54 21 13 ALA A 1892 ? ? -73.09 41.94 22 13 ALA A 1946 ? ? 62.93 153.41 23 14 ALA A 1892 ? ? -65.78 8.64 24 14 ALA A 1949 ? ? -80.68 47.27 25 15 ALA A 1892 ? ? -70.11 27.01 26 15 ARG A 1948 ? ? 59.93 -25.28 27 16 ALA A 1892 ? ? -71.24 26.90 28 17 ALA A 1892 ? ? -68.54 26.27 29 17 ASP A 1947 ? ? -48.68 151.12 30 18 ALA A 1892 ? ? 60.51 -39.82 31 19 ALA A 1892 ? ? -71.24 28.07 32 19 SER A 1945 ? ? -82.02 37.55 33 20 SER A -3 ? ? 60.62 167.68 34 20 ALA A 1892 ? ? -72.65 37.33 35 20 ALA A 1949 ? ? -74.61 44.66 # _pdbx_audit_support.funding_organization 'Agence Nationale de la Recherche (ANR)' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id PNS _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id PNS _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name "4'-PHOSPHOPANTETHEINE" _pdbx_entity_nonpoly.comp_id PNS # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #