data_8AR2 # _entry.id 8AR2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8AR2 pdb_00008ar2 10.2210/pdb8ar2/pdb WWPDB D_1292124455 ? ? BMRB 34752 ? 10.13018/BMR34752 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-22 2 'Structure model' 1 1 2023-03-29 3 'Structure model' 1 2 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation_author.name' 11 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8AR2 _pdbx_database_status.recvd_initial_deposition_date 2022-08-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of TLR5 transmembrane and cytoplasmic juxtamembrane regions' _pdbx_database_related.db_id 34752 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email mineev@nmr.ru _pdbx_contact_author.name_first Konstantin _pdbx_contact_author.name_last Mineev _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2418-9421 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Shabalkina, A.V.' 1 ? 'Kornilov, F.D.' 2 ? 'Goncharuk, M.V.' 3 ? 'Goncharuk, S.A.' 4 ? 'Arseniev, A.S.' 5 ? 'Mineev, K.S.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 1503 _citation.page_last 1503 _citation.title 'The architecture of transmembrane and cytoplasmic juxtamembrane regions of Toll-like receptors.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-023-37042-6 _citation.pdbx_database_id_PubMed 36932058 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kornilov, F.D.' 1 ? primary 'Shabalkina, A.V.' 2 ? primary 'Lin, C.' 3 ? primary 'Volynsky, P.E.' 4 ? primary 'Kot, E.F.' 5 ? primary 'Kayushin, A.L.' 6 ? primary 'Lushpa, V.A.' 7 ? primary 'Goncharuk, M.V.' 8 ? primary 'Arseniev, A.S.' 9 ? primary 'Goncharuk, S.A.' 10 ? primary 'Wang, X.' 11 ? primary 'Mineev, K.S.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Toll-like receptor 5' _entity.formula_weight 5880.270 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Toll/interleukin-1 receptor-like protein 3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MEEVLKSLKFSLFIVCTVTLTLFLMTILTVTKFRGFCFICYKTAQRLVFK _entity_poly.pdbx_seq_one_letter_code_can MEEVLKSLKFSLFIVCTVTLTLFLMTILTVTKFRGFCFICYKTAQRLVFK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 GLU n 1 4 VAL n 1 5 LEU n 1 6 LYS n 1 7 SER n 1 8 LEU n 1 9 LYS n 1 10 PHE n 1 11 SER n 1 12 LEU n 1 13 PHE n 1 14 ILE n 1 15 VAL n 1 16 CYS n 1 17 THR n 1 18 VAL n 1 19 THR n 1 20 LEU n 1 21 THR n 1 22 LEU n 1 23 PHE n 1 24 LEU n 1 25 MET n 1 26 THR n 1 27 ILE n 1 28 LEU n 1 29 THR n 1 30 VAL n 1 31 THR n 1 32 LYS n 1 33 PHE n 1 34 ARG n 1 35 GLY n 1 36 PHE n 1 37 CYS n 1 38 PHE n 1 39 ILE n 1 40 CYS n 1 41 TYR n 1 42 LYS n 1 43 THR n 1 44 ALA n 1 45 GLN n 1 46 ARG n 1 47 LEU n 1 48 VAL n 1 49 PHE n 1 50 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 50 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TLR5, TIL3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 631 631 MET MET A . n A 1 2 GLU 2 632 632 GLU GLU A . n A 1 3 GLU 3 633 633 GLU GLU A . n A 1 4 VAL 4 634 634 VAL VAL A . n A 1 5 LEU 5 635 635 LEU LEU A . n A 1 6 LYS 6 636 636 LYS LYS A . n A 1 7 SER 7 637 637 SER SER A . n A 1 8 LEU 8 638 638 LEU LEU A . n A 1 9 LYS 9 639 639 LYS LYS A . n A 1 10 PHE 10 640 640 PHE PHE A . n A 1 11 SER 11 641 641 SER SER A . n A 1 12 LEU 12 642 642 LEU LEU A . n A 1 13 PHE 13 643 643 PHE PHE A . n A 1 14 ILE 14 644 644 ILE ILE A . n A 1 15 VAL 15 645 645 VAL VAL A . n A 1 16 CYS 16 646 646 CYS CYS A . n A 1 17 THR 17 647 647 THR THR A . n A 1 18 VAL 18 648 648 VAL VAL A . n A 1 19 THR 19 649 649 THR THR A . n A 1 20 LEU 20 650 650 LEU LEU A . n A 1 21 THR 21 651 651 THR THR A . n A 1 22 LEU 22 652 652 LEU LEU A . n A 1 23 PHE 23 653 653 PHE PHE A . n A 1 24 LEU 24 654 654 LEU LEU A . n A 1 25 MET 25 655 655 MET MET A . n A 1 26 THR 26 656 656 THR THR A . n A 1 27 ILE 27 657 657 ILE ILE A . n A 1 28 LEU 28 658 658 LEU LEU A . n A 1 29 THR 29 659 659 THR THR A . n A 1 30 VAL 30 660 660 VAL VAL A . n A 1 31 THR 31 661 661 THR THR A . n A 1 32 LYS 32 662 662 LYS LYS A . n A 1 33 PHE 33 663 663 PHE PHE A . n A 1 34 ARG 34 664 664 ARG ARG A . n A 1 35 GLY 35 665 665 GLY GLY A . n A 1 36 PHE 36 666 666 PHE PHE A . n A 1 37 CYS 37 667 667 CYS CYS A . n A 1 38 PHE 38 668 668 PHE PHE A . n A 1 39 ILE 39 669 669 ILE ILE A . n A 1 40 CYS 40 670 670 CYS CYS A . n A 1 41 TYR 41 671 671 TYR TYR A . n A 1 42 LYS 42 672 672 LYS LYS A . n A 1 43 THR 43 673 673 THR THR A . n A 1 44 ALA 44 674 674 ALA ALA A . n A 1 45 GLN 45 675 675 GLN GLN A . n A 1 46 ARG 46 676 676 ARG ARG A . n A 1 47 LEU 47 677 677 LEU LEU A . n A 1 48 VAL 48 678 678 VAL VAL A . n A 1 49 PHE 49 679 679 PHE PHE A . n A 1 50 LYS 50 680 680 LYS LYS A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8AR2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8AR2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8AR2 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 8AR2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 8AR2 _struct.title 'Solution structure of TLR5 transmembrane and cytoplasmic juxtamembrane regions' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8AR2 _struct_keywords.text 'PROTEIN, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TLR5_HUMAN _struct_ref.pdbx_db_accession O60602 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EEVLKSLKFSLFIVCTVTLTLFLMTILTVTKFRGFCFICYKTAQRLVFK _struct_ref.pdbx_align_begin 632 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8AR2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O60602 _struct_ref_seq.db_align_beg 632 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 680 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 632 _struct_ref_seq.pdbx_auth_seq_align_end 680 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8AR2 _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O60602 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 631 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'NMR Distance Restraints' 'no extra NOE peaks' 2 1 'NMR relaxation study' 'values of tau c of alpha helix residues conform to monomer assembly' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id MET _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 1 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 49 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id MET _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 631 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 679 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 49 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 679 ? ? 51.29 73.27 2 9 PHE A 679 ? ? -63.67 -71.89 3 10 PHE A 679 ? ? -57.08 -177.09 # _pdbx_nmr_ensemble.entry_id 8AR2 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8AR2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;1000 uM [U-13C; U-15N] protein, 220 mM [U-2H] DPC, 20 mM potassium phosphate, 4 mM TCEP, 0.05 % w/v sodium azide, 1 mM TSP, 95% H2O/5% D2O ; '95% H2O/5% D2O' 15N13C_sample micelle ? 2 ;180 uM [U-15N] protein, 40 mM DPC, 30 mM potassium phosphate, 4 mM TCEP, 0.05 % w/v sodium azide, 1 mM TSP, 30 mg/mL dGpG, 100 mM potassium chloride, 95% H2O/5% D2O ; '95% H2O/5% D2O' 15N_sample_forRDC micelle ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 protein 1000 ? uM '[U-13C; U-15N]' 1 DPC 220 ? mM '[U-2H]' 1 'potassium phosphate' 20 ? mM 'natural abundance' 1 TCEP 4 ? mM 'natural abundance' 1 'sodium azide' 0.05 ? '% w/v' 'natural abundance' 1 TSP 1 ? mM 'natural abundance' 2 protein 180 ? uM '[U-15N]' 2 DPC 40 ? mM 'natural abundance' 2 'potassium phosphate' 30 ? mM 'natural abundance' 2 TCEP 4 ? mM 'natural abundance' 2 'sodium azide' 0.05 ? '% w/v' 'natural abundance' 2 TSP 1 ? mM 'natural abundance' 2 dGpG 30 ? mg/mL 'natural abundance' 2 'potassium chloride' 100 ? mM 'natural abundance' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 313 atm AMBIENT 6.0 50 ? ? mM conditions_main 0.1 pH ? ? K 2 318 atm AMBIENT 6.0 160 ? ? mM conditions_RDC 0.1 pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic constant time' 1 isotropic 3 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 4 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 5 1 1 '3D HNCO' 1 isotropic 6 1 1 '3D HNCA' 1 isotropic 7 1 1 '3D HN(CO)CA' 1 isotropic 8 1 1 '3D HCCH-TOCSY' 1 isotropic 9 1 1 '3D hCCH-TOCSY constant time' 1 isotropic 10 1 1 '3D 1H-15N NOESY' 1 isotropic 11 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 12 1 1 '3D 1H-13C NOESY aliphatic constant time' 1 isotropic 13 1 1 '2D CBHD aromatic' 1 isotropic 14 1 1 '3D hCCH-COSY aromatic' 1 isotropic 15 1 1 '2D CGCO' 1 isotropic 16 1 1 '2D CGN' 1 isotropic 17 2 2 '2D 1H-15N HSQC' 2 anisotropic 18 2 2 '2D 1H-15N IPAP-HSQC' 2 anisotropic # _pdbx_nmr_refine.entry_id 8AR2 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 2 processing TopSpin 3.0 'Bruker Biospin' 3 'chemical shift assignment' CARA 1.9.7.1 'Keller and Wuthrich' 4 'peak picking' CARA 1.9.7.1 'Keller and Wuthrich' 5 processing qMDD 3.2 'Maxim Mayzel, Krzysztof Kazimierczuk, Vladislav Orekhov' 6 'data analysis' MOLMOL ? 'Koradi, Billeter and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 CYS N N N N 41 CYS CA C N R 42 CYS C C N N 43 CYS O O N N 44 CYS CB C N N 45 CYS SG S N N 46 CYS OXT O N N 47 CYS H H N N 48 CYS H2 H N N 49 CYS HA H N N 50 CYS HB2 H N N 51 CYS HB3 H N N 52 CYS HG H N N 53 CYS HXT H N N 54 GLN N N N N 55 GLN CA C N S 56 GLN C C N N 57 GLN O O N N 58 GLN CB C N N 59 GLN CG C N N 60 GLN CD C N N 61 GLN OE1 O N N 62 GLN NE2 N N N 63 GLN OXT O N N 64 GLN H H N N 65 GLN H2 H N N 66 GLN HA H N N 67 GLN HB2 H N N 68 GLN HB3 H N N 69 GLN HG2 H N N 70 GLN HG3 H N N 71 GLN HE21 H N N 72 GLN HE22 H N N 73 GLN HXT H N N 74 GLU N N N N 75 GLU CA C N S 76 GLU C C N N 77 GLU O O N N 78 GLU CB C N N 79 GLU CG C N N 80 GLU CD C N N 81 GLU OE1 O N N 82 GLU OE2 O N N 83 GLU OXT O N N 84 GLU H H N N 85 GLU H2 H N N 86 GLU HA H N N 87 GLU HB2 H N N 88 GLU HB3 H N N 89 GLU HG2 H N N 90 GLU HG3 H N N 91 GLU HE2 H N N 92 GLU HXT H N N 93 GLY N N N N 94 GLY CA C N N 95 GLY C C N N 96 GLY O O N N 97 GLY OXT O N N 98 GLY H H N N 99 GLY H2 H N N 100 GLY HA2 H N N 101 GLY HA3 H N N 102 GLY HXT H N N 103 ILE N N N N 104 ILE CA C N S 105 ILE C C N N 106 ILE O O N N 107 ILE CB C N S 108 ILE CG1 C N N 109 ILE CG2 C N N 110 ILE CD1 C N N 111 ILE OXT O N N 112 ILE H H N N 113 ILE H2 H N N 114 ILE HA H N N 115 ILE HB H N N 116 ILE HG12 H N N 117 ILE HG13 H N N 118 ILE HG21 H N N 119 ILE HG22 H N N 120 ILE HG23 H N N 121 ILE HD11 H N N 122 ILE HD12 H N N 123 ILE HD13 H N N 124 ILE HXT H N N 125 LEU N N N N 126 LEU CA C N S 127 LEU C C N N 128 LEU O O N N 129 LEU CB C N N 130 LEU CG C N N 131 LEU CD1 C N N 132 LEU CD2 C N N 133 LEU OXT O N N 134 LEU H H N N 135 LEU H2 H N N 136 LEU HA H N N 137 LEU HB2 H N N 138 LEU HB3 H N N 139 LEU HG H N N 140 LEU HD11 H N N 141 LEU HD12 H N N 142 LEU HD13 H N N 143 LEU HD21 H N N 144 LEU HD22 H N N 145 LEU HD23 H N N 146 LEU HXT H N N 147 LYS N N N N 148 LYS CA C N S 149 LYS C C N N 150 LYS O O N N 151 LYS CB C N N 152 LYS CG C N N 153 LYS CD C N N 154 LYS CE C N N 155 LYS NZ N N N 156 LYS OXT O N N 157 LYS H H N N 158 LYS H2 H N N 159 LYS HA H N N 160 LYS HB2 H N N 161 LYS HB3 H N N 162 LYS HG2 H N N 163 LYS HG3 H N N 164 LYS HD2 H N N 165 LYS HD3 H N N 166 LYS HE2 H N N 167 LYS HE3 H N N 168 LYS HZ1 H N N 169 LYS HZ2 H N N 170 LYS HZ3 H N N 171 LYS HXT H N N 172 MET N N N N 173 MET CA C N S 174 MET C C N N 175 MET O O N N 176 MET CB C N N 177 MET CG C N N 178 MET SD S N N 179 MET CE C N N 180 MET OXT O N N 181 MET H H N N 182 MET H2 H N N 183 MET HA H N N 184 MET HB2 H N N 185 MET HB3 H N N 186 MET HG2 H N N 187 MET HG3 H N N 188 MET HE1 H N N 189 MET HE2 H N N 190 MET HE3 H N N 191 MET HXT H N N 192 PHE N N N N 193 PHE CA C N S 194 PHE C C N N 195 PHE O O N N 196 PHE CB C N N 197 PHE CG C Y N 198 PHE CD1 C Y N 199 PHE CD2 C Y N 200 PHE CE1 C Y N 201 PHE CE2 C Y N 202 PHE CZ C Y N 203 PHE OXT O N N 204 PHE H H N N 205 PHE H2 H N N 206 PHE HA H N N 207 PHE HB2 H N N 208 PHE HB3 H N N 209 PHE HD1 H N N 210 PHE HD2 H N N 211 PHE HE1 H N N 212 PHE HE2 H N N 213 PHE HZ H N N 214 PHE HXT H N N 215 SER N N N N 216 SER CA C N S 217 SER C C N N 218 SER O O N N 219 SER CB C N N 220 SER OG O N N 221 SER OXT O N N 222 SER H H N N 223 SER H2 H N N 224 SER HA H N N 225 SER HB2 H N N 226 SER HB3 H N N 227 SER HG H N N 228 SER HXT H N N 229 THR N N N N 230 THR CA C N S 231 THR C C N N 232 THR O O N N 233 THR CB C N R 234 THR OG1 O N N 235 THR CG2 C N N 236 THR OXT O N N 237 THR H H N N 238 THR H2 H N N 239 THR HA H N N 240 THR HB H N N 241 THR HG1 H N N 242 THR HG21 H N N 243 THR HG22 H N N 244 THR HG23 H N N 245 THR HXT H N N 246 TYR N N N N 247 TYR CA C N S 248 TYR C C N N 249 TYR O O N N 250 TYR CB C N N 251 TYR CG C Y N 252 TYR CD1 C Y N 253 TYR CD2 C Y N 254 TYR CE1 C Y N 255 TYR CE2 C Y N 256 TYR CZ C Y N 257 TYR OH O N N 258 TYR OXT O N N 259 TYR H H N N 260 TYR H2 H N N 261 TYR HA H N N 262 TYR HB2 H N N 263 TYR HB3 H N N 264 TYR HD1 H N N 265 TYR HD2 H N N 266 TYR HE1 H N N 267 TYR HE2 H N N 268 TYR HH H N N 269 TYR HXT H N N 270 VAL N N N N 271 VAL CA C N S 272 VAL C C N N 273 VAL O O N N 274 VAL CB C N N 275 VAL CG1 C N N 276 VAL CG2 C N N 277 VAL OXT O N N 278 VAL H H N N 279 VAL H2 H N N 280 VAL HA H N N 281 VAL HB H N N 282 VAL HG11 H N N 283 VAL HG12 H N N 284 VAL HG13 H N N 285 VAL HG21 H N N 286 VAL HG22 H N N 287 VAL HG23 H N N 288 VAL HXT H N N 289 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 CYS N CA sing N N 39 CYS N H sing N N 40 CYS N H2 sing N N 41 CYS CA C sing N N 42 CYS CA CB sing N N 43 CYS CA HA sing N N 44 CYS C O doub N N 45 CYS C OXT sing N N 46 CYS CB SG sing N N 47 CYS CB HB2 sing N N 48 CYS CB HB3 sing N N 49 CYS SG HG sing N N 50 CYS OXT HXT sing N N 51 GLN N CA sing N N 52 GLN N H sing N N 53 GLN N H2 sing N N 54 GLN CA C sing N N 55 GLN CA CB sing N N 56 GLN CA HA sing N N 57 GLN C O doub N N 58 GLN C OXT sing N N 59 GLN CB CG sing N N 60 GLN CB HB2 sing N N 61 GLN CB HB3 sing N N 62 GLN CG CD sing N N 63 GLN CG HG2 sing N N 64 GLN CG HG3 sing N N 65 GLN CD OE1 doub N N 66 GLN CD NE2 sing N N 67 GLN NE2 HE21 sing N N 68 GLN NE2 HE22 sing N N 69 GLN OXT HXT sing N N 70 GLU N CA sing N N 71 GLU N H sing N N 72 GLU N H2 sing N N 73 GLU CA C sing N N 74 GLU CA CB sing N N 75 GLU CA HA sing N N 76 GLU C O doub N N 77 GLU C OXT sing N N 78 GLU CB CG sing N N 79 GLU CB HB2 sing N N 80 GLU CB HB3 sing N N 81 GLU CG CD sing N N 82 GLU CG HG2 sing N N 83 GLU CG HG3 sing N N 84 GLU CD OE1 doub N N 85 GLU CD OE2 sing N N 86 GLU OE2 HE2 sing N N 87 GLU OXT HXT sing N N 88 GLY N CA sing N N 89 GLY N H sing N N 90 GLY N H2 sing N N 91 GLY CA C sing N N 92 GLY CA HA2 sing N N 93 GLY CA HA3 sing N N 94 GLY C O doub N N 95 GLY C OXT sing N N 96 GLY OXT HXT sing N N 97 ILE N CA sing N N 98 ILE N H sing N N 99 ILE N H2 sing N N 100 ILE CA C sing N N 101 ILE CA CB sing N N 102 ILE CA HA sing N N 103 ILE C O doub N N 104 ILE C OXT sing N N 105 ILE CB CG1 sing N N 106 ILE CB CG2 sing N N 107 ILE CB HB sing N N 108 ILE CG1 CD1 sing N N 109 ILE CG1 HG12 sing N N 110 ILE CG1 HG13 sing N N 111 ILE CG2 HG21 sing N N 112 ILE CG2 HG22 sing N N 113 ILE CG2 HG23 sing N N 114 ILE CD1 HD11 sing N N 115 ILE CD1 HD12 sing N N 116 ILE CD1 HD13 sing N N 117 ILE OXT HXT sing N N 118 LEU N CA sing N N 119 LEU N H sing N N 120 LEU N H2 sing N N 121 LEU CA C sing N N 122 LEU CA CB sing N N 123 LEU CA HA sing N N 124 LEU C O doub N N 125 LEU C OXT sing N N 126 LEU CB CG sing N N 127 LEU CB HB2 sing N N 128 LEU CB HB3 sing N N 129 LEU CG CD1 sing N N 130 LEU CG CD2 sing N N 131 LEU CG HG sing N N 132 LEU CD1 HD11 sing N N 133 LEU CD1 HD12 sing N N 134 LEU CD1 HD13 sing N N 135 LEU CD2 HD21 sing N N 136 LEU CD2 HD22 sing N N 137 LEU CD2 HD23 sing N N 138 LEU OXT HXT sing N N 139 LYS N CA sing N N 140 LYS N H sing N N 141 LYS N H2 sing N N 142 LYS CA C sing N N 143 LYS CA CB sing N N 144 LYS CA HA sing N N 145 LYS C O doub N N 146 LYS C OXT sing N N 147 LYS CB CG sing N N 148 LYS CB HB2 sing N N 149 LYS CB HB3 sing N N 150 LYS CG CD sing N N 151 LYS CG HG2 sing N N 152 LYS CG HG3 sing N N 153 LYS CD CE sing N N 154 LYS CD HD2 sing N N 155 LYS CD HD3 sing N N 156 LYS CE NZ sing N N 157 LYS CE HE2 sing N N 158 LYS CE HE3 sing N N 159 LYS NZ HZ1 sing N N 160 LYS NZ HZ2 sing N N 161 LYS NZ HZ3 sing N N 162 LYS OXT HXT sing N N 163 MET N CA sing N N 164 MET N H sing N N 165 MET N H2 sing N N 166 MET CA C sing N N 167 MET CA CB sing N N 168 MET CA HA sing N N 169 MET C O doub N N 170 MET C OXT sing N N 171 MET CB CG sing N N 172 MET CB HB2 sing N N 173 MET CB HB3 sing N N 174 MET CG SD sing N N 175 MET CG HG2 sing N N 176 MET CG HG3 sing N N 177 MET SD CE sing N N 178 MET CE HE1 sing N N 179 MET CE HE2 sing N N 180 MET CE HE3 sing N N 181 MET OXT HXT sing N N 182 PHE N CA sing N N 183 PHE N H sing N N 184 PHE N H2 sing N N 185 PHE CA C sing N N 186 PHE CA CB sing N N 187 PHE CA HA sing N N 188 PHE C O doub N N 189 PHE C OXT sing N N 190 PHE CB CG sing N N 191 PHE CB HB2 sing N N 192 PHE CB HB3 sing N N 193 PHE CG CD1 doub Y N 194 PHE CG CD2 sing Y N 195 PHE CD1 CE1 sing Y N 196 PHE CD1 HD1 sing N N 197 PHE CD2 CE2 doub Y N 198 PHE CD2 HD2 sing N N 199 PHE CE1 CZ doub Y N 200 PHE CE1 HE1 sing N N 201 PHE CE2 CZ sing Y N 202 PHE CE2 HE2 sing N N 203 PHE CZ HZ sing N N 204 PHE OXT HXT sing N N 205 SER N CA sing N N 206 SER N H sing N N 207 SER N H2 sing N N 208 SER CA C sing N N 209 SER CA CB sing N N 210 SER CA HA sing N N 211 SER C O doub N N 212 SER C OXT sing N N 213 SER CB OG sing N N 214 SER CB HB2 sing N N 215 SER CB HB3 sing N N 216 SER OG HG sing N N 217 SER OXT HXT sing N N 218 THR N CA sing N N 219 THR N H sing N N 220 THR N H2 sing N N 221 THR CA C sing N N 222 THR CA CB sing N N 223 THR CA HA sing N N 224 THR C O doub N N 225 THR C OXT sing N N 226 THR CB OG1 sing N N 227 THR CB CG2 sing N N 228 THR CB HB sing N N 229 THR OG1 HG1 sing N N 230 THR CG2 HG21 sing N N 231 THR CG2 HG22 sing N N 232 THR CG2 HG23 sing N N 233 THR OXT HXT sing N N 234 TYR N CA sing N N 235 TYR N H sing N N 236 TYR N H2 sing N N 237 TYR CA C sing N N 238 TYR CA CB sing N N 239 TYR CA HA sing N N 240 TYR C O doub N N 241 TYR C OXT sing N N 242 TYR CB CG sing N N 243 TYR CB HB2 sing N N 244 TYR CB HB3 sing N N 245 TYR CG CD1 doub Y N 246 TYR CG CD2 sing Y N 247 TYR CD1 CE1 sing Y N 248 TYR CD1 HD1 sing N N 249 TYR CD2 CE2 doub Y N 250 TYR CD2 HD2 sing N N 251 TYR CE1 CZ doub Y N 252 TYR CE1 HE1 sing N N 253 TYR CE2 CZ sing Y N 254 TYR CE2 HE2 sing N N 255 TYR CZ OH sing N N 256 TYR OH HH sing N N 257 TYR OXT HXT sing N N 258 VAL N CA sing N N 259 VAL N H sing N N 260 VAL N H2 sing N N 261 VAL CA C sing N N 262 VAL CA CB sing N N 263 VAL CA HA sing N N 264 VAL C O doub N N 265 VAL C OXT sing N N 266 VAL CB CG1 sing N N 267 VAL CB CG2 sing N N 268 VAL CB HB sing N N 269 VAL CG1 HG11 sing N N 270 VAL CG1 HG12 sing N N 271 VAL CG1 HG13 sing N N 272 VAL CG2 HG21 sing N N 273 VAL CG2 HG22 sing N N 274 VAL CG2 HG23 sing N N 275 VAL OXT HXT sing N N 276 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 22-14-0020 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 800 ? 2 'AVANCE III' ? Bruker 600 ? # _atom_sites.entry_id 8AR2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_