data_8AMP # _entry.id 8AMP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8AMP pdb_00008amp 10.2210/pdb8amp/pdb WWPDB D_1292124511 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-02-15 2 'Structure model' 1 1 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8AMP _pdbx_database_status.recvd_initial_deposition_date 2022-08-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 4 _pdbx_contact_author.email borshchevskiy.vi@phystech.edu _pdbx_contact_author.name_first Valentin _pdbx_contact_author.name_last Borshchevskiy _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4398-9712 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bukhdruker, S.' 1 ? 'Kavaleuski, A.' 2 ? 'Marin, E.' 3 ? 'Kapranov, I.' 4 ? 'Mishin, A.' 5 ? 'Gilep, A.' 6 ? 'Strushkevich, N.' 7 ? 'Borshchevskiy, V.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Front Mol Biosci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2296-889X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 1100032 _citation.page_last 1100032 _citation.title 'Structural insights into 3Fe-4S ferredoxins diversity in M. tuberculosis highlighted by a first redox complex with P450.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fmolb.2022.1100032 _citation.pdbx_database_id_PubMed 36699703 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gilep, A.' 1 ? primary 'Varaksa, T.' 2 ? primary 'Bukhdruker, S.' 3 ? primary 'Kavaleuski, A.' 4 ? primary 'Ryzhykau, Y.' 5 ? primary 'Smolskaya, S.' 6 ? primary 'Sushko, T.' 7 ? primary 'Tsumoto, K.' 8 ? primary 'Grabovec, I.' 9 ? primary 'Kapranov, I.' 10 ? primary 'Okhrimenko, I.' 11 ? primary 'Marin, E.' 12 ? primary 'Shevtsov, M.' 13 ? primary 'Mishin, A.' 14 ? primary 'Kovalev, K.' 15 ? primary 'Kuklin, A.' 16 ? primary 'Gordeliy, V.' 17 ? primary 'Kaluzhskiy, L.' 18 ? primary 'Gnedenko, O.' 19 ? primary 'Yablokov, E.' 20 ? primary 'Ivanov, A.' 21 ? primary 'Borshchevskiy, V.' 22 ? primary 'Strushkevich, N.' 23 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Possible ferredoxin' 8519.586 1 ? ? ? ? 2 non-polymer syn 'FE3-S4 CLUSTER' 295.795 1 ? ? ? ? 3 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 4 water nat water 18.015 5 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGYRVEADRDLCQGHAMCELEAPEYFRVPKRGQVEILDPEPPEEARGVIKHAVWACPTQALSIRETGEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MGYRVEADRDLCQGHAMCELEAPEYFRVPKRGQVEILDPEPPEEARGVIKHAVWACPTQALSIRETGEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE3-S4 CLUSTER' F3S 3 'FE (III) ION' FE 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 TYR n 1 4 ARG n 1 5 VAL n 1 6 GLU n 1 7 ALA n 1 8 ASP n 1 9 ARG n 1 10 ASP n 1 11 LEU n 1 12 CYS n 1 13 GLN n 1 14 GLY n 1 15 HIS n 1 16 ALA n 1 17 MET n 1 18 CYS n 1 19 GLU n 1 20 LEU n 1 21 GLU n 1 22 ALA n 1 23 PRO n 1 24 GLU n 1 25 TYR n 1 26 PHE n 1 27 ARG n 1 28 VAL n 1 29 PRO n 1 30 LYS n 1 31 ARG n 1 32 GLY n 1 33 GLN n 1 34 VAL n 1 35 GLU n 1 36 ILE n 1 37 LEU n 1 38 ASP n 1 39 PRO n 1 40 GLU n 1 41 PRO n 1 42 PRO n 1 43 GLU n 1 44 GLU n 1 45 ALA n 1 46 ARG n 1 47 GLY n 1 48 VAL n 1 49 ILE n 1 50 LYS n 1 51 HIS n 1 52 ALA n 1 53 VAL n 1 54 TRP n 1 55 ALA n 1 56 CYS n 1 57 PRO n 1 58 THR n 1 59 GLN n 1 60 ALA n 1 61 LEU n 1 62 SER n 1 63 ILE n 1 64 ARG n 1 65 GLU n 1 66 THR n 1 67 GLY n 1 68 GLU n 1 69 HIS n 1 70 HIS n 1 71 HIS n 1 72 HIS n 1 73 HIS n 1 74 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 74 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Rv0763c _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 F3S non-polymer . 'FE3-S4 CLUSTER' ? 'Fe3 S4' 295.795 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLY 67 67 ? ? ? A . n A 1 68 GLU 68 68 ? ? ? A . n A 1 69 HIS 69 69 ? ? ? A . n A 1 70 HIS 70 70 ? ? ? A . n A 1 71 HIS 71 71 ? ? ? A . n A 1 72 HIS 72 72 ? ? ? A . n A 1 73 HIS 73 73 ? ? ? A . n A 1 74 HIS 74 74 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 F3S 1 101 101 F3S F3S A . C 3 FE 1 102 201 FE FE A . D 4 HOH 1 201 205 HOH HOH A . D 4 HOH 2 202 204 HOH HOH A . D 4 HOH 3 203 203 HOH HOH A . D 4 HOH 4 204 206 HOH HOH A . D 4 HOH 5 205 202 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 4 ? CG ? A ARG 4 CG 2 1 Y 1 A ARG 4 ? CD ? A ARG 4 CD 3 1 Y 1 A ARG 4 ? NE ? A ARG 4 NE 4 1 Y 1 A ARG 4 ? CZ ? A ARG 4 CZ 5 1 Y 1 A ARG 4 ? NH1 ? A ARG 4 NH1 6 1 Y 1 A ARG 4 ? NH2 ? A ARG 4 NH2 7 1 Y 1 A VAL 5 ? CG1 ? A VAL 5 CG1 8 1 Y 1 A ASP 8 ? CG ? A ASP 8 CG 9 1 Y 1 A ASP 8 ? OD1 ? A ASP 8 OD1 10 1 Y 1 A ASP 8 ? OD2 ? A ASP 8 OD2 11 1 Y 1 A ASP 10 ? CG ? A ASP 10 CG 12 1 Y 1 A ASP 10 ? OD1 ? A ASP 10 OD1 13 1 Y 1 A ASP 10 ? OD2 ? A ASP 10 OD2 14 1 Y 1 A LEU 11 ? CG ? A LEU 11 CG 15 1 Y 1 A LEU 11 ? CD1 ? A LEU 11 CD1 16 1 Y 1 A LEU 11 ? CD2 ? A LEU 11 CD2 17 1 Y 1 A LEU 20 ? CG ? A LEU 20 CG 18 1 Y 1 A LEU 20 ? CD1 ? A LEU 20 CD1 19 1 Y 1 A LEU 20 ? CD2 ? A LEU 20 CD2 20 1 Y 1 A GLU 24 ? CG ? A GLU 24 CG 21 1 Y 1 A GLU 24 ? CD ? A GLU 24 CD 22 1 Y 1 A GLU 24 ? OE1 ? A GLU 24 OE1 23 1 Y 1 A GLU 24 ? OE2 ? A GLU 24 OE2 24 1 Y 1 A ARG 27 ? CG ? A ARG 27 CG 25 1 Y 1 A ARG 27 ? CD ? A ARG 27 CD 26 1 Y 1 A ARG 27 ? NE ? A ARG 27 NE 27 1 Y 1 A ARG 27 ? CZ ? A ARG 27 CZ 28 1 Y 1 A ARG 27 ? NH1 ? A ARG 27 NH1 29 1 Y 1 A ARG 27 ? NH2 ? A ARG 27 NH2 30 1 Y 1 A LYS 30 ? CG ? A LYS 30 CG 31 1 Y 1 A LYS 30 ? CD ? A LYS 30 CD 32 1 Y 1 A LYS 30 ? CE ? A LYS 30 CE 33 1 Y 1 A LYS 30 ? NZ ? A LYS 30 NZ 34 1 Y 1 A ARG 31 ? CG ? A ARG 31 CG 35 1 Y 1 A ARG 31 ? CD ? A ARG 31 CD 36 1 Y 1 A ARG 31 ? NE ? A ARG 31 NE 37 1 Y 1 A ARG 31 ? CZ ? A ARG 31 CZ 38 1 Y 1 A ARG 31 ? NH1 ? A ARG 31 NH1 39 1 Y 1 A ARG 31 ? NH2 ? A ARG 31 NH2 40 1 Y 1 A LYS 50 ? CE ? A LYS 50 CE 41 1 Y 1 A LYS 50 ? NZ ? A LYS 50 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 20170615 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? '3.344 27-Apr-2022' 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MoRDa ? ? ? '1.4.09; 10.02.2022' 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8AMP _cell.details ? _cell.formula_units_Z ? _cell.length_a 46.959 _cell.length_a_esd ? _cell.length_b 46.959 _cell.length_b_esd ? _cell.length_c 162.674 _cell.length_c_esd ? _cell.volume 310660.801 _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8AMP _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ;R 3 2" ; _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8AMP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.03 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M MgCl2, 0.1 M Tris, 25% (w/v) PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-06-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.966 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.966 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 38.46 _reflns.entry_id 8AMP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 28.76 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4958 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.95 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.097 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.00 2.05 ? 0.93 ? ? ? ? 346 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.9 ? ? ? ? 2.801 ? ? 1 1 0.526 ? ? ? ? ? ? ? ? ? ? 2.05 2.11 ? 1.32 ? ? ? ? 361 99.4 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.8 ? ? ? ? 1.997 ? ? 2 1 0.687 ? ? ? ? ? ? ? ? ? ? 2.11 2.17 ? 1.62 ? ? ? ? 338 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.5 ? ? ? ? 1.621 ? ? 3 1 0.794 ? ? ? ? ? ? ? ? ? ? 2.17 2.24 ? 2.07 ? ? ? ? 339 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.1 ? ? ? ? 1.252 ? ? 4 1 0.814 ? ? ? ? ? ? ? ? ? ? 2.24 2.31 ? 2.60 ? ? ? ? 303 92.0 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.0 ? ? ? ? 0.976 ? ? 5 1 0.874 ? ? ? ? ? ? ? ? ? ? 2.31 2.39 ? 3.30 ? ? ? ? 319 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.6 ? ? ? ? 0.793 ? ? 6 1 0.923 ? ? ? ? ? ? ? ? ? ? 2.39 2.48 ? 4.27 ? ? ? ? 303 99.7 ? ? ? ? ? ? ? ? ? ? ? ? ? 10.3 ? ? ? ? 0.64 ? ? 7 1 0.951 ? ? ? ? ? ? ? ? ? ? 2.48 2.58 ? 5.38 ? ? ? ? 284 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.9 ? ? ? ? 0.463 ? ? 8 1 0.974 ? ? ? ? ? ? ? ? ? ? 2.58 2.70 ? 6.32 ? ? ? ? 281 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 10.0 ? ? ? ? 0.393 ? ? 9 1 0.982 ? ? ? ? ? ? ? ? ? ? 2.70 2.83 ? 10.00 ? ? ? ? 264 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.8 ? ? ? ? 0.222 ? ? 10 1 0.992 ? ? ? ? ? ? ? ? ? ? 2.83 2.98 ? 11.19 ? ? ? ? 249 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.6 ? ? ? ? 0.197 ? ? 11 1 0.992 ? ? ? ? ? ? ? ? ? ? 2.98 3.16 ? 13.10 ? ? ? ? 247 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.2 ? ? ? ? 0.140 ? ? 12 1 0.996 ? ? ? ? ? ? ? ? ? ? 3.16 3.38 ? 17.05 ? ? ? ? 234 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 8.7 ? ? ? ? 0.099 ? ? 13 1 0.997 ? ? ? ? ? ? ? ? ? ? 3.38 3.65 ? 23.14 ? ? ? ? 220 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.6 ? ? ? ? 0.071 ? ? 14 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.65 4.00 ? 27.87 ? ? ? ? 189 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.7 ? ? ? ? 0.063 ? ? 15 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.00 4.47 ? 32.87 ? ? ? ? 188 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.6 ? ? ? ? 0.056 ? ? 16 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.47 5.17 ? 33.15 ? ? ? ? 168 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 8.7 ? ? ? ? 0.053 ? ? 17 1 0.999 ? ? ? ? ? ? ? ? ? ? 5.17 6.33 ? 31.52 ? ? ? ? 133 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 7.9 ? ? ? ? 0.056 ? ? 18 1 0.999 ? ? ? ? ? ? ? ? ? ? 6.33 8.95 ? 35.29 ? ? ? ? 119 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 8.3 ? ? ? ? 0.051 ? ? 19 1 0.999 ? ? ? ? ? ? ? ? ? ? 8.95 28.76 ? 36.57 ? ? ? ? 73 96.1 ? ? ? ? ? ? ? ? ? ? ? ? ? 7.4 ? ? ? ? 0.051 ? ? 20 1 0.994 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 56.80 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8AMP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 28.76 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4119 _refine.ls_number_reflns_R_free 416 _refine.ls_number_reflns_R_work 3703 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 83.03 _refine.ls_percent_reflns_R_free 10.10 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2543 _refine.ls_R_factor_R_free 0.2910 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2503 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1VJW _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.4958 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2447 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 28.76 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 487 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 474 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.1220 ? 495 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 4.4138 ? 680 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 2.0938 ? 73 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0047 ? 91 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.0730 ? 171 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.00 2.29 . . 98 869 60.17 . . . 0.3601 . 0.3185 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.29 2.88 . . 146 1290 87.72 . . . 0.3454 . 0.3149 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.89 28.76 . . 172 1544 100.00 . . . 0.2651 . 0.2245 . . . . . . . . . . . # _struct.entry_id 8AMP _struct.title 'Crystal structure of M.tuberculosis ferredoxin Fdx' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8AMP _struct_keywords.text 'Ferredoxin, electron transport, tuberculosis, Rv0763c, CYP51' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P71820_MYCTU _struct_ref.pdbx_db_accession P71820 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MGYRVEADRDLCQGHAMCELEAPEYFRVPKRGQVEILDPEPPEEARGVIKHAVWACPTQALSIRETGE _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8AMP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P71820 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 68 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 68 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8AMP HIS A 69 ? UNP P71820 ? ? 'expression tag' 69 1 1 8AMP HIS A 70 ? UNP P71820 ? ? 'expression tag' 70 2 1 8AMP HIS A 71 ? UNP P71820 ? ? 'expression tag' 71 3 1 8AMP HIS A 72 ? UNP P71820 ? ? 'expression tag' 72 4 1 8AMP HIS A 73 ? UNP P71820 ? ? 'expression tag' 73 5 1 8AMP HIS A 74 ? UNP P71820 ? ? 'expression tag' 74 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 470 ? 1 MORE -27 ? 1 'SSA (A^2)' 3750 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 16 ? ALA A 22 ? ALA A 16 ALA A 22 1 ? 7 HELX_P HELX_P2 AA2 PRO A 42 ? GLU A 44 ? PRO A 42 GLU A 44 5 ? 3 HELX_P HELX_P3 AA3 ALA A 45 ? CYS A 56 ? ALA A 45 CYS A 56 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 12 SG ? ? ? 1_555 B F3S . FE4 ? ? A CYS 12 A F3S 101 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc2 metalc ? ? A CYS 18 SG ? ? ? 1_555 B F3S . FE3 ? ? A CYS 18 A F3S 101 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc3 metalc ? ? A HIS 51 NE2 ? ? ? 1_555 C FE . FE ? ? A HIS 51 A FE 102 1_555 ? ? ? ? ? ? ? 2.070 ? ? metalc4 metalc ? ? A HIS 51 NE2 ? ? ? 1_555 C FE . FE ? ? A HIS 51 A FE 102 2_455 ? ? ? ? ? ? ? 2.042 ? ? metalc5 metalc ? ? A CYS 56 SG ? ? ? 1_555 B F3S . FE1 ? ? A CYS 56 A F3S 101 1_555 ? ? ? ? ? ? ? 2.315 ? ? metalc6 metalc ? ? C FE . FE ? ? ? 1_555 D HOH . O ? ? A FE 102 A HOH 205 1_555 ? ? ? ? ? ? ? 2.309 ? ? metalc7 metalc ? ? C FE . FE ? ? ? 1_555 D HOH . O ? ? A FE 102 A HOH 205 2_455 ? ? ? ? ? ? ? 2.309 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 12 ? A CYS 12 ? 1_555 FE4 ? B F3S . ? A F3S 101 ? 1_555 S2 ? B F3S . ? A F3S 101 ? 1_555 114.8 ? 2 SG ? A CYS 12 ? A CYS 12 ? 1_555 FE4 ? B F3S . ? A F3S 101 ? 1_555 S3 ? B F3S . ? A F3S 101 ? 1_555 116.5 ? 3 S2 ? B F3S . ? A F3S 101 ? 1_555 FE4 ? B F3S . ? A F3S 101 ? 1_555 S3 ? B F3S . ? A F3S 101 ? 1_555 105.5 ? 4 SG ? A CYS 12 ? A CYS 12 ? 1_555 FE4 ? B F3S . ? A F3S 101 ? 1_555 S4 ? B F3S . ? A F3S 101 ? 1_555 101.7 ? 5 S2 ? B F3S . ? A F3S 101 ? 1_555 FE4 ? B F3S . ? A F3S 101 ? 1_555 S4 ? B F3S . ? A F3S 101 ? 1_555 111.1 ? 6 S3 ? B F3S . ? A F3S 101 ? 1_555 FE4 ? B F3S . ? A F3S 101 ? 1_555 S4 ? B F3S . ? A F3S 101 ? 1_555 107.0 ? 7 SG ? A CYS 18 ? A CYS 18 ? 1_555 FE3 ? B F3S . ? A F3S 101 ? 1_555 S1 ? B F3S . ? A F3S 101 ? 1_555 110.8 ? 8 SG ? A CYS 18 ? A CYS 18 ? 1_555 FE3 ? B F3S . ? A F3S 101 ? 1_555 S3 ? B F3S . ? A F3S 101 ? 1_555 120.1 ? 9 S1 ? B F3S . ? A F3S 101 ? 1_555 FE3 ? B F3S . ? A F3S 101 ? 1_555 S3 ? B F3S . ? A F3S 101 ? 1_555 105.4 ? 10 SG ? A CYS 18 ? A CYS 18 ? 1_555 FE3 ? B F3S . ? A F3S 101 ? 1_555 S4 ? B F3S . ? A F3S 101 ? 1_555 104.9 ? 11 S1 ? B F3S . ? A F3S 101 ? 1_555 FE3 ? B F3S . ? A F3S 101 ? 1_555 S4 ? B F3S . ? A F3S 101 ? 1_555 108.4 ? 12 S3 ? B F3S . ? A F3S 101 ? 1_555 FE3 ? B F3S . ? A F3S 101 ? 1_555 S4 ? B F3S . ? A F3S 101 ? 1_555 106.8 ? 13 NE2 ? A HIS 51 ? A HIS 51 ? 1_555 FE ? C FE . ? A FE 102 ? 1_555 NE2 ? A HIS 51 ? A HIS 51 ? 1_555 0.0 ? 14 NE2 ? A HIS 51 ? A HIS 51 ? 1_555 FE ? C FE . ? A FE 102 ? 1_555 O ? D HOH . ? A HOH 205 ? 1_555 106.0 ? 15 NE2 ? A HIS 51 ? A HIS 51 ? 1_555 FE ? C FE . ? A FE 102 ? 1_555 O ? D HOH . ? A HOH 205 ? 1_555 106.0 ? 16 NE2 ? A HIS 51 ? A HIS 51 ? 1_555 FE ? C FE . ? A FE 102 ? 1_555 O ? D HOH . ? A HOH 205 ? 2_455 106.1 ? 17 NE2 ? A HIS 51 ? A HIS 51 ? 1_555 FE ? C FE . ? A FE 102 ? 1_555 O ? D HOH . ? A HOH 205 ? 2_455 106.1 ? 18 O ? D HOH . ? A HOH 205 ? 1_555 FE ? C FE . ? A FE 102 ? 1_555 O ? D HOH . ? A HOH 205 ? 2_455 0.1 ? 19 SG ? A CYS 56 ? A CYS 56 ? 1_555 FE1 ? B F3S . ? A F3S 101 ? 1_555 S1 ? B F3S . ? A F3S 101 ? 1_555 116.9 ? 20 SG ? A CYS 56 ? A CYS 56 ? 1_555 FE1 ? B F3S . ? A F3S 101 ? 1_555 S2 ? B F3S . ? A F3S 101 ? 1_555 117.5 ? 21 S1 ? B F3S . ? A F3S 101 ? 1_555 FE1 ? B F3S . ? A F3S 101 ? 1_555 S2 ? B F3S . ? A F3S 101 ? 1_555 107.5 ? 22 SG ? A CYS 56 ? A CYS 56 ? 1_555 FE1 ? B F3S . ? A F3S 101 ? 1_555 S3 ? B F3S . ? A F3S 101 ? 1_555 102.8 ? 23 S1 ? B F3S . ? A F3S 101 ? 1_555 FE1 ? B F3S . ? A F3S 101 ? 1_555 S3 ? B F3S . ? A F3S 101 ? 1_555 105.4 ? 24 S2 ? B F3S . ? A F3S 101 ? 1_555 FE1 ? B F3S . ? A F3S 101 ? 1_555 S3 ? B F3S . ? A F3S 101 ? 1_555 105.2 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 3 ? ALA A 7 ? TYR A 3 ALA A 7 AA1 2 LEU A 61 ? GLU A 65 ? LEU A 61 GLU A 65 AA2 1 PHE A 26 ? ARG A 27 ? PHE A 26 ARG A 27 AA2 2 GLU A 35 ? ILE A 36 ? GLU A 35 ILE A 36 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 6 ? N GLU A 6 O SER A 62 ? O SER A 62 AA2 1 2 N ARG A 27 ? N ARG A 27 O GLU A 35 ? O GLU A 35 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A FE 102 ? C FE . 2 1 A HOH 201 ? D HOH . 3 1 A HOH 205 ? D HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z 3 -x+y,-x,z 4 x-y,-y,-z 5 -x,-x+y,-z 6 y,x,-z 7 x+1/3,y+2/3,z+2/3 8 -y+1/3,x-y+2/3,z+2/3 9 -x+y+1/3,-x+2/3,z+2/3 10 x-y+1/3,-y+2/3,-z+2/3 11 -x+1/3,-x+y+2/3,-z+2/3 12 y+1/3,x+2/3,-z+2/3 13 x+2/3,y+1/3,z+1/3 14 -y+2/3,x-y+1/3,z+1/3 15 -x+y+2/3,-x+1/3,z+1/3 16 x-y+2/3,-y+1/3,-z+1/3 17 -x+2/3,-x+y+1/3,-z+1/3 18 y+2/3,x+1/3,-z+1/3 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -10.2235812771 _pdbx_refine_tls.origin_y -10.5283877981 _pdbx_refine_tls.origin_z -13.6477102063 _pdbx_refine_tls.T[1][1] 0.169361525199 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0369906789722 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.215263474863 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.313415454142 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0664168035822 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.663810000722 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.12669271625 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -2.00557385106 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.17651409912 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 5.28127722827 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.169499384196 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.807417697391 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.203074986829 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0371668676423 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.459390927478 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.622434118087 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0829792519237 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -3.2436368637 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.539500956334 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.484072393083 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.260567329696 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 2 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id D _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 202 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ;(chain 'A' and resid 2 through 202) ; # _pdbx_entry_details.entry_id 8AMP _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 67 ? A GLY 67 3 1 Y 1 A GLU 68 ? A GLU 68 4 1 Y 1 A HIS 69 ? A HIS 69 5 1 Y 1 A HIS 70 ? A HIS 70 6 1 Y 1 A HIS 71 ? A HIS 71 7 1 Y 1 A HIS 72 ? A HIS 72 8 1 Y 1 A HIS 73 ? A HIS 73 9 1 Y 1 A HIS 74 ? A HIS 74 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 F3S FE1 FE N N 71 F3S FE3 FE N N 72 F3S FE4 FE N N 73 F3S S1 S N N 74 F3S S2 S N N 75 F3S S3 S N N 76 F3S S4 S N N 77 FE FE FE N N 78 GLN N N N N 79 GLN CA C N S 80 GLN C C N N 81 GLN O O N N 82 GLN CB C N N 83 GLN CG C N N 84 GLN CD C N N 85 GLN OE1 O N N 86 GLN NE2 N N N 87 GLN OXT O N N 88 GLN H H N N 89 GLN H2 H N N 90 GLN HA H N N 91 GLN HB2 H N N 92 GLN HB3 H N N 93 GLN HG2 H N N 94 GLN HG3 H N N 95 GLN HE21 H N N 96 GLN HE22 H N N 97 GLN HXT H N N 98 GLU N N N N 99 GLU CA C N S 100 GLU C C N N 101 GLU O O N N 102 GLU CB C N N 103 GLU CG C N N 104 GLU CD C N N 105 GLU OE1 O N N 106 GLU OE2 O N N 107 GLU OXT O N N 108 GLU H H N N 109 GLU H2 H N N 110 GLU HA H N N 111 GLU HB2 H N N 112 GLU HB3 H N N 113 GLU HG2 H N N 114 GLU HG3 H N N 115 GLU HE2 H N N 116 GLU HXT H N N 117 GLY N N N N 118 GLY CA C N N 119 GLY C C N N 120 GLY O O N N 121 GLY OXT O N N 122 GLY H H N N 123 GLY H2 H N N 124 GLY HA2 H N N 125 GLY HA3 H N N 126 GLY HXT H N N 127 HIS N N N N 128 HIS CA C N S 129 HIS C C N N 130 HIS O O N N 131 HIS CB C N N 132 HIS CG C Y N 133 HIS ND1 N Y N 134 HIS CD2 C Y N 135 HIS CE1 C Y N 136 HIS NE2 N Y N 137 HIS OXT O N N 138 HIS H H N N 139 HIS H2 H N N 140 HIS HA H N N 141 HIS HB2 H N N 142 HIS HB3 H N N 143 HIS HD1 H N N 144 HIS HD2 H N N 145 HIS HE1 H N N 146 HIS HE2 H N N 147 HIS HXT H N N 148 HOH O O N N 149 HOH H1 H N N 150 HOH H2 H N N 151 ILE N N N N 152 ILE CA C N S 153 ILE C C N N 154 ILE O O N N 155 ILE CB C N S 156 ILE CG1 C N N 157 ILE CG2 C N N 158 ILE CD1 C N N 159 ILE OXT O N N 160 ILE H H N N 161 ILE H2 H N N 162 ILE HA H N N 163 ILE HB H N N 164 ILE HG12 H N N 165 ILE HG13 H N N 166 ILE HG21 H N N 167 ILE HG22 H N N 168 ILE HG23 H N N 169 ILE HD11 H N N 170 ILE HD12 H N N 171 ILE HD13 H N N 172 ILE HXT H N N 173 LEU N N N N 174 LEU CA C N S 175 LEU C C N N 176 LEU O O N N 177 LEU CB C N N 178 LEU CG C N N 179 LEU CD1 C N N 180 LEU CD2 C N N 181 LEU OXT O N N 182 LEU H H N N 183 LEU H2 H N N 184 LEU HA H N N 185 LEU HB2 H N N 186 LEU HB3 H N N 187 LEU HG H N N 188 LEU HD11 H N N 189 LEU HD12 H N N 190 LEU HD13 H N N 191 LEU HD21 H N N 192 LEU HD22 H N N 193 LEU HD23 H N N 194 LEU HXT H N N 195 LYS N N N N 196 LYS CA C N S 197 LYS C C N N 198 LYS O O N N 199 LYS CB C N N 200 LYS CG C N N 201 LYS CD C N N 202 LYS CE C N N 203 LYS NZ N N N 204 LYS OXT O N N 205 LYS H H N N 206 LYS H2 H N N 207 LYS HA H N N 208 LYS HB2 H N N 209 LYS HB3 H N N 210 LYS HG2 H N N 211 LYS HG3 H N N 212 LYS HD2 H N N 213 LYS HD3 H N N 214 LYS HE2 H N N 215 LYS HE3 H N N 216 LYS HZ1 H N N 217 LYS HZ2 H N N 218 LYS HZ3 H N N 219 LYS HXT H N N 220 MET N N N N 221 MET CA C N S 222 MET C C N N 223 MET O O N N 224 MET CB C N N 225 MET CG C N N 226 MET SD S N N 227 MET CE C N N 228 MET OXT O N N 229 MET H H N N 230 MET H2 H N N 231 MET HA H N N 232 MET HB2 H N N 233 MET HB3 H N N 234 MET HG2 H N N 235 MET HG3 H N N 236 MET HE1 H N N 237 MET HE2 H N N 238 MET HE3 H N N 239 MET HXT H N N 240 PHE N N N N 241 PHE CA C N S 242 PHE C C N N 243 PHE O O N N 244 PHE CB C N N 245 PHE CG C Y N 246 PHE CD1 C Y N 247 PHE CD2 C Y N 248 PHE CE1 C Y N 249 PHE CE2 C Y N 250 PHE CZ C Y N 251 PHE OXT O N N 252 PHE H H N N 253 PHE H2 H N N 254 PHE HA H N N 255 PHE HB2 H N N 256 PHE HB3 H N N 257 PHE HD1 H N N 258 PHE HD2 H N N 259 PHE HE1 H N N 260 PHE HE2 H N N 261 PHE HZ H N N 262 PHE HXT H N N 263 PRO N N N N 264 PRO CA C N S 265 PRO C C N N 266 PRO O O N N 267 PRO CB C N N 268 PRO CG C N N 269 PRO CD C N N 270 PRO OXT O N N 271 PRO H H N N 272 PRO HA H N N 273 PRO HB2 H N N 274 PRO HB3 H N N 275 PRO HG2 H N N 276 PRO HG3 H N N 277 PRO HD2 H N N 278 PRO HD3 H N N 279 PRO HXT H N N 280 SER N N N N 281 SER CA C N S 282 SER C C N N 283 SER O O N N 284 SER CB C N N 285 SER OG O N N 286 SER OXT O N N 287 SER H H N N 288 SER H2 H N N 289 SER HA H N N 290 SER HB2 H N N 291 SER HB3 H N N 292 SER HG H N N 293 SER HXT H N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 TRP N N N N 312 TRP CA C N S 313 TRP C C N N 314 TRP O O N N 315 TRP CB C N N 316 TRP CG C Y N 317 TRP CD1 C Y N 318 TRP CD2 C Y N 319 TRP NE1 N Y N 320 TRP CE2 C Y N 321 TRP CE3 C Y N 322 TRP CZ2 C Y N 323 TRP CZ3 C Y N 324 TRP CH2 C Y N 325 TRP OXT O N N 326 TRP H H N N 327 TRP H2 H N N 328 TRP HA H N N 329 TRP HB2 H N N 330 TRP HB3 H N N 331 TRP HD1 H N N 332 TRP HE1 H N N 333 TRP HE3 H N N 334 TRP HZ2 H N N 335 TRP HZ3 H N N 336 TRP HH2 H N N 337 TRP HXT H N N 338 TYR N N N N 339 TYR CA C N S 340 TYR C C N N 341 TYR O O N N 342 TYR CB C N N 343 TYR CG C Y N 344 TYR CD1 C Y N 345 TYR CD2 C Y N 346 TYR CE1 C Y N 347 TYR CE2 C Y N 348 TYR CZ C Y N 349 TYR OH O N N 350 TYR OXT O N N 351 TYR H H N N 352 TYR H2 H N N 353 TYR HA H N N 354 TYR HB2 H N N 355 TYR HB3 H N N 356 TYR HD1 H N N 357 TYR HD2 H N N 358 TYR HE1 H N N 359 TYR HE2 H N N 360 TYR HH H N N 361 TYR HXT H N N 362 VAL N N N N 363 VAL CA C N S 364 VAL C C N N 365 VAL O O N N 366 VAL CB C N N 367 VAL CG1 C N N 368 VAL CG2 C N N 369 VAL OXT O N N 370 VAL H H N N 371 VAL H2 H N N 372 VAL HA H N N 373 VAL HB H N N 374 VAL HG11 H N N 375 VAL HG12 H N N 376 VAL HG13 H N N 377 VAL HG21 H N N 378 VAL HG22 H N N 379 VAL HG23 H N N 380 VAL HXT H N N 381 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 F3S FE1 S1 sing N N 67 F3S FE1 S2 sing N N 68 F3S FE1 S3 sing N N 69 F3S FE3 S1 sing N N 70 F3S FE3 S3 sing N N 71 F3S FE3 S4 sing N N 72 F3S FE4 S2 sing N N 73 F3S FE4 S3 sing N N 74 F3S FE4 S4 sing N N 75 GLN N CA sing N N 76 GLN N H sing N N 77 GLN N H2 sing N N 78 GLN CA C sing N N 79 GLN CA CB sing N N 80 GLN CA HA sing N N 81 GLN C O doub N N 82 GLN C OXT sing N N 83 GLN CB CG sing N N 84 GLN CB HB2 sing N N 85 GLN CB HB3 sing N N 86 GLN CG CD sing N N 87 GLN CG HG2 sing N N 88 GLN CG HG3 sing N N 89 GLN CD OE1 doub N N 90 GLN CD NE2 sing N N 91 GLN NE2 HE21 sing N N 92 GLN NE2 HE22 sing N N 93 GLN OXT HXT sing N N 94 GLU N CA sing N N 95 GLU N H sing N N 96 GLU N H2 sing N N 97 GLU CA C sing N N 98 GLU CA CB sing N N 99 GLU CA HA sing N N 100 GLU C O doub N N 101 GLU C OXT sing N N 102 GLU CB CG sing N N 103 GLU CB HB2 sing N N 104 GLU CB HB3 sing N N 105 GLU CG CD sing N N 106 GLU CG HG2 sing N N 107 GLU CG HG3 sing N N 108 GLU CD OE1 doub N N 109 GLU CD OE2 sing N N 110 GLU OE2 HE2 sing N N 111 GLU OXT HXT sing N N 112 GLY N CA sing N N 113 GLY N H sing N N 114 GLY N H2 sing N N 115 GLY CA C sing N N 116 GLY CA HA2 sing N N 117 GLY CA HA3 sing N N 118 GLY C O doub N N 119 GLY C OXT sing N N 120 GLY OXT HXT sing N N 121 HIS N CA sing N N 122 HIS N H sing N N 123 HIS N H2 sing N N 124 HIS CA C sing N N 125 HIS CA CB sing N N 126 HIS CA HA sing N N 127 HIS C O doub N N 128 HIS C OXT sing N N 129 HIS CB CG sing N N 130 HIS CB HB2 sing N N 131 HIS CB HB3 sing N N 132 HIS CG ND1 sing Y N 133 HIS CG CD2 doub Y N 134 HIS ND1 CE1 doub Y N 135 HIS ND1 HD1 sing N N 136 HIS CD2 NE2 sing Y N 137 HIS CD2 HD2 sing N N 138 HIS CE1 NE2 sing Y N 139 HIS CE1 HE1 sing N N 140 HIS NE2 HE2 sing N N 141 HIS OXT HXT sing N N 142 HOH O H1 sing N N 143 HOH O H2 sing N N 144 ILE N CA sing N N 145 ILE N H sing N N 146 ILE N H2 sing N N 147 ILE CA C sing N N 148 ILE CA CB sing N N 149 ILE CA HA sing N N 150 ILE C O doub N N 151 ILE C OXT sing N N 152 ILE CB CG1 sing N N 153 ILE CB CG2 sing N N 154 ILE CB HB sing N N 155 ILE CG1 CD1 sing N N 156 ILE CG1 HG12 sing N N 157 ILE CG1 HG13 sing N N 158 ILE CG2 HG21 sing N N 159 ILE CG2 HG22 sing N N 160 ILE CG2 HG23 sing N N 161 ILE CD1 HD11 sing N N 162 ILE CD1 HD12 sing N N 163 ILE CD1 HD13 sing N N 164 ILE OXT HXT sing N N 165 LEU N CA sing N N 166 LEU N H sing N N 167 LEU N H2 sing N N 168 LEU CA C sing N N 169 LEU CA CB sing N N 170 LEU CA HA sing N N 171 LEU C O doub N N 172 LEU C OXT sing N N 173 LEU CB CG sing N N 174 LEU CB HB2 sing N N 175 LEU CB HB3 sing N N 176 LEU CG CD1 sing N N 177 LEU CG CD2 sing N N 178 LEU CG HG sing N N 179 LEU CD1 HD11 sing N N 180 LEU CD1 HD12 sing N N 181 LEU CD1 HD13 sing N N 182 LEU CD2 HD21 sing N N 183 LEU CD2 HD22 sing N N 184 LEU CD2 HD23 sing N N 185 LEU OXT HXT sing N N 186 LYS N CA sing N N 187 LYS N H sing N N 188 LYS N H2 sing N N 189 LYS CA C sing N N 190 LYS CA CB sing N N 191 LYS CA HA sing N N 192 LYS C O doub N N 193 LYS C OXT sing N N 194 LYS CB CG sing N N 195 LYS CB HB2 sing N N 196 LYS CB HB3 sing N N 197 LYS CG CD sing N N 198 LYS CG HG2 sing N N 199 LYS CG HG3 sing N N 200 LYS CD CE sing N N 201 LYS CD HD2 sing N N 202 LYS CD HD3 sing N N 203 LYS CE NZ sing N N 204 LYS CE HE2 sing N N 205 LYS CE HE3 sing N N 206 LYS NZ HZ1 sing N N 207 LYS NZ HZ2 sing N N 208 LYS NZ HZ3 sing N N 209 LYS OXT HXT sing N N 210 MET N CA sing N N 211 MET N H sing N N 212 MET N H2 sing N N 213 MET CA C sing N N 214 MET CA CB sing N N 215 MET CA HA sing N N 216 MET C O doub N N 217 MET C OXT sing N N 218 MET CB CG sing N N 219 MET CB HB2 sing N N 220 MET CB HB3 sing N N 221 MET CG SD sing N N 222 MET CG HG2 sing N N 223 MET CG HG3 sing N N 224 MET SD CE sing N N 225 MET CE HE1 sing N N 226 MET CE HE2 sing N N 227 MET CE HE3 sing N N 228 MET OXT HXT sing N N 229 PHE N CA sing N N 230 PHE N H sing N N 231 PHE N H2 sing N N 232 PHE CA C sing N N 233 PHE CA CB sing N N 234 PHE CA HA sing N N 235 PHE C O doub N N 236 PHE C OXT sing N N 237 PHE CB CG sing N N 238 PHE CB HB2 sing N N 239 PHE CB HB3 sing N N 240 PHE CG CD1 doub Y N 241 PHE CG CD2 sing Y N 242 PHE CD1 CE1 sing Y N 243 PHE CD1 HD1 sing N N 244 PHE CD2 CE2 doub Y N 245 PHE CD2 HD2 sing N N 246 PHE CE1 CZ doub Y N 247 PHE CE1 HE1 sing N N 248 PHE CE2 CZ sing Y N 249 PHE CE2 HE2 sing N N 250 PHE CZ HZ sing N N 251 PHE OXT HXT sing N N 252 PRO N CA sing N N 253 PRO N CD sing N N 254 PRO N H sing N N 255 PRO CA C sing N N 256 PRO CA CB sing N N 257 PRO CA HA sing N N 258 PRO C O doub N N 259 PRO C OXT sing N N 260 PRO CB CG sing N N 261 PRO CB HB2 sing N N 262 PRO CB HB3 sing N N 263 PRO CG CD sing N N 264 PRO CG HG2 sing N N 265 PRO CG HG3 sing N N 266 PRO CD HD2 sing N N 267 PRO CD HD3 sing N N 268 PRO OXT HXT sing N N 269 SER N CA sing N N 270 SER N H sing N N 271 SER N H2 sing N N 272 SER CA C sing N N 273 SER CA CB sing N N 274 SER CA HA sing N N 275 SER C O doub N N 276 SER C OXT sing N N 277 SER CB OG sing N N 278 SER CB HB2 sing N N 279 SER CB HB3 sing N N 280 SER OG HG sing N N 281 SER OXT HXT sing N N 282 THR N CA sing N N 283 THR N H sing N N 284 THR N H2 sing N N 285 THR CA C sing N N 286 THR CA CB sing N N 287 THR CA HA sing N N 288 THR C O doub N N 289 THR C OXT sing N N 290 THR CB OG1 sing N N 291 THR CB CG2 sing N N 292 THR CB HB sing N N 293 THR OG1 HG1 sing N N 294 THR CG2 HG21 sing N N 295 THR CG2 HG22 sing N N 296 THR CG2 HG23 sing N N 297 THR OXT HXT sing N N 298 TRP N CA sing N N 299 TRP N H sing N N 300 TRP N H2 sing N N 301 TRP CA C sing N N 302 TRP CA CB sing N N 303 TRP CA HA sing N N 304 TRP C O doub N N 305 TRP C OXT sing N N 306 TRP CB CG sing N N 307 TRP CB HB2 sing N N 308 TRP CB HB3 sing N N 309 TRP CG CD1 doub Y N 310 TRP CG CD2 sing Y N 311 TRP CD1 NE1 sing Y N 312 TRP CD1 HD1 sing N N 313 TRP CD2 CE2 doub Y N 314 TRP CD2 CE3 sing Y N 315 TRP NE1 CE2 sing Y N 316 TRP NE1 HE1 sing N N 317 TRP CE2 CZ2 sing Y N 318 TRP CE3 CZ3 doub Y N 319 TRP CE3 HE3 sing N N 320 TRP CZ2 CH2 doub Y N 321 TRP CZ2 HZ2 sing N N 322 TRP CZ3 CH2 sing Y N 323 TRP CZ3 HZ3 sing N N 324 TRP CH2 HH2 sing N N 325 TRP OXT HXT sing N N 326 TYR N CA sing N N 327 TYR N H sing N N 328 TYR N H2 sing N N 329 TYR CA C sing N N 330 TYR CA CB sing N N 331 TYR CA HA sing N N 332 TYR C O doub N N 333 TYR C OXT sing N N 334 TYR CB CG sing N N 335 TYR CB HB2 sing N N 336 TYR CB HB3 sing N N 337 TYR CG CD1 doub Y N 338 TYR CG CD2 sing Y N 339 TYR CD1 CE1 sing Y N 340 TYR CD1 HD1 sing N N 341 TYR CD2 CE2 doub Y N 342 TYR CD2 HD2 sing N N 343 TYR CE1 CZ doub Y N 344 TYR CE1 HE1 sing N N 345 TYR CE2 CZ sing Y N 346 TYR CE2 HE2 sing N N 347 TYR CZ OH sing N N 348 TYR OH HH sing N N 349 TYR OXT HXT sing N N 350 VAL N CA sing N N 351 VAL N H sing N N 352 VAL N H2 sing N N 353 VAL CA C sing N N 354 VAL CA CB sing N N 355 VAL CA HA sing N N 356 VAL C O doub N N 357 VAL C OXT sing N N 358 VAL CB CG1 sing N N 359 VAL CB CG2 sing N N 360 VAL CB HB sing N N 361 VAL CG1 HG11 sing N N 362 VAL CG1 HG12 sing N N 363 VAL CG1 HG13 sing N N 364 VAL CG2 HG21 sing N N 365 VAL CG2 HG22 sing N N 366 VAL CG2 HG23 sing N N 367 VAL OXT HXT sing N N 368 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Science and Higher Education of the Russian Federation' 'Russian Federation' 075-15-2021-1354 1 'Ministry of Science and Higher Education of the Russian Federation' 'Russian Federation' 122030100168-2 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id F3S _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id F3S _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1VJW _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'R 3 2 :H' _space_group.name_Hall ;R 3 2" ; _space_group.IT_number 155 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 8AMP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.021295 _atom_sites.fract_transf_matrix[1][2] 0.012295 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024590 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006147 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? FE ? ? 20.90327 4.99816 ? ? 2.55100 38.46870 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_