data_8AO0
# 
_entry.id   8AO0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   8AO0         pdb_00008ao0 10.2210/pdb8ao0/pdb 
WWPDB D_1292124780 ?            ?                   
BMRB  34746        ?            10.13018/BMR34746   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2022-11-23 
2 'Structure model' 1 1 2024-10-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 2 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom            
2 2 'Structure model' chem_comp_bond            
3 2 'Structure model' database_2                
4 2 'Structure model' pdbx_entry_details        
5 2 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                         
2 2 'Structure model' '_pdbx_entry_details.has_protein_modification' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        8AO0 
_pdbx_database_status.recvd_initial_deposition_date   2022-08-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'Solution structure of nanoFAST/HBR-DOM2 complex' 
_pdbx_database_related.db_id          34746 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_contact_author.id                 2 
_pdbx_contact_author.email              mineev@nmr.com 
_pdbx_contact_author.name_first         Konstantin 
_pdbx_contact_author.name_last          Mineev 
_pdbx_contact_author.name_mi            S 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0002-2418-9421 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lushpa, V.A.'    1 0000-0002-1788-1153 
'Goncharuk, M.V.' 2 0000-0002-6984-7125 
'Goncharuk, S.A.' 3 0000-0002-0263-6462 
'Baleeva, N.S.'   4 0000-0003-2737-0733 
'Baranov, M.S.'   5 0000-0002-9339-7603 
'Mineev, K.S.'    6 0000-0002-2418-9421 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Int J Mol Sci' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1422-0067 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            23 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Spatial Structure of NanoFAST in the Apo State and in Complex with its Fluorogen HBR-DOM2.' 
_citation.year                      2022 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3390/ijms231911361 
_citation.pdbx_database_id_PubMed   36232662 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lushpa, V.A.'    1 ?                   
primary 'Baleeva, N.S.'   2 ?                   
primary 'Goncharuk, S.A.' 3 0000-0002-0263-6462 
primary 'Goncharuk, M.V.' 4 0000-0002-6984-7125 
primary 'Arseniev, A.S.'  5 ?                   
primary 'Baranov, M.S.'   6 0000-0002-9339-7603 
primary 'Mineev, K.S.'    7 0000-0002-2418-9421 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Photoactive yellow protein'                                                                     12489.214 1 ? ? 
? ? 
2 non-polymer syn '(5~{Z})-5-[(2,5-dimethoxy-4-oxidanyl-phenyl)methylidene]-2-sulfanylidene-1,3-thiazolidin-4-one' 297.350   1 ? ? 
? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PYP 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MFGAIQLDGDGNILQYNAA(GGL)GDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFKEGVASGNLNTMFEWMIPTSRGP
TKVKVHMKKALSGDSYWVFVKRVKLAAALEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFKEGVASGNLNTMFEWMIPTSRGPTKVK
VHMKKALSGDSYWVFVKRVKLAAALEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        '(5~{Z})-5-[(2,5-dimethoxy-4-oxidanyl-phenyl)methylidene]-2-sulfanylidene-1,3-thiazolidin-4-one' 
_pdbx_entity_nonpoly.comp_id     O1F 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PHE n 
1 3   GLY n 
1 4   ALA n 
1 5   ILE n 
1 6   GLN n 
1 7   LEU n 
1 8   ASP n 
1 9   GLY n 
1 10  ASP n 
1 11  GLY n 
1 12  ASN n 
1 13  ILE n 
1 14  LEU n 
1 15  GLN n 
1 16  TYR n 
1 17  ASN n 
1 18  ALA n 
1 19  ALA n 
1 20  GGL n 
1 21  GLY n 
1 22  ASP n 
1 23  ILE n 
1 24  THR n 
1 25  GLY n 
1 26  ARG n 
1 27  ASP n 
1 28  PRO n 
1 29  LYS n 
1 30  GLN n 
1 31  VAL n 
1 32  ILE n 
1 33  GLY n 
1 34  LYS n 
1 35  ASN n 
1 36  PHE n 
1 37  PHE n 
1 38  LYS n 
1 39  ASP n 
1 40  VAL n 
1 41  ALA n 
1 42  PRO n 
1 43  GLY n 
1 44  THR n 
1 45  ASP n 
1 46  SER n 
1 47  PRO n 
1 48  GLU n 
1 49  PHE n 
1 50  TYR n 
1 51  GLY n 
1 52  LYS n 
1 53  PHE n 
1 54  LYS n 
1 55  GLU n 
1 56  GLY n 
1 57  VAL n 
1 58  ALA n 
1 59  SER n 
1 60  GLY n 
1 61  ASN n 
1 62  LEU n 
1 63  ASN n 
1 64  THR n 
1 65  MET n 
1 66  PHE n 
1 67  GLU n 
1 68  TRP n 
1 69  MET n 
1 70  ILE n 
1 71  PRO n 
1 72  THR n 
1 73  SER n 
1 74  ARG n 
1 75  GLY n 
1 76  PRO n 
1 77  THR n 
1 78  LYS n 
1 79  VAL n 
1 80  LYS n 
1 81  VAL n 
1 82  HIS n 
1 83  MET n 
1 84  LYS n 
1 85  LYS n 
1 86  ALA n 
1 87  LEU n 
1 88  SER n 
1 89  GLY n 
1 90  ASP n 
1 91  SER n 
1 92  TYR n 
1 93  TRP n 
1 94  VAL n 
1 95  PHE n 
1 96  VAL n 
1 97  LYS n 
1 98  ARG n 
1 99  VAL n 
1 100 LYS n 
1 101 LEU n 
1 102 ALA n 
1 103 ALA n 
1 104 ALA n 
1 105 LEU n 
1 106 GLU n 
1 107 HIS n 
1 108 HIS n 
1 109 HIS n 
1 110 HIS n 
1 111 HIS n 
1 112 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   112 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 pyp 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'synthetic construct' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     32630 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'                y ALANINE ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'                y ARGININE ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'                y ASPARAGINE ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'                y 'ASPARTIC ACID' ?                 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking'                y CYSTEINE ?                 'C3 H7 N O2 S'    121.158 
GGL 'L-gamma-peptide, C-delta linking' . 'GAMMA-L-GLUTAMIC ACID' 'L-GLUTAMIC ACID' 'C5 H9 N O4'      147.129 
GLN 'L-peptide linking'                y GLUTAMINE ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'                y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'                  y GLYCINE ?                 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking'                y HISTIDINE ?                 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking'                y ISOLEUCINE ?                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'                y LEUCINE ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'                y LYSINE ?                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'                y METHIONINE ?                 'C5 H11 N O2 S'   149.211 
O1F non-polymer                        . 
'(5~{Z})-5-[(2,5-dimethoxy-4-oxidanyl-phenyl)methylidene]-2-sulfanylidene-1,3-thiazolidin-4-one' ?                 
'C12 H11 N O4 S2' 297.350 
PHE 'L-peptide linking'                y PHENYLALANINE ?                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'                y PROLINE ?                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking'                y SERINE ?                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking'                y THREONINE ?                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'                y TRYPTOPHAN ?                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'                y TYROSINE ?                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'                y VALINE ?                 'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   PHE 2   2   2   PHE PHE A . n 
A 1 3   GLY 3   3   3   GLY GLY A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   ASP 8   8   8   ASP ASP A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  TYR 16  16  16  TYR TYR A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  GGL 20  20  20  GGL GLP A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  THR 44  44  44  THR THR A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  MET 65  65  65  MET MET A . n 
A 1 66  PHE 66  66  66  PHE PHE A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  TRP 68  68  68  TRP TRP A . n 
A 1 69  MET 69  69  69  MET MET A . n 
A 1 70  ILE 70  70  70  ILE ILE A . n 
A 1 71  PRO 71  71  71  PRO PRO A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  VAL 81  81  81  VAL VAL A . n 
A 1 82  HIS 82  82  82  HIS HIS A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  TRP 93  93  93  TRP TRP A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  PHE 95  95  95  PHE PHE A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 HIS 107 107 107 HIS HIS A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 HIS 109 109 109 HIS HIS A . n 
A 1 110 HIS 110 110 110 HIS HIS A . n 
A 1 111 HIS 111 111 111 HIS HIS A . n 
A 1 112 HIS 112 112 112 HIS HIS A . n 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        O1F 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   O1F 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          O1F 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     201 
_pdbx_nonpoly_scheme.auth_seq_num    123 
_pdbx_nonpoly_scheme.pdb_mon_id      O1F 
_pdbx_nonpoly_scheme.auth_mon_id     LIG 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     8AO0 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.000 
_cell.length_a_esd                 ? 
_cell.length_b                     1.000 
_cell.length_b_esd                 ? 
_cell.length_c                     1.000 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
_cell.pdbx_esd_method              ? 
# 
_symmetry.entry_id                         8AO0 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   8AO0 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_database_PDB_matrix.entry_id          8AO0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                     8AO0 
_struct.title                        'Solution structure of nanoFAST/HBR-DOM2 complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        8AO0 
_struct_keywords.text            
;fluorogen-activating protein, FAST, nanoFAST, spatial structure, dynamics, ligand sepcificity, fluorogen, binding constatnt, FLUORESCENT PROTEIN
;
_struct_keywords.pdbx_keywords   'FLUORESCENT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PYP_HALHA 
_struct_ref.pdbx_db_accession          P16113 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKV
HMKKALSGDSYWVFVKRV
;
_struct_ref.pdbx_align_begin           28 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              8AO0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 99 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16113 
_struct_ref_seq.db_align_beg                  28 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  125 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       99 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 8AO0 MET A 1   ? UNP P16113 ?   ?   'initiating methionine' 1   1  
1 8AO0 GGL A 20  ? UNP P16113 GLU 46  conflict                20  2  
1 8AO0 GLY A 43  ? UNP P16113 CYS 69  conflict                43  3  
1 8AO0 TRP A 68  ? UNP P16113 TYR 94  conflict                68  4  
1 8AO0 MET A 69  ? UNP P16113 THR 95  conflict                69  5  
1 8AO0 ILE A 70  ? UNP P16113 PHE 96  conflict                70  6  
1 8AO0 PRO A 71  ? UNP P16113 ASP 97  conflict                71  7  
1 8AO0 THR A 72  ? UNP P16113 TYR 98  conflict                72  8  
1 8AO0 SER A 73  ? UNP P16113 GLN 99  conflict                73  9  
1 8AO0 ARG A 74  ? UNP P16113 MET 100 conflict                74  10 
1 8AO0 GLY A 75  ? UNP P16113 THR 101 conflict                75  11 
1 8AO0 LYS A 100 ? UNP P16113 ?   ?   'expression tag'        100 12 
1 8AO0 LEU A 101 ? UNP P16113 ?   ?   'expression tag'        101 13 
1 8AO0 ALA A 102 ? UNP P16113 ?   ?   'expression tag'        102 14 
1 8AO0 ALA A 103 ? UNP P16113 ?   ?   'expression tag'        103 15 
1 8AO0 ALA A 104 ? UNP P16113 ?   ?   'expression tag'        104 16 
1 8AO0 LEU A 105 ? UNP P16113 ?   ?   'expression tag'        105 17 
1 8AO0 GLU A 106 ? UNP P16113 ?   ?   'expression tag'        106 18 
1 8AO0 HIS A 107 ? UNP P16113 ?   ?   'expression tag'        107 19 
1 8AO0 HIS A 108 ? UNP P16113 ?   ?   'expression tag'        108 20 
1 8AO0 HIS A 109 ? UNP P16113 ?   ?   'expression tag'        109 21 
1 8AO0 HIS A 110 ? UNP P16113 ?   ?   'expression tag'        110 22 
1 8AO0 HIS A 111 ? UNP P16113 ?   ?   'expression tag'        111 23 
1 8AO0 HIS A 112 ? UNP P16113 ?   ?   'expression tag'        112 24 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1 1 'gel filtration'       ? 
2 1 'NMR relaxation study' ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASN A 17 ? GLY A 25 ? ASN A 17 GLY A 25 1 ? 9  
HELX_P HELX_P2 AA2 ASP A 27 ? ILE A 32 ? ASP A 27 ILE A 32 1 ? 6  
HELX_P HELX_P3 AA3 PHE A 49 ? GLY A 60 ? PHE A 49 GLY A 60 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A ALA 19 C ? ? ? 1_555 A GGL 20 N ? ? A ALA 19 A GGL 20 1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale2 covale one  ? A GGL 20 C ? ? ? 1_555 A GLY 21 N ? ? A GGL 20 A GLY 21 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      GGL 
_pdbx_modification_feature.label_asym_id                      A 
_pdbx_modification_feature.label_seq_id                       20 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     . 
_pdbx_modification_feature.modified_residue_label_asym_id     . 
_pdbx_modification_feature.modified_residue_label_seq_id      . 
_pdbx_modification_feature.modified_residue_label_alt_id      . 
_pdbx_modification_feature.auth_comp_id                       GGL 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        20 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      . 
_pdbx_modification_feature.modified_residue_auth_asym_id      . 
_pdbx_modification_feature.modified_residue_auth_seq_id       . 
_pdbx_modification_feature.modified_residue_PDB_ins_code      . 
_pdbx_modification_feature.modified_residue_symmetry          . 
_pdbx_modification_feature.comp_id_linking_atom               . 
_pdbx_modification_feature.modified_residue_id_linking_atom   . 
_pdbx_modification_feature.modified_residue_id                ? 
_pdbx_modification_feature.ref_pcm_id                         1 
_pdbx_modification_feature.ref_comp_id                        GGL 
_pdbx_modification_feature.type                               None 
_pdbx_modification_feature.category                           'Non-standard residue' 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 13 ? TYR A 16 ? ILE A 13 TYR A 16 
AA1 2 GLY A 3  ? LEU A 7  ? GLY A 3  LEU A 7  
AA1 3 TYR A 92 ? ARG A 98 ? TYR A 92 ARG A 98 
AA1 4 GLY A 75 ? LYS A 85 ? GLY A 75 LYS A 85 
AA1 5 ASN A 63 ? THR A 72 ? ASN A 63 THR A 72 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LEU A 14 ? O LEU A 14 N GLN A 6  ? N GLN A 6  
AA1 2 3 N LEU A 7  ? N LEU A 7  O TYR A 92 ? O TYR A 92 
AA1 3 4 O LYS A 97 ? O LYS A 97 N LYS A 80 ? N LYS A 80 
AA1 4 5 O VAL A 79 ? O VAL A 79 N TRP A 68 ? N TRP A 68 
# 
_pdbx_entry_details.entry_id                   8AO0 
_pdbx_entry_details.has_ligand_of_interest     Y 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  ASP A 39  ? ? -89.71  -71.51  
2   1  ASP A 45  ? ? -59.25  97.37   
3   1  PHE A 49  ? ? -96.86  -71.12  
4   1  ASN A 61  ? ? 179.84  84.14   
5   1  ASP A 90  ? ? -142.01 35.85   
6   1  ALA A 102 ? ? -54.94  103.70  
7   1  HIS A 109 ? ? -55.17  171.92  
8   2  ASP A 39  ? ? -90.80  -71.61  
9   2  ASP A 45  ? ? -59.35  97.82   
10  2  PHE A 49  ? ? -96.38  -68.92  
11  2  ASN A 61  ? ? 179.73  86.09   
12  2  ALA A 104 ? ? -172.26 109.46  
13  2  HIS A 109 ? ? -127.72 -59.56  
14  3  ASP A 39  ? ? -90.07  -71.65  
15  3  ASP A 45  ? ? -59.11  97.10   
16  3  PHE A 49  ? ? -95.81  -71.67  
17  3  ASN A 61  ? ? 179.16  90.32   
18  3  ALA A 86  ? ? -56.04  172.27  
19  3  VAL A 99  ? ? -56.68  176.29  
20  3  ALA A 103 ? ? -103.68 -75.28  
21  4  ASP A 39  ? ? -91.34  -71.28  
22  4  ASP A 45  ? ? -59.35  96.77   
23  4  PHE A 49  ? ? -95.37  -69.20  
24  4  ASN A 61  ? ? 179.51  83.82   
25  4  ASP A 90  ? ? -143.39 35.97   
26  4  VAL A 99  ? ? -63.96  -179.73 
27  5  ASP A 39  ? ? -89.91  -71.59  
28  5  ASP A 45  ? ? -59.10  97.49   
29  5  PHE A 49  ? ? -95.63  -68.74  
30  5  ASN A 61  ? ? -179.96 81.17   
31  6  ASP A 39  ? ? -88.75  -71.54  
32  6  ASP A 45  ? ? -59.24  96.88   
33  6  PHE A 49  ? ? -99.27  -70.90  
34  6  ASN A 61  ? ? 179.03  87.07   
35  6  SER A 91  ? ? -179.76 -175.73 
36  7  ASP A 39  ? ? -91.78  -71.35  
37  7  ASP A 45  ? ? -59.04  97.30   
38  7  PHE A 49  ? ? -94.45  -68.42  
39  7  ASN A 61  ? ? 179.42  84.54   
40  7  ALA A 104 ? ? -60.53  -174.89 
41  8  ASP A 39  ? ? -80.84  -71.58  
42  8  ASP A 45  ? ? -59.43  97.41   
43  8  PHE A 49  ? ? -96.35  -69.29  
44  8  ASN A 61  ? ? 179.39  84.46   
45  8  GLU A 106 ? ? -104.60 41.55   
46  9  ASP A 39  ? ? -79.68  -71.24  
47  9  ASP A 45  ? ? -59.62  97.15   
48  9  PHE A 49  ? ? -97.40  -69.35  
49  9  ASN A 61  ? ? 179.85  85.37   
50  10 ASP A 39  ? ? -89.70  -71.55  
51  10 ASP A 45  ? ? -59.22  97.41   
52  10 PHE A 49  ? ? -96.16  -68.56  
53  10 ASN A 61  ? ? 178.94  71.74   
54  10 ASP A 90  ? ? -145.23 34.98   
55  10 LYS A 100 ? ? -63.53  93.64   
56  10 ALA A 103 ? ? -171.84 133.89  
57  10 ALA A 104 ? ? -83.52  -74.90  
58  11 ARG A 26  ? ? -119.97 -168.05 
59  11 ASP A 39  ? ? -92.28  -71.44  
60  11 ASP A 45  ? ? -59.16  97.73   
61  11 PHE A 49  ? ? -94.45  -68.65  
62  11 ASN A 61  ? ? 179.78  83.96   
63  12 ASP A 39  ? ? -80.76  -71.77  
64  12 ASP A 45  ? ? -59.42  96.97   
65  12 PHE A 49  ? ? -94.19  -69.14  
66  12 ASN A 61  ? ? -179.93 81.46   
67  12 VAL A 99  ? ? -58.61  -176.79 
68  12 GLU A 106 ? ? -175.00 123.05  
69  13 ARG A 26  ? ? -110.30 -169.05 
70  13 ASP A 39  ? ? -90.55  -71.83  
71  13 ASP A 45  ? ? -59.21  97.81   
72  13 PHE A 49  ? ? -94.27  -68.76  
73  13 ASN A 61  ? ? 179.24  88.71   
74  13 ASP A 90  ? ? -145.21 35.16   
75  13 SER A 91  ? ? -179.77 -179.03 
76  14 ASP A 39  ? ? -80.42  -71.50  
77  14 ASP A 45  ? ? -58.97  97.72   
78  14 PHE A 49  ? ? -99.63  -68.42  
79  14 ASN A 61  ? ? 179.34  86.21   
80  14 ASP A 90  ? ? -144.09 36.17   
81  14 VAL A 99  ? ? -92.74  42.12   
82  14 ALA A 104 ? ? -167.21 112.24  
83  15 ARG A 26  ? ? -121.02 -168.52 
84  15 ASP A 39  ? ? -91.33  -71.56  
85  15 ASP A 45  ? ? -59.26  97.44   
86  15 PHE A 49  ? ? -94.51  -69.29  
87  15 ASN A 61  ? ? 179.71  85.79   
88  15 LYS A 100 ? ? -59.09  -179.90 
89  16 ASP A 39  ? ? -90.13  -71.42  
90  16 ASP A 45  ? ? -59.36  97.38   
91  16 PHE A 49  ? ? -94.27  -69.34  
92  16 ASN A 61  ? ? 179.42  88.67   
93  16 ALA A 86  ? ? -57.86  173.46  
94  16 VAL A 99  ? ? -61.68  -179.44 
95  17 ASP A 27  ? ? -53.87  109.86  
96  17 ASP A 39  ? ? -92.30  -71.51  
97  17 ASP A 45  ? ? -59.21  98.00   
98  17 PHE A 49  ? ? -95.96  -71.67  
99  17 ASN A 61  ? ? 179.75  86.71   
100 17 ALA A 102 ? ? -56.84  177.45  
101 17 ALA A 103 ? ? -55.25  102.00  
102 18 ASP A 39  ? ? -138.02 -70.89  
103 18 ALA A 41  ? ? -155.70 86.82   
104 18 PHE A 49  ? ? -94.14  -64.30  
105 18 ASN A 61  ? ? 179.61  77.13   
106 18 HIS A 110 ? ? -132.22 -51.95  
107 19 ARG A 26  ? ? -122.74 -169.16 
108 19 ASP A 39  ? ? -91.84  -71.57  
109 19 ASP A 45  ? ? -59.33  97.28   
110 19 PHE A 49  ? ? -94.89  -69.89  
111 19 ASN A 61  ? ? 179.24  85.96   
112 19 LEU A 105 ? ? -116.50 -74.61  
113 19 HIS A 107 ? ? -101.17 -70.36  
114 19 HIS A 109 ? ? -116.41 71.79   
115 20 ASP A 39  ? ? -91.33  -71.31  
116 20 ASP A 45  ? ? -59.48  96.99   
117 20 PHE A 49  ? ? -97.01  -69.67  
118 20 ASN A 61  ? ? 180.00  90.86   
119 20 ALA A 104 ? ? -129.32 -70.59  
120 20 LEU A 105 ? ? -163.93 112.82  
# 
_pdbx_nmr_ensemble.entry_id                                      8AO0 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             8AO0 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '20 mM NaPi, 20 mM sodium chloride, 0.001 % sodium azide, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
_pdbx_nmr_sample_details.label            '15N, 13C_sample' 
_pdbx_nmr_sample_details.type             solid 
_pdbx_nmr_sample_details.details          ? 
# 
loop_
_pdbx_nmr_exptl_sample.solution_id 
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
1 NaPi              20    ? mM 'natural abundance' 
1 'sodium chloride' 20    ? mM 'natural abundance' 
1 'sodium azide'    0.001 ? %  'natural abundance' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         Pa 
_pdbx_nmr_exptl_sample_conditions.pressure               AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                     7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         NULL 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  conditions_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  1 1 '2D 1H-15N HSQC'           1 isotropic 
2  1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 
3  1 1 '2D 1H-13C HSQC aromatic'  1 isotropic 
4  1 1 '3D HNCO'                  1 isotropic 
5  1 1 '3D HNCA'                  1 isotropic 
18 1 1 '3D HN(CO)CA'              1 isotropic 
17 1 1 '3D HNCACO'                1 isotropic 
16 1 1 '3D TOCSY'                 1 isotropic 
15 1 1 '3D HCCH-COSY'             1 isotropic 
14 1 1 '3D HCCH-TOCSY'            1 isotropic 
13 1 1 '3D 1H-13C NOESY'          1 isotropic 
12 1 1 '3D 1H-15N NOESY'          1 isotropic 
11 1 1 '3D HNCACB'                1 isotropic 
10 1 1 hbCBcarHar                 1 isotropic 
# 
_pdbx_nmr_refine.entry_id           8AO0 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 'structure calculation'     CYANA   3.98.13 'Guntert, Mumenthaler and Wuthrich'                       
2 processing                  TopSpin 3.0     'Bruker Biospin'                                          
3 processing                  qMDD    3.2     'Maxim Mayzev, Krzysztof Kazimierczuk, Vladislav Orekhov' 
4 'peak picking'              CARA    1.9.1.7 'Keller and Wuthrich'                                     
5 'chemical shift assignment' CARA    1.9.1.7 'Keller and Wuthrich'                                     
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GGL N    N N N 88  
GGL CA   C N S 89  
GGL C    C N N 90  
GGL O    O N N 91  
GGL CB   C N N 92  
GGL CG   C N N 93  
GGL CD   C N N 94  
GGL OE1  O N N 95  
GGL OE2  O N N 96  
GGL OXT  O N N 97  
GGL H    H N N 98  
GGL H2   H N N 99  
GGL HA   H N N 100 
GGL HB2  H N N 101 
GGL HB3  H N N 102 
GGL HG2  H N N 103 
GGL HG3  H N N 104 
GGL HE2  H N N 105 
GGL HXT  H N N 106 
GLN N    N N N 107 
GLN CA   C N S 108 
GLN C    C N N 109 
GLN O    O N N 110 
GLN CB   C N N 111 
GLN CG   C N N 112 
GLN CD   C N N 113 
GLN OE1  O N N 114 
GLN NE2  N N N 115 
GLN OXT  O N N 116 
GLN H    H N N 117 
GLN H2   H N N 118 
GLN HA   H N N 119 
GLN HB2  H N N 120 
GLN HB3  H N N 121 
GLN HG2  H N N 122 
GLN HG3  H N N 123 
GLN HE21 H N N 124 
GLN HE22 H N N 125 
GLN HXT  H N N 126 
GLU N    N N N 127 
GLU CA   C N S 128 
GLU C    C N N 129 
GLU O    O N N 130 
GLU CB   C N N 131 
GLU CG   C N N 132 
GLU CD   C N N 133 
GLU OE1  O N N 134 
GLU OE2  O N N 135 
GLU OXT  O N N 136 
GLU H    H N N 137 
GLU H2   H N N 138 
GLU HA   H N N 139 
GLU HB2  H N N 140 
GLU HB3  H N N 141 
GLU HG2  H N N 142 
GLU HG3  H N N 143 
GLU HE2  H N N 144 
GLU HXT  H N N 145 
GLY N    N N N 146 
GLY CA   C N N 147 
GLY C    C N N 148 
GLY O    O N N 149 
GLY OXT  O N N 150 
GLY H    H N N 151 
GLY H2   H N N 152 
GLY HA2  H N N 153 
GLY HA3  H N N 154 
GLY HXT  H N N 155 
HIS N    N N N 156 
HIS CA   C N S 157 
HIS C    C N N 158 
HIS O    O N N 159 
HIS CB   C N N 160 
HIS CG   C Y N 161 
HIS ND1  N Y N 162 
HIS CD2  C Y N 163 
HIS CE1  C Y N 164 
HIS NE2  N Y N 165 
HIS OXT  O N N 166 
HIS H    H N N 167 
HIS H2   H N N 168 
HIS HA   H N N 169 
HIS HB2  H N N 170 
HIS HB3  H N N 171 
HIS HD1  H N N 172 
HIS HD2  H N N 173 
HIS HE1  H N N 174 
HIS HE2  H N N 175 
HIS HXT  H N N 176 
ILE N    N N N 177 
ILE CA   C N S 178 
ILE C    C N N 179 
ILE O    O N N 180 
ILE CB   C N S 181 
ILE CG1  C N N 182 
ILE CG2  C N N 183 
ILE CD1  C N N 184 
ILE OXT  O N N 185 
ILE H    H N N 186 
ILE H2   H N N 187 
ILE HA   H N N 188 
ILE HB   H N N 189 
ILE HG12 H N N 190 
ILE HG13 H N N 191 
ILE HG21 H N N 192 
ILE HG22 H N N 193 
ILE HG23 H N N 194 
ILE HD11 H N N 195 
ILE HD12 H N N 196 
ILE HD13 H N N 197 
ILE HXT  H N N 198 
LEU N    N N N 199 
LEU CA   C N S 200 
LEU C    C N N 201 
LEU O    O N N 202 
LEU CB   C N N 203 
LEU CG   C N N 204 
LEU CD1  C N N 205 
LEU CD2  C N N 206 
LEU OXT  O N N 207 
LEU H    H N N 208 
LEU H2   H N N 209 
LEU HA   H N N 210 
LEU HB2  H N N 211 
LEU HB3  H N N 212 
LEU HG   H N N 213 
LEU HD11 H N N 214 
LEU HD12 H N N 215 
LEU HD13 H N N 216 
LEU HD21 H N N 217 
LEU HD22 H N N 218 
LEU HD23 H N N 219 
LEU HXT  H N N 220 
LYS N    N N N 221 
LYS CA   C N S 222 
LYS C    C N N 223 
LYS O    O N N 224 
LYS CB   C N N 225 
LYS CG   C N N 226 
LYS CD   C N N 227 
LYS CE   C N N 228 
LYS NZ   N N N 229 
LYS OXT  O N N 230 
LYS H    H N N 231 
LYS H2   H N N 232 
LYS HA   H N N 233 
LYS HB2  H N N 234 
LYS HB3  H N N 235 
LYS HG2  H N N 236 
LYS HG3  H N N 237 
LYS HD2  H N N 238 
LYS HD3  H N N 239 
LYS HE2  H N N 240 
LYS HE3  H N N 241 
LYS HZ1  H N N 242 
LYS HZ2  H N N 243 
LYS HZ3  H N N 244 
LYS HXT  H N N 245 
MET N    N N N 246 
MET CA   C N S 247 
MET C    C N N 248 
MET O    O N N 249 
MET CB   C N N 250 
MET CG   C N N 251 
MET SD   S N N 252 
MET CE   C N N 253 
MET OXT  O N N 254 
MET H    H N N 255 
MET H2   H N N 256 
MET HA   H N N 257 
MET HB2  H N N 258 
MET HB3  H N N 259 
MET HG2  H N N 260 
MET HG3  H N N 261 
MET HE1  H N N 262 
MET HE2  H N N 263 
MET HE3  H N N 264 
MET HXT  H N N 265 
O1F N1   N N N 266 
O1F C4   C N N 267 
O1F C5   C Y N 268 
O1F C6   C Y N 269 
O1F C7   C Y N 270 
O1F C8   C Y N 271 
O1F C10  C N N 272 
O1F C1   C N N 273 
O1F O3   O N N 274 
O1F O1   O N N 275 
O1F C9   C Y N 276 
O1F O4   O N N 277 
O1F C2   C N N 278 
O1F C3   C Y N 279 
O1F S2   S N N 280 
O1F C12  C N N 281 
O1F S1   S N N 282 
O1F C11  C N N 283 
O1F O2   O N N 284 
O1F H8   H N N 285 
O1F H45  H N N 286 
O1F H21  H N N 287 
O1F H332 H N N 288 
O1F H333 H N N 289 
O1F H331 H N N 290 
O1F H1   H N N 291 
O1F H231 H N N 292 
O1F H232 H N N 293 
O1F H233 H N N 294 
O1F H32  H N N 295 
PHE N    N N N 296 
PHE CA   C N S 297 
PHE C    C N N 298 
PHE O    O N N 299 
PHE CB   C N N 300 
PHE CG   C Y N 301 
PHE CD1  C Y N 302 
PHE CD2  C Y N 303 
PHE CE1  C Y N 304 
PHE CE2  C Y N 305 
PHE CZ   C Y N 306 
PHE OXT  O N N 307 
PHE H    H N N 308 
PHE H2   H N N 309 
PHE HA   H N N 310 
PHE HB2  H N N 311 
PHE HB3  H N N 312 
PHE HD1  H N N 313 
PHE HD2  H N N 314 
PHE HE1  H N N 315 
PHE HE2  H N N 316 
PHE HZ   H N N 317 
PHE HXT  H N N 318 
PRO N    N N N 319 
PRO CA   C N S 320 
PRO C    C N N 321 
PRO O    O N N 322 
PRO CB   C N N 323 
PRO CG   C N N 324 
PRO CD   C N N 325 
PRO OXT  O N N 326 
PRO H    H N N 327 
PRO HA   H N N 328 
PRO HB2  H N N 329 
PRO HB3  H N N 330 
PRO HG2  H N N 331 
PRO HG3  H N N 332 
PRO HD2  H N N 333 
PRO HD3  H N N 334 
PRO HXT  H N N 335 
SER N    N N N 336 
SER CA   C N S 337 
SER C    C N N 338 
SER O    O N N 339 
SER CB   C N N 340 
SER OG   O N N 341 
SER OXT  O N N 342 
SER H    H N N 343 
SER H2   H N N 344 
SER HA   H N N 345 
SER HB2  H N N 346 
SER HB3  H N N 347 
SER HG   H N N 348 
SER HXT  H N N 349 
THR N    N N N 350 
THR CA   C N S 351 
THR C    C N N 352 
THR O    O N N 353 
THR CB   C N R 354 
THR OG1  O N N 355 
THR CG2  C N N 356 
THR OXT  O N N 357 
THR H    H N N 358 
THR H2   H N N 359 
THR HA   H N N 360 
THR HB   H N N 361 
THR HG1  H N N 362 
THR HG21 H N N 363 
THR HG22 H N N 364 
THR HG23 H N N 365 
THR HXT  H N N 366 
TRP N    N N N 367 
TRP CA   C N S 368 
TRP C    C N N 369 
TRP O    O N N 370 
TRP CB   C N N 371 
TRP CG   C Y N 372 
TRP CD1  C Y N 373 
TRP CD2  C Y N 374 
TRP NE1  N Y N 375 
TRP CE2  C Y N 376 
TRP CE3  C Y N 377 
TRP CZ2  C Y N 378 
TRP CZ3  C Y N 379 
TRP CH2  C Y N 380 
TRP OXT  O N N 381 
TRP H    H N N 382 
TRP H2   H N N 383 
TRP HA   H N N 384 
TRP HB2  H N N 385 
TRP HB3  H N N 386 
TRP HD1  H N N 387 
TRP HE1  H N N 388 
TRP HE3  H N N 389 
TRP HZ2  H N N 390 
TRP HZ3  H N N 391 
TRP HH2  H N N 392 
TRP HXT  H N N 393 
TYR N    N N N 394 
TYR CA   C N S 395 
TYR C    C N N 396 
TYR O    O N N 397 
TYR CB   C N N 398 
TYR CG   C Y N 399 
TYR CD1  C Y N 400 
TYR CD2  C Y N 401 
TYR CE1  C Y N 402 
TYR CE2  C Y N 403 
TYR CZ   C Y N 404 
TYR OH   O N N 405 
TYR OXT  O N N 406 
TYR H    H N N 407 
TYR H2   H N N 408 
TYR HA   H N N 409 
TYR HB2  H N N 410 
TYR HB3  H N N 411 
TYR HD1  H N N 412 
TYR HD2  H N N 413 
TYR HE1  H N N 414 
TYR HE2  H N N 415 
TYR HH   H N N 416 
TYR HXT  H N N 417 
VAL N    N N N 418 
VAL CA   C N S 419 
VAL C    C N N 420 
VAL O    O N N 421 
VAL CB   C N N 422 
VAL CG1  C N N 423 
VAL CG2  C N N 424 
VAL OXT  O N N 425 
VAL H    H N N 426 
VAL H2   H N N 427 
VAL HA   H N N 428 
VAL HB   H N N 429 
VAL HG11 H N N 430 
VAL HG12 H N N 431 
VAL HG13 H N N 432 
VAL HG21 H N N 433 
VAL HG22 H N N 434 
VAL HG23 H N N 435 
VAL HXT  H N N 436 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GGL N   CA   sing N N 83  
GGL N   H    sing N N 84  
GGL N   H2   sing N N 85  
GGL CA  C    sing N N 86  
GGL CA  CB   sing N N 87  
GGL CA  HA   sing N N 88  
GGL C   O    doub N N 89  
GGL C   OXT  sing N N 90  
GGL CB  CG   sing N N 91  
GGL CB  HB2  sing N N 92  
GGL CB  HB3  sing N N 93  
GGL CG  CD   sing N N 94  
GGL CG  HG2  sing N N 95  
GGL CG  HG3  sing N N 96  
GGL CD  OE1  doub N N 97  
GGL CD  OE2  sing N N 98  
GGL OE2 HE2  sing N N 99  
GGL OXT HXT  sing N N 100 
GLN N   CA   sing N N 101 
GLN N   H    sing N N 102 
GLN N   H2   sing N N 103 
GLN CA  C    sing N N 104 
GLN CA  CB   sing N N 105 
GLN CA  HA   sing N N 106 
GLN C   O    doub N N 107 
GLN C   OXT  sing N N 108 
GLN CB  CG   sing N N 109 
GLN CB  HB2  sing N N 110 
GLN CB  HB3  sing N N 111 
GLN CG  CD   sing N N 112 
GLN CG  HG2  sing N N 113 
GLN CG  HG3  sing N N 114 
GLN CD  OE1  doub N N 115 
GLN CD  NE2  sing N N 116 
GLN NE2 HE21 sing N N 117 
GLN NE2 HE22 sing N N 118 
GLN OXT HXT  sing N N 119 
GLU N   CA   sing N N 120 
GLU N   H    sing N N 121 
GLU N   H2   sing N N 122 
GLU CA  C    sing N N 123 
GLU CA  CB   sing N N 124 
GLU CA  HA   sing N N 125 
GLU C   O    doub N N 126 
GLU C   OXT  sing N N 127 
GLU CB  CG   sing N N 128 
GLU CB  HB2  sing N N 129 
GLU CB  HB3  sing N N 130 
GLU CG  CD   sing N N 131 
GLU CG  HG2  sing N N 132 
GLU CG  HG3  sing N N 133 
GLU CD  OE1  doub N N 134 
GLU CD  OE2  sing N N 135 
GLU OE2 HE2  sing N N 136 
GLU OXT HXT  sing N N 137 
GLY N   CA   sing N N 138 
GLY N   H    sing N N 139 
GLY N   H2   sing N N 140 
GLY CA  C    sing N N 141 
GLY CA  HA2  sing N N 142 
GLY CA  HA3  sing N N 143 
GLY C   O    doub N N 144 
GLY C   OXT  sing N N 145 
GLY OXT HXT  sing N N 146 
HIS N   CA   sing N N 147 
HIS N   H    sing N N 148 
HIS N   H2   sing N N 149 
HIS CA  C    sing N N 150 
HIS CA  CB   sing N N 151 
HIS CA  HA   sing N N 152 
HIS C   O    doub N N 153 
HIS C   OXT  sing N N 154 
HIS CB  CG   sing N N 155 
HIS CB  HB2  sing N N 156 
HIS CB  HB3  sing N N 157 
HIS CG  ND1  sing Y N 158 
HIS CG  CD2  doub Y N 159 
HIS ND1 CE1  doub Y N 160 
HIS ND1 HD1  sing N N 161 
HIS CD2 NE2  sing Y N 162 
HIS CD2 HD2  sing N N 163 
HIS CE1 NE2  sing Y N 164 
HIS CE1 HE1  sing N N 165 
HIS NE2 HE2  sing N N 166 
HIS OXT HXT  sing N N 167 
ILE N   CA   sing N N 168 
ILE N   H    sing N N 169 
ILE N   H2   sing N N 170 
ILE CA  C    sing N N 171 
ILE CA  CB   sing N N 172 
ILE CA  HA   sing N N 173 
ILE C   O    doub N N 174 
ILE C   OXT  sing N N 175 
ILE CB  CG1  sing N N 176 
ILE CB  CG2  sing N N 177 
ILE CB  HB   sing N N 178 
ILE CG1 CD1  sing N N 179 
ILE CG1 HG12 sing N N 180 
ILE CG1 HG13 sing N N 181 
ILE CG2 HG21 sing N N 182 
ILE CG2 HG22 sing N N 183 
ILE CG2 HG23 sing N N 184 
ILE CD1 HD11 sing N N 185 
ILE CD1 HD12 sing N N 186 
ILE CD1 HD13 sing N N 187 
ILE OXT HXT  sing N N 188 
LEU N   CA   sing N N 189 
LEU N   H    sing N N 190 
LEU N   H2   sing N N 191 
LEU CA  C    sing N N 192 
LEU CA  CB   sing N N 193 
LEU CA  HA   sing N N 194 
LEU C   O    doub N N 195 
LEU C   OXT  sing N N 196 
LEU CB  CG   sing N N 197 
LEU CB  HB2  sing N N 198 
LEU CB  HB3  sing N N 199 
LEU CG  CD1  sing N N 200 
LEU CG  CD2  sing N N 201 
LEU CG  HG   sing N N 202 
LEU CD1 HD11 sing N N 203 
LEU CD1 HD12 sing N N 204 
LEU CD1 HD13 sing N N 205 
LEU CD2 HD21 sing N N 206 
LEU CD2 HD22 sing N N 207 
LEU CD2 HD23 sing N N 208 
LEU OXT HXT  sing N N 209 
LYS N   CA   sing N N 210 
LYS N   H    sing N N 211 
LYS N   H2   sing N N 212 
LYS CA  C    sing N N 213 
LYS CA  CB   sing N N 214 
LYS CA  HA   sing N N 215 
LYS C   O    doub N N 216 
LYS C   OXT  sing N N 217 
LYS CB  CG   sing N N 218 
LYS CB  HB2  sing N N 219 
LYS CB  HB3  sing N N 220 
LYS CG  CD   sing N N 221 
LYS CG  HG2  sing N N 222 
LYS CG  HG3  sing N N 223 
LYS CD  CE   sing N N 224 
LYS CD  HD2  sing N N 225 
LYS CD  HD3  sing N N 226 
LYS CE  NZ   sing N N 227 
LYS CE  HE2  sing N N 228 
LYS CE  HE3  sing N N 229 
LYS NZ  HZ1  sing N N 230 
LYS NZ  HZ2  sing N N 231 
LYS NZ  HZ3  sing N N 232 
LYS OXT HXT  sing N N 233 
MET N   CA   sing N N 234 
MET N   H    sing N N 235 
MET N   H2   sing N N 236 
MET CA  C    sing N N 237 
MET CA  CB   sing N N 238 
MET CA  HA   sing N N 239 
MET C   O    doub N N 240 
MET C   OXT  sing N N 241 
MET CB  CG   sing N N 242 
MET CB  HB2  sing N N 243 
MET CB  HB3  sing N N 244 
MET CG  SD   sing N N 245 
MET CG  HG2  sing N N 246 
MET CG  HG3  sing N N 247 
MET SD  CE   sing N N 248 
MET CE  HE1  sing N N 249 
MET CE  HE2  sing N N 250 
MET CE  HE3  sing N N 251 
MET OXT HXT  sing N N 252 
O1F C2  O4   sing N N 253 
O1F O4  C9   sing N N 254 
O1F S1  C12  doub N N 255 
O1F C9  C3   doub Y N 256 
O1F C9  C7   sing Y N 257 
O1F S2  C12  sing N N 258 
O1F S2  C10  sing N N 259 
O1F C12 N1   sing N N 260 
O1F C3  C6   sing Y N 261 
O1F O1  C7   sing N N 262 
O1F C7  C5   doub Y N 263 
O1F C10 C4   doub N Z 264 
O1F C10 C11  sing N N 265 
O1F N1  C11  sing N N 266 
O1F C6  C4   sing N N 267 
O1F C6  C8   doub Y N 268 
O1F C5  C8   sing Y N 269 
O1F C11 O2   doub N N 270 
O1F C8  O3   sing N N 271 
O1F O3  C1   sing N N 272 
O1F N1  H8   sing N N 273 
O1F C4  H45  sing N N 274 
O1F C5  H21  sing N N 275 
O1F C1  H332 sing N N 276 
O1F C1  H333 sing N N 277 
O1F C1  H331 sing N N 278 
O1F O1  H1   sing N N 279 
O1F C2  H231 sing N N 280 
O1F C2  H232 sing N N 281 
O1F C2  H233 sing N N 282 
O1F C3  H32  sing N N 283 
PHE N   CA   sing N N 284 
PHE N   H    sing N N 285 
PHE N   H2   sing N N 286 
PHE CA  C    sing N N 287 
PHE CA  CB   sing N N 288 
PHE CA  HA   sing N N 289 
PHE C   O    doub N N 290 
PHE C   OXT  sing N N 291 
PHE CB  CG   sing N N 292 
PHE CB  HB2  sing N N 293 
PHE CB  HB3  sing N N 294 
PHE CG  CD1  doub Y N 295 
PHE CG  CD2  sing Y N 296 
PHE CD1 CE1  sing Y N 297 
PHE CD1 HD1  sing N N 298 
PHE CD2 CE2  doub Y N 299 
PHE CD2 HD2  sing N N 300 
PHE CE1 CZ   doub Y N 301 
PHE CE1 HE1  sing N N 302 
PHE CE2 CZ   sing Y N 303 
PHE CE2 HE2  sing N N 304 
PHE CZ  HZ   sing N N 305 
PHE OXT HXT  sing N N 306 
PRO N   CA   sing N N 307 
PRO N   CD   sing N N 308 
PRO N   H    sing N N 309 
PRO CA  C    sing N N 310 
PRO CA  CB   sing N N 311 
PRO CA  HA   sing N N 312 
PRO C   O    doub N N 313 
PRO C   OXT  sing N N 314 
PRO CB  CG   sing N N 315 
PRO CB  HB2  sing N N 316 
PRO CB  HB3  sing N N 317 
PRO CG  CD   sing N N 318 
PRO CG  HG2  sing N N 319 
PRO CG  HG3  sing N N 320 
PRO CD  HD2  sing N N 321 
PRO CD  HD3  sing N N 322 
PRO OXT HXT  sing N N 323 
SER N   CA   sing N N 324 
SER N   H    sing N N 325 
SER N   H2   sing N N 326 
SER CA  C    sing N N 327 
SER CA  CB   sing N N 328 
SER CA  HA   sing N N 329 
SER C   O    doub N N 330 
SER C   OXT  sing N N 331 
SER CB  OG   sing N N 332 
SER CB  HB2  sing N N 333 
SER CB  HB3  sing N N 334 
SER OG  HG   sing N N 335 
SER OXT HXT  sing N N 336 
THR N   CA   sing N N 337 
THR N   H    sing N N 338 
THR N   H2   sing N N 339 
THR CA  C    sing N N 340 
THR CA  CB   sing N N 341 
THR CA  HA   sing N N 342 
THR C   O    doub N N 343 
THR C   OXT  sing N N 344 
THR CB  OG1  sing N N 345 
THR CB  CG2  sing N N 346 
THR CB  HB   sing N N 347 
THR OG1 HG1  sing N N 348 
THR CG2 HG21 sing N N 349 
THR CG2 HG22 sing N N 350 
THR CG2 HG23 sing N N 351 
THR OXT HXT  sing N N 352 
TRP N   CA   sing N N 353 
TRP N   H    sing N N 354 
TRP N   H2   sing N N 355 
TRP CA  C    sing N N 356 
TRP CA  CB   sing N N 357 
TRP CA  HA   sing N N 358 
TRP C   O    doub N N 359 
TRP C   OXT  sing N N 360 
TRP CB  CG   sing N N 361 
TRP CB  HB2  sing N N 362 
TRP CB  HB3  sing N N 363 
TRP CG  CD1  doub Y N 364 
TRP CG  CD2  sing Y N 365 
TRP CD1 NE1  sing Y N 366 
TRP CD1 HD1  sing N N 367 
TRP CD2 CE2  doub Y N 368 
TRP CD2 CE3  sing Y N 369 
TRP NE1 CE2  sing Y N 370 
TRP NE1 HE1  sing N N 371 
TRP CE2 CZ2  sing Y N 372 
TRP CE3 CZ3  doub Y N 373 
TRP CE3 HE3  sing N N 374 
TRP CZ2 CH2  doub Y N 375 
TRP CZ2 HZ2  sing N N 376 
TRP CZ3 CH2  sing Y N 377 
TRP CZ3 HZ3  sing N N 378 
TRP CH2 HH2  sing N N 379 
TRP OXT HXT  sing N N 380 
TYR N   CA   sing N N 381 
TYR N   H    sing N N 382 
TYR N   H2   sing N N 383 
TYR CA  C    sing N N 384 
TYR CA  CB   sing N N 385 
TYR CA  HA   sing N N 386 
TYR C   O    doub N N 387 
TYR C   OXT  sing N N 388 
TYR CB  CG   sing N N 389 
TYR CB  HB2  sing N N 390 
TYR CB  HB3  sing N N 391 
TYR CG  CD1  doub Y N 392 
TYR CG  CD2  sing Y N 393 
TYR CD1 CE1  sing Y N 394 
TYR CD1 HD1  sing N N 395 
TYR CD2 CE2  doub Y N 396 
TYR CD2 HD2  sing N N 397 
TYR CE1 CZ   doub Y N 398 
TYR CE1 HE1  sing N N 399 
TYR CE2 CZ   sing Y N 400 
TYR CE2 HE2  sing N N 401 
TYR CZ  OH   sing N N 402 
TYR OH  HH   sing N N 403 
TYR OXT HXT  sing N N 404 
VAL N   CA   sing N N 405 
VAL N   H    sing N N 406 
VAL N   H2   sing N N 407 
VAL CA  C    sing N N 408 
VAL CA  CB   sing N N 409 
VAL CA  HA   sing N N 410 
VAL C   O    doub N N 411 
VAL C   OXT  sing N N 412 
VAL CB  CG1  sing N N 413 
VAL CB  CG2  sing N N 414 
VAL CB  HB   sing N N 415 
VAL CG1 HG11 sing N N 416 
VAL CG1 HG12 sing N N 417 
VAL CG1 HG13 sing N N 418 
VAL CG2 HG21 sing N N 419 
VAL CG2 HG22 sing N N 420 
VAL CG2 HG23 sing N N 421 
VAL OXT HXT  sing N N 422 
# 
_pdbx_audit_support.funding_organization   'Russian Science Foundation' 
_pdbx_audit_support.country                'Russian Federation' 
_pdbx_audit_support.grant_number           18-73-10105 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'AVANCE III' 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.details           ? 
# 
_atom_sites.entry_id                    8AO0 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_