data_8AO0 # _entry.id 8AO0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8AO0 pdb_00008ao0 10.2210/pdb8ao0/pdb WWPDB D_1292124780 ? ? BMRB 34746 ? 10.13018/BMR34746 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-23 2 'Structure model' 1 1 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8AO0 _pdbx_database_status.recvd_initial_deposition_date 2022-08-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of nanoFAST/HBR-DOM2 complex' _pdbx_database_related.db_id 34746 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email mineev@nmr.com _pdbx_contact_author.name_first Konstantin _pdbx_contact_author.name_last Mineev _pdbx_contact_author.name_mi S _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2418-9421 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lushpa, V.A.' 1 0000-0002-1788-1153 'Goncharuk, M.V.' 2 0000-0002-6984-7125 'Goncharuk, S.A.' 3 0000-0002-0263-6462 'Baleeva, N.S.' 4 0000-0003-2737-0733 'Baranov, M.S.' 5 0000-0002-9339-7603 'Mineev, K.S.' 6 0000-0002-2418-9421 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 23 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Spatial Structure of NanoFAST in the Apo State and in Complex with its Fluorogen HBR-DOM2.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms231911361 _citation.pdbx_database_id_PubMed 36232662 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lushpa, V.A.' 1 ? primary 'Baleeva, N.S.' 2 ? primary 'Goncharuk, S.A.' 3 0000-0002-0263-6462 primary 'Goncharuk, M.V.' 4 0000-0002-6984-7125 primary 'Arseniev, A.S.' 5 ? primary 'Baranov, M.S.' 6 0000-0002-9339-7603 primary 'Mineev, K.S.' 7 0000-0002-2418-9421 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Photoactive yellow protein' 12489.214 1 ? ? ? ? 2 non-polymer syn '(5~{Z})-5-[(2,5-dimethoxy-4-oxidanyl-phenyl)methylidene]-2-sulfanylidene-1,3-thiazolidin-4-one' 297.350 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PYP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MFGAIQLDGDGNILQYNAA(GGL)GDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFKEGVASGNLNTMFEWMIPTSRGP TKVKVHMKKALSGDSYWVFVKRVKLAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFKEGVASGNLNTMFEWMIPTSRGPTKVK VHMKKALSGDSYWVFVKRVKLAAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '(5~{Z})-5-[(2,5-dimethoxy-4-oxidanyl-phenyl)methylidene]-2-sulfanylidene-1,3-thiazolidin-4-one' _pdbx_entity_nonpoly.comp_id O1F # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 GLY n 1 4 ALA n 1 5 ILE n 1 6 GLN n 1 7 LEU n 1 8 ASP n 1 9 GLY n 1 10 ASP n 1 11 GLY n 1 12 ASN n 1 13 ILE n 1 14 LEU n 1 15 GLN n 1 16 TYR n 1 17 ASN n 1 18 ALA n 1 19 ALA n 1 20 GGL n 1 21 GLY n 1 22 ASP n 1 23 ILE n 1 24 THR n 1 25 GLY n 1 26 ARG n 1 27 ASP n 1 28 PRO n 1 29 LYS n 1 30 GLN n 1 31 VAL n 1 32 ILE n 1 33 GLY n 1 34 LYS n 1 35 ASN n 1 36 PHE n 1 37 PHE n 1 38 LYS n 1 39 ASP n 1 40 VAL n 1 41 ALA n 1 42 PRO n 1 43 GLY n 1 44 THR n 1 45 ASP n 1 46 SER n 1 47 PRO n 1 48 GLU n 1 49 PHE n 1 50 TYR n 1 51 GLY n 1 52 LYS n 1 53 PHE n 1 54 LYS n 1 55 GLU n 1 56 GLY n 1 57 VAL n 1 58 ALA n 1 59 SER n 1 60 GLY n 1 61 ASN n 1 62 LEU n 1 63 ASN n 1 64 THR n 1 65 MET n 1 66 PHE n 1 67 GLU n 1 68 TRP n 1 69 MET n 1 70 ILE n 1 71 PRO n 1 72 THR n 1 73 SER n 1 74 ARG n 1 75 GLY n 1 76 PRO n 1 77 THR n 1 78 LYS n 1 79 VAL n 1 80 LYS n 1 81 VAL n 1 82 HIS n 1 83 MET n 1 84 LYS n 1 85 LYS n 1 86 ALA n 1 87 LEU n 1 88 SER n 1 89 GLY n 1 90 ASP n 1 91 SER n 1 92 TYR n 1 93 TRP n 1 94 VAL n 1 95 PHE n 1 96 VAL n 1 97 LYS n 1 98 ARG n 1 99 VAL n 1 100 LYS n 1 101 LEU n 1 102 ALA n 1 103 ALA n 1 104 ALA n 1 105 LEU n 1 106 GLU n 1 107 HIS n 1 108 HIS n 1 109 HIS n 1 110 HIS n 1 111 HIS n 1 112 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 112 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene pyp _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GGL 'L-gamma-peptide, C-delta linking' . 'GAMMA-L-GLUTAMIC ACID' 'L-GLUTAMIC ACID' 'C5 H9 N O4' 147.129 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 O1F non-polymer . '(5~{Z})-5-[(2,5-dimethoxy-4-oxidanyl-phenyl)methylidene]-2-sulfanylidene-1,3-thiazolidin-4-one' ? 'C12 H11 N O4 S2' 297.350 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GGL 20 20 20 GGL GLP A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 TRP 68 68 68 TRP TRP A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 HIS 112 112 112 HIS HIS A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id O1F _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id O1F _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id O1F _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 123 _pdbx_nonpoly_scheme.pdb_mon_id O1F _pdbx_nonpoly_scheme.auth_mon_id LIG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8AO0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8AO0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8AO0 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 8AO0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 8AO0 _struct.title 'Solution structure of nanoFAST/HBR-DOM2 complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8AO0 _struct_keywords.text ;fluorogen-activating protein, FAST, nanoFAST, spatial structure, dynamics, ligand sepcificity, fluorogen, binding constatnt, FLUORESCENT PROTEIN ; _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYP_HALHA _struct_ref.pdbx_db_accession P16113 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;FGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKV HMKKALSGDSYWVFVKRV ; _struct_ref.pdbx_align_begin 28 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8AO0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16113 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 99 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8AO0 MET A 1 ? UNP P16113 ? ? 'initiating methionine' 1 1 1 8AO0 GGL A 20 ? UNP P16113 GLU 46 conflict 20 2 1 8AO0 GLY A 43 ? UNP P16113 CYS 69 conflict 43 3 1 8AO0 TRP A 68 ? UNP P16113 TYR 94 conflict 68 4 1 8AO0 MET A 69 ? UNP P16113 THR 95 conflict 69 5 1 8AO0 ILE A 70 ? UNP P16113 PHE 96 conflict 70 6 1 8AO0 PRO A 71 ? UNP P16113 ASP 97 conflict 71 7 1 8AO0 THR A 72 ? UNP P16113 TYR 98 conflict 72 8 1 8AO0 SER A 73 ? UNP P16113 GLN 99 conflict 73 9 1 8AO0 ARG A 74 ? UNP P16113 MET 100 conflict 74 10 1 8AO0 GLY A 75 ? UNP P16113 THR 101 conflict 75 11 1 8AO0 LYS A 100 ? UNP P16113 ? ? 'expression tag' 100 12 1 8AO0 LEU A 101 ? UNP P16113 ? ? 'expression tag' 101 13 1 8AO0 ALA A 102 ? UNP P16113 ? ? 'expression tag' 102 14 1 8AO0 ALA A 103 ? UNP P16113 ? ? 'expression tag' 103 15 1 8AO0 ALA A 104 ? UNP P16113 ? ? 'expression tag' 104 16 1 8AO0 LEU A 105 ? UNP P16113 ? ? 'expression tag' 105 17 1 8AO0 GLU A 106 ? UNP P16113 ? ? 'expression tag' 106 18 1 8AO0 HIS A 107 ? UNP P16113 ? ? 'expression tag' 107 19 1 8AO0 HIS A 108 ? UNP P16113 ? ? 'expression tag' 108 20 1 8AO0 HIS A 109 ? UNP P16113 ? ? 'expression tag' 109 21 1 8AO0 HIS A 110 ? UNP P16113 ? ? 'expression tag' 110 22 1 8AO0 HIS A 111 ? UNP P16113 ? ? 'expression tag' 111 23 1 8AO0 HIS A 112 ? UNP P16113 ? ? 'expression tag' 112 24 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' ? 2 1 'NMR relaxation study' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 17 ? GLY A 25 ? ASN A 17 GLY A 25 1 ? 9 HELX_P HELX_P2 AA2 ASP A 27 ? ILE A 32 ? ASP A 27 ILE A 32 1 ? 6 HELX_P HELX_P3 AA3 PHE A 49 ? GLY A 60 ? PHE A 49 GLY A 60 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 19 C ? ? ? 1_555 A GGL 20 N ? ? A ALA 19 A GGL 20 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale2 covale one ? A GGL 20 C ? ? ? 1_555 A GLY 21 N ? ? A GGL 20 A GLY 21 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id GGL _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 20 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id GGL _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 20 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id ? _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id GGL _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Non-standard residue' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 13 ? TYR A 16 ? ILE A 13 TYR A 16 AA1 2 GLY A 3 ? LEU A 7 ? GLY A 3 LEU A 7 AA1 3 TYR A 92 ? ARG A 98 ? TYR A 92 ARG A 98 AA1 4 GLY A 75 ? LYS A 85 ? GLY A 75 LYS A 85 AA1 5 ASN A 63 ? THR A 72 ? ASN A 63 THR A 72 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 14 ? O LEU A 14 N GLN A 6 ? N GLN A 6 AA1 2 3 N LEU A 7 ? N LEU A 7 O TYR A 92 ? O TYR A 92 AA1 3 4 O LYS A 97 ? O LYS A 97 N LYS A 80 ? N LYS A 80 AA1 4 5 O VAL A 79 ? O VAL A 79 N TRP A 68 ? N TRP A 68 # _pdbx_entry_details.entry_id 8AO0 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 39 ? ? -89.71 -71.51 2 1 ASP A 45 ? ? -59.25 97.37 3 1 PHE A 49 ? ? -96.86 -71.12 4 1 ASN A 61 ? ? 179.84 84.14 5 1 ASP A 90 ? ? -142.01 35.85 6 1 ALA A 102 ? ? -54.94 103.70 7 1 HIS A 109 ? ? -55.17 171.92 8 2 ASP A 39 ? ? -90.80 -71.61 9 2 ASP A 45 ? ? -59.35 97.82 10 2 PHE A 49 ? ? -96.38 -68.92 11 2 ASN A 61 ? ? 179.73 86.09 12 2 ALA A 104 ? ? -172.26 109.46 13 2 HIS A 109 ? ? -127.72 -59.56 14 3 ASP A 39 ? ? -90.07 -71.65 15 3 ASP A 45 ? ? -59.11 97.10 16 3 PHE A 49 ? ? -95.81 -71.67 17 3 ASN A 61 ? ? 179.16 90.32 18 3 ALA A 86 ? ? -56.04 172.27 19 3 VAL A 99 ? ? -56.68 176.29 20 3 ALA A 103 ? ? -103.68 -75.28 21 4 ASP A 39 ? ? -91.34 -71.28 22 4 ASP A 45 ? ? -59.35 96.77 23 4 PHE A 49 ? ? -95.37 -69.20 24 4 ASN A 61 ? ? 179.51 83.82 25 4 ASP A 90 ? ? -143.39 35.97 26 4 VAL A 99 ? ? -63.96 -179.73 27 5 ASP A 39 ? ? -89.91 -71.59 28 5 ASP A 45 ? ? -59.10 97.49 29 5 PHE A 49 ? ? -95.63 -68.74 30 5 ASN A 61 ? ? -179.96 81.17 31 6 ASP A 39 ? ? -88.75 -71.54 32 6 ASP A 45 ? ? -59.24 96.88 33 6 PHE A 49 ? ? -99.27 -70.90 34 6 ASN A 61 ? ? 179.03 87.07 35 6 SER A 91 ? ? -179.76 -175.73 36 7 ASP A 39 ? ? -91.78 -71.35 37 7 ASP A 45 ? ? -59.04 97.30 38 7 PHE A 49 ? ? -94.45 -68.42 39 7 ASN A 61 ? ? 179.42 84.54 40 7 ALA A 104 ? ? -60.53 -174.89 41 8 ASP A 39 ? ? -80.84 -71.58 42 8 ASP A 45 ? ? -59.43 97.41 43 8 PHE A 49 ? ? -96.35 -69.29 44 8 ASN A 61 ? ? 179.39 84.46 45 8 GLU A 106 ? ? -104.60 41.55 46 9 ASP A 39 ? ? -79.68 -71.24 47 9 ASP A 45 ? ? -59.62 97.15 48 9 PHE A 49 ? ? -97.40 -69.35 49 9 ASN A 61 ? ? 179.85 85.37 50 10 ASP A 39 ? ? -89.70 -71.55 51 10 ASP A 45 ? ? -59.22 97.41 52 10 PHE A 49 ? ? -96.16 -68.56 53 10 ASN A 61 ? ? 178.94 71.74 54 10 ASP A 90 ? ? -145.23 34.98 55 10 LYS A 100 ? ? -63.53 93.64 56 10 ALA A 103 ? ? -171.84 133.89 57 10 ALA A 104 ? ? -83.52 -74.90 58 11 ARG A 26 ? ? -119.97 -168.05 59 11 ASP A 39 ? ? -92.28 -71.44 60 11 ASP A 45 ? ? -59.16 97.73 61 11 PHE A 49 ? ? -94.45 -68.65 62 11 ASN A 61 ? ? 179.78 83.96 63 12 ASP A 39 ? ? -80.76 -71.77 64 12 ASP A 45 ? ? -59.42 96.97 65 12 PHE A 49 ? ? -94.19 -69.14 66 12 ASN A 61 ? ? -179.93 81.46 67 12 VAL A 99 ? ? -58.61 -176.79 68 12 GLU A 106 ? ? -175.00 123.05 69 13 ARG A 26 ? ? -110.30 -169.05 70 13 ASP A 39 ? ? -90.55 -71.83 71 13 ASP A 45 ? ? -59.21 97.81 72 13 PHE A 49 ? ? -94.27 -68.76 73 13 ASN A 61 ? ? 179.24 88.71 74 13 ASP A 90 ? ? -145.21 35.16 75 13 SER A 91 ? ? -179.77 -179.03 76 14 ASP A 39 ? ? -80.42 -71.50 77 14 ASP A 45 ? ? -58.97 97.72 78 14 PHE A 49 ? ? -99.63 -68.42 79 14 ASN A 61 ? ? 179.34 86.21 80 14 ASP A 90 ? ? -144.09 36.17 81 14 VAL A 99 ? ? -92.74 42.12 82 14 ALA A 104 ? ? -167.21 112.24 83 15 ARG A 26 ? ? -121.02 -168.52 84 15 ASP A 39 ? ? -91.33 -71.56 85 15 ASP A 45 ? ? -59.26 97.44 86 15 PHE A 49 ? ? -94.51 -69.29 87 15 ASN A 61 ? ? 179.71 85.79 88 15 LYS A 100 ? ? -59.09 -179.90 89 16 ASP A 39 ? ? -90.13 -71.42 90 16 ASP A 45 ? ? -59.36 97.38 91 16 PHE A 49 ? ? -94.27 -69.34 92 16 ASN A 61 ? ? 179.42 88.67 93 16 ALA A 86 ? ? -57.86 173.46 94 16 VAL A 99 ? ? -61.68 -179.44 95 17 ASP A 27 ? ? -53.87 109.86 96 17 ASP A 39 ? ? -92.30 -71.51 97 17 ASP A 45 ? ? -59.21 98.00 98 17 PHE A 49 ? ? -95.96 -71.67 99 17 ASN A 61 ? ? 179.75 86.71 100 17 ALA A 102 ? ? -56.84 177.45 101 17 ALA A 103 ? ? -55.25 102.00 102 18 ASP A 39 ? ? -138.02 -70.89 103 18 ALA A 41 ? ? -155.70 86.82 104 18 PHE A 49 ? ? -94.14 -64.30 105 18 ASN A 61 ? ? 179.61 77.13 106 18 HIS A 110 ? ? -132.22 -51.95 107 19 ARG A 26 ? ? -122.74 -169.16 108 19 ASP A 39 ? ? -91.84 -71.57 109 19 ASP A 45 ? ? -59.33 97.28 110 19 PHE A 49 ? ? -94.89 -69.89 111 19 ASN A 61 ? ? 179.24 85.96 112 19 LEU A 105 ? ? -116.50 -74.61 113 19 HIS A 107 ? ? -101.17 -70.36 114 19 HIS A 109 ? ? -116.41 71.79 115 20 ASP A 39 ? ? -91.33 -71.31 116 20 ASP A 45 ? ? -59.48 96.99 117 20 PHE A 49 ? ? -97.01 -69.67 118 20 ASN A 61 ? ? 180.00 90.86 119 20 ALA A 104 ? ? -129.32 -70.59 120 20 LEU A 105 ? ? -163.93 112.82 # _pdbx_nmr_ensemble.entry_id 8AO0 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8AO0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20 mM NaPi, 20 mM sodium chloride, 0.001 % sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '15N, 13C_sample' _pdbx_nmr_sample_details.type solid _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 NaPi 20 ? mM 'natural abundance' 1 'sodium chloride' 20 ? mM 'natural abundance' 1 'sodium azide' 0.001 ? % 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength NULL _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HNCA' 1 isotropic 18 1 1 '3D HN(CO)CA' 1 isotropic 17 1 1 '3D HNCACO' 1 isotropic 16 1 1 '3D TOCSY' 1 isotropic 15 1 1 '3D HCCH-COSY' 1 isotropic 14 1 1 '3D HCCH-TOCSY' 1 isotropic 13 1 1 '3D 1H-13C NOESY' 1 isotropic 12 1 1 '3D 1H-15N NOESY' 1 isotropic 11 1 1 '3D HNCACB' 1 isotropic 10 1 1 hbCBcarHar 1 isotropic # _pdbx_nmr_refine.entry_id 8AO0 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 2 processing TopSpin 3.0 'Bruker Biospin' 3 processing qMDD 3.2 'Maxim Mayzev, Krzysztof Kazimierczuk, Vladislav Orekhov' 4 'peak picking' CARA 1.9.1.7 'Keller and Wuthrich' 5 'chemical shift assignment' CARA 1.9.1.7 'Keller and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GGL N N N N 88 GGL CA C N S 89 GGL C C N N 90 GGL O O N N 91 GGL CB C N N 92 GGL CG C N N 93 GGL CD C N N 94 GGL OE1 O N N 95 GGL OE2 O N N 96 GGL OXT O N N 97 GGL H H N N 98 GGL H2 H N N 99 GGL HA H N N 100 GGL HB2 H N N 101 GGL HB3 H N N 102 GGL HG2 H N N 103 GGL HG3 H N N 104 GGL HE2 H N N 105 GGL HXT H N N 106 GLN N N N N 107 GLN CA C N S 108 GLN C C N N 109 GLN O O N N 110 GLN CB C N N 111 GLN CG C N N 112 GLN CD C N N 113 GLN OE1 O N N 114 GLN NE2 N N N 115 GLN OXT O N N 116 GLN H H N N 117 GLN H2 H N N 118 GLN HA H N N 119 GLN HB2 H N N 120 GLN HB3 H N N 121 GLN HG2 H N N 122 GLN HG3 H N N 123 GLN HE21 H N N 124 GLN HE22 H N N 125 GLN HXT H N N 126 GLU N N N N 127 GLU CA C N S 128 GLU C C N N 129 GLU O O N N 130 GLU CB C N N 131 GLU CG C N N 132 GLU CD C N N 133 GLU OE1 O N N 134 GLU OE2 O N N 135 GLU OXT O N N 136 GLU H H N N 137 GLU H2 H N N 138 GLU HA H N N 139 GLU HB2 H N N 140 GLU HB3 H N N 141 GLU HG2 H N N 142 GLU HG3 H N N 143 GLU HE2 H N N 144 GLU HXT H N N 145 GLY N N N N 146 GLY CA C N N 147 GLY C C N N 148 GLY O O N N 149 GLY OXT O N N 150 GLY H H N N 151 GLY H2 H N N 152 GLY HA2 H N N 153 GLY HA3 H N N 154 GLY HXT H N N 155 HIS N N N N 156 HIS CA C N S 157 HIS C C N N 158 HIS O O N N 159 HIS CB C N N 160 HIS CG C Y N 161 HIS ND1 N Y N 162 HIS CD2 C Y N 163 HIS CE1 C Y N 164 HIS NE2 N Y N 165 HIS OXT O N N 166 HIS H H N N 167 HIS H2 H N N 168 HIS HA H N N 169 HIS HB2 H N N 170 HIS HB3 H N N 171 HIS HD1 H N N 172 HIS HD2 H N N 173 HIS HE1 H N N 174 HIS HE2 H N N 175 HIS HXT H N N 176 ILE N N N N 177 ILE CA C N S 178 ILE C C N N 179 ILE O O N N 180 ILE CB C N S 181 ILE CG1 C N N 182 ILE CG2 C N N 183 ILE CD1 C N N 184 ILE OXT O N N 185 ILE H H N N 186 ILE H2 H N N 187 ILE HA H N N 188 ILE HB H N N 189 ILE HG12 H N N 190 ILE HG13 H N N 191 ILE HG21 H N N 192 ILE HG22 H N N 193 ILE HG23 H N N 194 ILE HD11 H N N 195 ILE HD12 H N N 196 ILE HD13 H N N 197 ILE HXT H N N 198 LEU N N N N 199 LEU CA C N S 200 LEU C C N N 201 LEU O O N N 202 LEU CB C N N 203 LEU CG C N N 204 LEU CD1 C N N 205 LEU CD2 C N N 206 LEU OXT O N N 207 LEU H H N N 208 LEU H2 H N N 209 LEU HA H N N 210 LEU HB2 H N N 211 LEU HB3 H N N 212 LEU HG H N N 213 LEU HD11 H N N 214 LEU HD12 H N N 215 LEU HD13 H N N 216 LEU HD21 H N N 217 LEU HD22 H N N 218 LEU HD23 H N N 219 LEU HXT H N N 220 LYS N N N N 221 LYS CA C N S 222 LYS C C N N 223 LYS O O N N 224 LYS CB C N N 225 LYS CG C N N 226 LYS CD C N N 227 LYS CE C N N 228 LYS NZ N N N 229 LYS OXT O N N 230 LYS H H N N 231 LYS H2 H N N 232 LYS HA H N N 233 LYS HB2 H N N 234 LYS HB3 H N N 235 LYS HG2 H N N 236 LYS HG3 H N N 237 LYS HD2 H N N 238 LYS HD3 H N N 239 LYS HE2 H N N 240 LYS HE3 H N N 241 LYS HZ1 H N N 242 LYS HZ2 H N N 243 LYS HZ3 H N N 244 LYS HXT H N N 245 MET N N N N 246 MET CA C N S 247 MET C C N N 248 MET O O N N 249 MET CB C N N 250 MET CG C N N 251 MET SD S N N 252 MET CE C N N 253 MET OXT O N N 254 MET H H N N 255 MET H2 H N N 256 MET HA H N N 257 MET HB2 H N N 258 MET HB3 H N N 259 MET HG2 H N N 260 MET HG3 H N N 261 MET HE1 H N N 262 MET HE2 H N N 263 MET HE3 H N N 264 MET HXT H N N 265 O1F N1 N N N 266 O1F C4 C N N 267 O1F C5 C Y N 268 O1F C6 C Y N 269 O1F C7 C Y N 270 O1F C8 C Y N 271 O1F C10 C N N 272 O1F C1 C N N 273 O1F O3 O N N 274 O1F O1 O N N 275 O1F C9 C Y N 276 O1F O4 O N N 277 O1F C2 C N N 278 O1F C3 C Y N 279 O1F S2 S N N 280 O1F C12 C N N 281 O1F S1 S N N 282 O1F C11 C N N 283 O1F O2 O N N 284 O1F H8 H N N 285 O1F H45 H N N 286 O1F H21 H N N 287 O1F H332 H N N 288 O1F H333 H N N 289 O1F H331 H N N 290 O1F H1 H N N 291 O1F H231 H N N 292 O1F H232 H N N 293 O1F H233 H N N 294 O1F H32 H N N 295 PHE N N N N 296 PHE CA C N S 297 PHE C C N N 298 PHE O O N N 299 PHE CB C N N 300 PHE CG C Y N 301 PHE CD1 C Y N 302 PHE CD2 C Y N 303 PHE CE1 C Y N 304 PHE CE2 C Y N 305 PHE CZ C Y N 306 PHE OXT O N N 307 PHE H H N N 308 PHE H2 H N N 309 PHE HA H N N 310 PHE HB2 H N N 311 PHE HB3 H N N 312 PHE HD1 H N N 313 PHE HD2 H N N 314 PHE HE1 H N N 315 PHE HE2 H N N 316 PHE HZ H N N 317 PHE HXT H N N 318 PRO N N N N 319 PRO CA C N S 320 PRO C C N N 321 PRO O O N N 322 PRO CB C N N 323 PRO CG C N N 324 PRO CD C N N 325 PRO OXT O N N 326 PRO H H N N 327 PRO HA H N N 328 PRO HB2 H N N 329 PRO HB3 H N N 330 PRO HG2 H N N 331 PRO HG3 H N N 332 PRO HD2 H N N 333 PRO HD3 H N N 334 PRO HXT H N N 335 SER N N N N 336 SER CA C N S 337 SER C C N N 338 SER O O N N 339 SER CB C N N 340 SER OG O N N 341 SER OXT O N N 342 SER H H N N 343 SER H2 H N N 344 SER HA H N N 345 SER HB2 H N N 346 SER HB3 H N N 347 SER HG H N N 348 SER HXT H N N 349 THR N N N N 350 THR CA C N S 351 THR C C N N 352 THR O O N N 353 THR CB C N R 354 THR OG1 O N N 355 THR CG2 C N N 356 THR OXT O N N 357 THR H H N N 358 THR H2 H N N 359 THR HA H N N 360 THR HB H N N 361 THR HG1 H N N 362 THR HG21 H N N 363 THR HG22 H N N 364 THR HG23 H N N 365 THR HXT H N N 366 TRP N N N N 367 TRP CA C N S 368 TRP C C N N 369 TRP O O N N 370 TRP CB C N N 371 TRP CG C Y N 372 TRP CD1 C Y N 373 TRP CD2 C Y N 374 TRP NE1 N Y N 375 TRP CE2 C Y N 376 TRP CE3 C Y N 377 TRP CZ2 C Y N 378 TRP CZ3 C Y N 379 TRP CH2 C Y N 380 TRP OXT O N N 381 TRP H H N N 382 TRP H2 H N N 383 TRP HA H N N 384 TRP HB2 H N N 385 TRP HB3 H N N 386 TRP HD1 H N N 387 TRP HE1 H N N 388 TRP HE3 H N N 389 TRP HZ2 H N N 390 TRP HZ3 H N N 391 TRP HH2 H N N 392 TRP HXT H N N 393 TYR N N N N 394 TYR CA C N S 395 TYR C C N N 396 TYR O O N N 397 TYR CB C N N 398 TYR CG C Y N 399 TYR CD1 C Y N 400 TYR CD2 C Y N 401 TYR CE1 C Y N 402 TYR CE2 C Y N 403 TYR CZ C Y N 404 TYR OH O N N 405 TYR OXT O N N 406 TYR H H N N 407 TYR H2 H N N 408 TYR HA H N N 409 TYR HB2 H N N 410 TYR HB3 H N N 411 TYR HD1 H N N 412 TYR HD2 H N N 413 TYR HE1 H N N 414 TYR HE2 H N N 415 TYR HH H N N 416 TYR HXT H N N 417 VAL N N N N 418 VAL CA C N S 419 VAL C C N N 420 VAL O O N N 421 VAL CB C N N 422 VAL CG1 C N N 423 VAL CG2 C N N 424 VAL OXT O N N 425 VAL H H N N 426 VAL H2 H N N 427 VAL HA H N N 428 VAL HB H N N 429 VAL HG11 H N N 430 VAL HG12 H N N 431 VAL HG13 H N N 432 VAL HG21 H N N 433 VAL HG22 H N N 434 VAL HG23 H N N 435 VAL HXT H N N 436 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GGL N CA sing N N 83 GGL N H sing N N 84 GGL N H2 sing N N 85 GGL CA C sing N N 86 GGL CA CB sing N N 87 GGL CA HA sing N N 88 GGL C O doub N N 89 GGL C OXT sing N N 90 GGL CB CG sing N N 91 GGL CB HB2 sing N N 92 GGL CB HB3 sing N N 93 GGL CG CD sing N N 94 GGL CG HG2 sing N N 95 GGL CG HG3 sing N N 96 GGL CD OE1 doub N N 97 GGL CD OE2 sing N N 98 GGL OE2 HE2 sing N N 99 GGL OXT HXT sing N N 100 GLN N CA sing N N 101 GLN N H sing N N 102 GLN N H2 sing N N 103 GLN CA C sing N N 104 GLN CA CB sing N N 105 GLN CA HA sing N N 106 GLN C O doub N N 107 GLN C OXT sing N N 108 GLN CB CG sing N N 109 GLN CB HB2 sing N N 110 GLN CB HB3 sing N N 111 GLN CG CD sing N N 112 GLN CG HG2 sing N N 113 GLN CG HG3 sing N N 114 GLN CD OE1 doub N N 115 GLN CD NE2 sing N N 116 GLN NE2 HE21 sing N N 117 GLN NE2 HE22 sing N N 118 GLN OXT HXT sing N N 119 GLU N CA sing N N 120 GLU N H sing N N 121 GLU N H2 sing N N 122 GLU CA C sing N N 123 GLU CA CB sing N N 124 GLU CA HA sing N N 125 GLU C O doub N N 126 GLU C OXT sing N N 127 GLU CB CG sing N N 128 GLU CB HB2 sing N N 129 GLU CB HB3 sing N N 130 GLU CG CD sing N N 131 GLU CG HG2 sing N N 132 GLU CG HG3 sing N N 133 GLU CD OE1 doub N N 134 GLU CD OE2 sing N N 135 GLU OE2 HE2 sing N N 136 GLU OXT HXT sing N N 137 GLY N CA sing N N 138 GLY N H sing N N 139 GLY N H2 sing N N 140 GLY CA C sing N N 141 GLY CA HA2 sing N N 142 GLY CA HA3 sing N N 143 GLY C O doub N N 144 GLY C OXT sing N N 145 GLY OXT HXT sing N N 146 HIS N CA sing N N 147 HIS N H sing N N 148 HIS N H2 sing N N 149 HIS CA C sing N N 150 HIS CA CB sing N N 151 HIS CA HA sing N N 152 HIS C O doub N N 153 HIS C OXT sing N N 154 HIS CB CG sing N N 155 HIS CB HB2 sing N N 156 HIS CB HB3 sing N N 157 HIS CG ND1 sing Y N 158 HIS CG CD2 doub Y N 159 HIS ND1 CE1 doub Y N 160 HIS ND1 HD1 sing N N 161 HIS CD2 NE2 sing Y N 162 HIS CD2 HD2 sing N N 163 HIS CE1 NE2 sing Y N 164 HIS CE1 HE1 sing N N 165 HIS NE2 HE2 sing N N 166 HIS OXT HXT sing N N 167 ILE N CA sing N N 168 ILE N H sing N N 169 ILE N H2 sing N N 170 ILE CA C sing N N 171 ILE CA CB sing N N 172 ILE CA HA sing N N 173 ILE C O doub N N 174 ILE C OXT sing N N 175 ILE CB CG1 sing N N 176 ILE CB CG2 sing N N 177 ILE CB HB sing N N 178 ILE CG1 CD1 sing N N 179 ILE CG1 HG12 sing N N 180 ILE CG1 HG13 sing N N 181 ILE CG2 HG21 sing N N 182 ILE CG2 HG22 sing N N 183 ILE CG2 HG23 sing N N 184 ILE CD1 HD11 sing N N 185 ILE CD1 HD12 sing N N 186 ILE CD1 HD13 sing N N 187 ILE OXT HXT sing N N 188 LEU N CA sing N N 189 LEU N H sing N N 190 LEU N H2 sing N N 191 LEU CA C sing N N 192 LEU CA CB sing N N 193 LEU CA HA sing N N 194 LEU C O doub N N 195 LEU C OXT sing N N 196 LEU CB CG sing N N 197 LEU CB HB2 sing N N 198 LEU CB HB3 sing N N 199 LEU CG CD1 sing N N 200 LEU CG CD2 sing N N 201 LEU CG HG sing N N 202 LEU CD1 HD11 sing N N 203 LEU CD1 HD12 sing N N 204 LEU CD1 HD13 sing N N 205 LEU CD2 HD21 sing N N 206 LEU CD2 HD22 sing N N 207 LEU CD2 HD23 sing N N 208 LEU OXT HXT sing N N 209 LYS N CA sing N N 210 LYS N H sing N N 211 LYS N H2 sing N N 212 LYS CA C sing N N 213 LYS CA CB sing N N 214 LYS CA HA sing N N 215 LYS C O doub N N 216 LYS C OXT sing N N 217 LYS CB CG sing N N 218 LYS CB HB2 sing N N 219 LYS CB HB3 sing N N 220 LYS CG CD sing N N 221 LYS CG HG2 sing N N 222 LYS CG HG3 sing N N 223 LYS CD CE sing N N 224 LYS CD HD2 sing N N 225 LYS CD HD3 sing N N 226 LYS CE NZ sing N N 227 LYS CE HE2 sing N N 228 LYS CE HE3 sing N N 229 LYS NZ HZ1 sing N N 230 LYS NZ HZ2 sing N N 231 LYS NZ HZ3 sing N N 232 LYS OXT HXT sing N N 233 MET N CA sing N N 234 MET N H sing N N 235 MET N H2 sing N N 236 MET CA C sing N N 237 MET CA CB sing N N 238 MET CA HA sing N N 239 MET C O doub N N 240 MET C OXT sing N N 241 MET CB CG sing N N 242 MET CB HB2 sing N N 243 MET CB HB3 sing N N 244 MET CG SD sing N N 245 MET CG HG2 sing N N 246 MET CG HG3 sing N N 247 MET SD CE sing N N 248 MET CE HE1 sing N N 249 MET CE HE2 sing N N 250 MET CE HE3 sing N N 251 MET OXT HXT sing N N 252 O1F C2 O4 sing N N 253 O1F O4 C9 sing N N 254 O1F S1 C12 doub N N 255 O1F C9 C3 doub Y N 256 O1F C9 C7 sing Y N 257 O1F S2 C12 sing N N 258 O1F S2 C10 sing N N 259 O1F C12 N1 sing N N 260 O1F C3 C6 sing Y N 261 O1F O1 C7 sing N N 262 O1F C7 C5 doub Y N 263 O1F C10 C4 doub N Z 264 O1F C10 C11 sing N N 265 O1F N1 C11 sing N N 266 O1F C6 C4 sing N N 267 O1F C6 C8 doub Y N 268 O1F C5 C8 sing Y N 269 O1F C11 O2 doub N N 270 O1F C8 O3 sing N N 271 O1F O3 C1 sing N N 272 O1F N1 H8 sing N N 273 O1F C4 H45 sing N N 274 O1F C5 H21 sing N N 275 O1F C1 H332 sing N N 276 O1F C1 H333 sing N N 277 O1F C1 H331 sing N N 278 O1F O1 H1 sing N N 279 O1F C2 H231 sing N N 280 O1F C2 H232 sing N N 281 O1F C2 H233 sing N N 282 O1F C3 H32 sing N N 283 PHE N CA sing N N 284 PHE N H sing N N 285 PHE N H2 sing N N 286 PHE CA C sing N N 287 PHE CA CB sing N N 288 PHE CA HA sing N N 289 PHE C O doub N N 290 PHE C OXT sing N N 291 PHE CB CG sing N N 292 PHE CB HB2 sing N N 293 PHE CB HB3 sing N N 294 PHE CG CD1 doub Y N 295 PHE CG CD2 sing Y N 296 PHE CD1 CE1 sing Y N 297 PHE CD1 HD1 sing N N 298 PHE CD2 CE2 doub Y N 299 PHE CD2 HD2 sing N N 300 PHE CE1 CZ doub Y N 301 PHE CE1 HE1 sing N N 302 PHE CE2 CZ sing Y N 303 PHE CE2 HE2 sing N N 304 PHE CZ HZ sing N N 305 PHE OXT HXT sing N N 306 PRO N CA sing N N 307 PRO N CD sing N N 308 PRO N H sing N N 309 PRO CA C sing N N 310 PRO CA CB sing N N 311 PRO CA HA sing N N 312 PRO C O doub N N 313 PRO C OXT sing N N 314 PRO CB CG sing N N 315 PRO CB HB2 sing N N 316 PRO CB HB3 sing N N 317 PRO CG CD sing N N 318 PRO CG HG2 sing N N 319 PRO CG HG3 sing N N 320 PRO CD HD2 sing N N 321 PRO CD HD3 sing N N 322 PRO OXT HXT sing N N 323 SER N CA sing N N 324 SER N H sing N N 325 SER N H2 sing N N 326 SER CA C sing N N 327 SER CA CB sing N N 328 SER CA HA sing N N 329 SER C O doub N N 330 SER C OXT sing N N 331 SER CB OG sing N N 332 SER CB HB2 sing N N 333 SER CB HB3 sing N N 334 SER OG HG sing N N 335 SER OXT HXT sing N N 336 THR N CA sing N N 337 THR N H sing N N 338 THR N H2 sing N N 339 THR CA C sing N N 340 THR CA CB sing N N 341 THR CA HA sing N N 342 THR C O doub N N 343 THR C OXT sing N N 344 THR CB OG1 sing N N 345 THR CB CG2 sing N N 346 THR CB HB sing N N 347 THR OG1 HG1 sing N N 348 THR CG2 HG21 sing N N 349 THR CG2 HG22 sing N N 350 THR CG2 HG23 sing N N 351 THR OXT HXT sing N N 352 TRP N CA sing N N 353 TRP N H sing N N 354 TRP N H2 sing N N 355 TRP CA C sing N N 356 TRP CA CB sing N N 357 TRP CA HA sing N N 358 TRP C O doub N N 359 TRP C OXT sing N N 360 TRP CB CG sing N N 361 TRP CB HB2 sing N N 362 TRP CB HB3 sing N N 363 TRP CG CD1 doub Y N 364 TRP CG CD2 sing Y N 365 TRP CD1 NE1 sing Y N 366 TRP CD1 HD1 sing N N 367 TRP CD2 CE2 doub Y N 368 TRP CD2 CE3 sing Y N 369 TRP NE1 CE2 sing Y N 370 TRP NE1 HE1 sing N N 371 TRP CE2 CZ2 sing Y N 372 TRP CE3 CZ3 doub Y N 373 TRP CE3 HE3 sing N N 374 TRP CZ2 CH2 doub Y N 375 TRP CZ2 HZ2 sing N N 376 TRP CZ3 CH2 sing Y N 377 TRP CZ3 HZ3 sing N N 378 TRP CH2 HH2 sing N N 379 TRP OXT HXT sing N N 380 TYR N CA sing N N 381 TYR N H sing N N 382 TYR N H2 sing N N 383 TYR CA C sing N N 384 TYR CA CB sing N N 385 TYR CA HA sing N N 386 TYR C O doub N N 387 TYR C OXT sing N N 388 TYR CB CG sing N N 389 TYR CB HB2 sing N N 390 TYR CB HB3 sing N N 391 TYR CG CD1 doub Y N 392 TYR CG CD2 sing Y N 393 TYR CD1 CE1 sing Y N 394 TYR CD1 HD1 sing N N 395 TYR CD2 CE2 doub Y N 396 TYR CD2 HD2 sing N N 397 TYR CE1 CZ doub Y N 398 TYR CE1 HE1 sing N N 399 TYR CE2 CZ sing Y N 400 TYR CE2 HE2 sing N N 401 TYR CZ OH sing N N 402 TYR OH HH sing N N 403 TYR OXT HXT sing N N 404 VAL N CA sing N N 405 VAL N H sing N N 406 VAL N H2 sing N N 407 VAL CA C sing N N 408 VAL CA CB sing N N 409 VAL CA HA sing N N 410 VAL C O doub N N 411 VAL C OXT sing N N 412 VAL CB CG1 sing N N 413 VAL CB CG2 sing N N 414 VAL CB HB sing N N 415 VAL CG1 HG11 sing N N 416 VAL CG1 HG12 sing N N 417 VAL CG1 HG13 sing N N 418 VAL CG2 HG21 sing N N 419 VAL CG2 HG22 sing N N 420 VAL CG2 HG23 sing N N 421 VAL OXT HXT sing N N 422 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 18-73-10105 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8AO0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_