data_8AXO # _entry.id 8AXO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.396 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8AXO pdb_00008axo 10.2210/pdb8axo/pdb WWPDB D_1292125329 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-09-13 2 'Structure model' 1 1 2023-09-27 3 'Structure model' 1 2 2024-09-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn 2 3 'Structure model' citation 3 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn.ambient_temp' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_CSD' 5 3 'Structure model' '_citation.journal_id_ISSN' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation.pdbx_database_id_DOI' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8AXO _pdbx_database_status.recvd_initial_deposition_date 2022-08-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Different domains of the same protein' _pdbx_database_related.db_id 8AXJ _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email gang.dong@meduniwien.ac.at _pdbx_contact_author.name_first Gang _pdbx_contact_author.name_last Dong _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9745-8103 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Dong, G.' 1 0000-0001-9745-8103 'Stadler, A.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Open Biology' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2046-2441 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 240128 _citation.page_last 240128 _citation.title 'The C-terminus of CFAP410 forms a tetrameric helical bundle that is essential for its localization to the basal body.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1098/rsob.240128 _citation.pdbx_database_id_PubMed 39255848 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stadler, A.' 1 ? primary 'De Liz, L.V.' 2 ? primary 'Gabriel, H.B.' 3 ? primary 'Alonso-Gil, S.' 4 ? primary 'Crickley, R.' 5 ? primary 'Korbula, K.' 6 ? primary 'Zagrovic, B.' 7 ? primary 'Vaughan, S.' 8 ? primary 'Sunter, J.D.' 9 0000-0002-2836-9622 primary 'Dong, G.' 10 0000-0001-9745-8103 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man TbCFAP410-CTD 3913.451 2 ? ? ? ? 2 water nat water 18.015 33 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code QIGPTETGVVQAVKVLLSELSVEGLDEVRRFIDALQ _entity_poly.pdbx_seq_one_letter_code_can QIGPTETGVVQAVKVLLSELSVEGLDEVRRFIDALQ _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ILE n 1 3 GLY n 1 4 PRO n 1 5 THR n 1 6 GLU n 1 7 THR n 1 8 GLY n 1 9 VAL n 1 10 VAL n 1 11 GLN n 1 12 ALA n 1 13 VAL n 1 14 LYS n 1 15 VAL n 1 16 LEU n 1 17 LEU n 1 18 SER n 1 19 GLU n 1 20 LEU n 1 21 SER n 1 22 VAL n 1 23 GLU n 1 24 GLY n 1 25 LEU n 1 26 ASP n 1 27 GLU n 1 28 VAL n 1 29 ARG n 1 30 ARG n 1 31 PHE n 1 32 ILE n 1 33 ASP n 1 34 ALA n 1 35 LEU n 1 36 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 36 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Tb09.211.3240 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain '927/4 GUTat10.1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Trypanosoma brucei brucei TREU927' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 185431 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 256 ? ? ? A . n A 1 2 ILE 2 257 ? ? ? A . n A 1 3 GLY 3 258 ? ? ? A . n A 1 4 PRO 4 259 259 PRO PRO A . n A 1 5 THR 5 260 260 THR THR A . n A 1 6 GLU 6 261 261 GLU GLU A . n A 1 7 THR 7 262 262 THR THR A . n A 1 8 GLY 8 263 263 GLY GLY A . n A 1 9 VAL 9 264 264 VAL VAL A . n A 1 10 VAL 10 265 265 VAL VAL A . n A 1 11 GLN 11 266 266 GLN GLN A . n A 1 12 ALA 12 267 267 ALA ALA A . n A 1 13 VAL 13 268 268 VAL VAL A . n A 1 14 LYS 14 269 269 LYS LYS A . n A 1 15 VAL 15 270 270 VAL VAL A . n A 1 16 LEU 16 271 271 LEU LEU A . n A 1 17 LEU 17 272 272 LEU LEU A . n A 1 18 SER 18 273 273 SER SER A . n A 1 19 GLU 19 274 274 GLU GLU A . n A 1 20 LEU 20 275 275 LEU LEU A . n A 1 21 SER 21 276 276 SER SER A . n A 1 22 VAL 22 277 277 VAL VAL A . n A 1 23 GLU 23 278 278 GLU GLU A . n A 1 24 GLY 24 279 279 GLY GLY A . n A 1 25 LEU 25 280 280 LEU LEU A . n A 1 26 ASP 26 281 281 ASP ASP A . n A 1 27 GLU 27 282 282 GLU GLU A . n A 1 28 VAL 28 283 283 VAL VAL A . n A 1 29 ARG 29 284 284 ARG ARG A . n A 1 30 ARG 30 285 285 ARG ARG A . n A 1 31 PHE 31 286 286 PHE PHE A . n A 1 32 ILE 32 287 287 ILE ILE A . n A 1 33 ASP 33 288 288 ASP ASP A . n A 1 34 ALA 34 289 289 ALA ALA A . n A 1 35 LEU 35 290 290 LEU LEU A . n A 1 36 GLN 36 291 ? ? ? A . n B 1 1 GLN 1 256 ? ? ? B . n B 1 2 ILE 2 257 ? ? ? B . n B 1 3 GLY 3 258 ? ? ? B . n B 1 4 PRO 4 259 259 PRO PRO B . n B 1 5 THR 5 260 260 THR THR B . n B 1 6 GLU 6 261 261 GLU GLU B . n B 1 7 THR 7 262 262 THR THR B . n B 1 8 GLY 8 263 263 GLY GLY B . n B 1 9 VAL 9 264 264 VAL VAL B . n B 1 10 VAL 10 265 265 VAL VAL B . n B 1 11 GLN 11 266 266 GLN GLN B . n B 1 12 ALA 12 267 267 ALA ALA B . n B 1 13 VAL 13 268 268 VAL VAL B . n B 1 14 LYS 14 269 269 LYS LYS B . n B 1 15 VAL 15 270 270 VAL VAL B . n B 1 16 LEU 16 271 271 LEU LEU B . n B 1 17 LEU 17 272 272 LEU LEU B . n B 1 18 SER 18 273 273 SER SER B . n B 1 19 GLU 19 274 274 GLU GLU B . n B 1 20 LEU 20 275 275 LEU LEU B . n B 1 21 SER 21 276 276 SER SER B . n B 1 22 VAL 22 277 277 VAL VAL B . n B 1 23 GLU 23 278 278 GLU GLU B . n B 1 24 GLY 24 279 279 GLY GLY B . n B 1 25 LEU 25 280 280 LEU LEU B . n B 1 26 ASP 26 281 281 ASP ASP B . n B 1 27 GLU 27 282 282 GLU GLU B . n B 1 28 VAL 28 283 283 VAL VAL B . n B 1 29 ARG 29 284 284 ARG ARG B . n B 1 30 ARG 30 285 285 ARG ARG B . n B 1 31 PHE 31 286 286 PHE PHE B . n B 1 32 ILE 32 287 287 ILE ILE B . n B 1 33 ASP 33 288 288 ASP ASP B . n B 1 34 ALA 34 289 289 ALA ALA B . n B 1 35 LEU 35 290 290 LEU LEU B . n B 1 36 GLN 36 291 291 GLN GLN B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 301 28 HOH HOH A . C 2 HOH 2 302 27 HOH HOH A . C 2 HOH 3 303 16 HOH HOH A . C 2 HOH 4 304 5 HOH HOH A . C 2 HOH 5 305 7 HOH HOH A . C 2 HOH 6 306 12 HOH HOH A . C 2 HOH 7 307 8 HOH HOH A . C 2 HOH 8 308 3 HOH HOH A . C 2 HOH 9 309 33 HOH HOH A . C 2 HOH 10 310 4 HOH HOH A . C 2 HOH 11 311 10 HOH HOH A . C 2 HOH 12 312 23 HOH HOH A . C 2 HOH 13 313 6 HOH HOH A . C 2 HOH 14 314 18 HOH HOH A . C 2 HOH 15 315 13 HOH HOH A . C 2 HOH 16 316 19 HOH HOH A . C 2 HOH 17 317 22 HOH HOH A . C 2 HOH 18 318 15 HOH HOH A . D 2 HOH 1 301 21 HOH HOH B . D 2 HOH 2 302 2 HOH HOH B . D 2 HOH 3 303 26 HOH HOH B . D 2 HOH 4 304 9 HOH HOH B . D 2 HOH 5 305 20 HOH HOH B . D 2 HOH 6 306 1 HOH HOH B . D 2 HOH 7 307 11 HOH HOH B . D 2 HOH 8 308 32 HOH HOH B . D 2 HOH 9 309 14 HOH HOH B . D 2 HOH 10 310 17 HOH HOH B . D 2 HOH 11 311 25 HOH HOH B . D 2 HOH 12 312 29 HOH HOH B . D 2 HOH 13 313 31 HOH HOH B . D 2 HOH 14 314 24 HOH HOH B . D 2 HOH 15 315 30 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18_3845 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18_3845 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8AXO _cell.details ? _cell.formula_units_Z ? _cell.length_a 40.107 _cell.length_a_esd ? _cell.length_b 40.107 _cell.length_b_esd ? _cell.length_c 62.684 _cell.length_c_esd ? _cell.volume 87322.807 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8AXO _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8AXO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.86 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.85 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;2.0 M ammonium sulfate, 5% (v/v) iso-propanol ; _exptl_crystal_grow.pdbx_pH_range 7.0-7.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-06 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97242 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97242 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 22.58 _reflns.entry_id 8AXO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.29 _reflns.d_resolution_low 19.10 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15025 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.65 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.4 _reflns.pdbx_Rmerge_I_obs 0.132 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.16 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.140 _reflns.pdbx_Rpim_I_all 0.046 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.991 _reflns.pdbx_CC_star 0.998 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.29 _reflns_shell.d_res_low 1.34 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1430 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.43 _reflns_shell.pdbx_CC_star 0.775 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 30.33 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8AXO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.29 _refine.ls_d_res_low 19.10 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15021 _refine.ls_number_reflns_R_free 1516 _refine.ls_number_reflns_R_work 13505 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.70 _refine.ls_percent_reflns_R_free 10.09 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1882 _refine.ls_R_factor_R_free 0.2074 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1860 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'AB INITIO PHASING' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.4872 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1764 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.29 _refine_hist.d_res_low 19.10 _refine_hist.number_atoms_solvent 33 _refine_hist.number_atoms_total 531 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 498 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0047 ? 509 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.6112 ? 692 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0408 ? 92 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0022 ? 87 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 3.1018 ? 72 ? f_dihedral_angle_d ? ? # _refine_ls_restr_ncs.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_restr_ncs.dom_id d_2 _refine_ls_restr_ncs.ncs_model_details ? _refine_ls_restr_ncs.rms_dev_B_iso ? _refine_ls_restr_ncs.rms_dev_position 0.602751331809 _refine_ls_restr_ncs.weight_B_iso ? _refine_ls_restr_ncs.weight_position ? _refine_ls_restr_ncs.pdbx_ordinal 1 _refine_ls_restr_ncs.pdbx_type 'Torsion NCS' _refine_ls_restr_ncs.pdbx_asym_id ? _refine_ls_restr_ncs.pdbx_auth_asym_id A _refine_ls_restr_ncs.pdbx_number ? _refine_ls_restr_ncs.pdbx_rms ? _refine_ls_restr_ncs.pdbx_weight ? _refine_ls_restr_ncs.pdbx_ens_id ens_1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.29 1.34 . . 127 1168 97.08 . . . 0.3698 . 0.3110 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.34 1.38 . . 135 1212 99.93 . . . 0.2775 . 0.2401 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.38 1.44 . . 130 1213 100.00 . . . 0.2433 . 0.2196 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.44 1.50 . . 135 1182 99.92 . . . 0.2757 . 0.1853 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.50 1.58 . . 137 1238 100.00 . . . 0.2199 . 0.1691 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.58 1.68 . . 139 1215 100.00 . . . 0.1998 . 0.1689 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.68 1.81 . . 139 1229 99.93 . . . 0.2349 . 0.1549 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.81 1.99 . . 139 1235 100.00 . . . 0.2051 . 0.1788 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.99 2.28 . . 140 1230 100.00 . . . 0.2018 . 0.1840 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.28 2.87 . . 143 1263 100.00 . . . 0.1737 . 0.1722 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.88 19.10 . . 152 1320 100.00 . . . 0.2121 . 0.1935 . . . . . . . . . . . # _struct_ncs_oper.id 1 _struct_ncs_oper.code given _struct_ncs_oper.matrix[1][1] 0.414888869432 _struct_ncs_oper.matrix[1][2] -0.817997484866 _struct_ncs_oper.matrix[1][3] -0.398431099156 _struct_ncs_oper.matrix[2][1] -0.816003137042 _struct_ncs_oper.matrix[2][2] -0.528227217356 _struct_ncs_oper.matrix[2][3] 0.234765600509 _struct_ncs_oper.matrix[3][1] -0.402499821565 _struct_ncs_oper.matrix[3][2] 0.227719392229 _struct_ncs_oper.matrix[3][3] -0.886644106755 _struct_ncs_oper.vector[1] -20.6582407499 _struct_ncs_oper.vector[2] -35.6908118029 _struct_ncs_oper.vector[3] -0.0374757063738 _struct_ncs_oper.details ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details ens_1 d_1 ;(chain "A" and ((resid 259 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 260 and (name N or name CA or name C or name O or name CB or name OG1 or name CG2)) or (resid 261 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 262 and (name N or name CA or name C or name O or name CB or name OG1 or name CG2)) or (resid 263 and (name N or name CA or name C or name O )) or (resid 264 through 265 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2)) or (resid 266 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 267 and (name N or name CA or name C or name O or name CB )) or (resid 268 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2)) or (resid 269 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 270 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2)) or (resid 271 through 272 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 274 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 275 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 276 and (name N or name CA or name C or name O or name CB or name OG )) or (resid 278 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 279 and (name N or name CA or name C or name O )) or (resid 280 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 281 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name OD2)) or (resid 282 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 283 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2)) or (resid 284 through 285 and (name N or name CA or name C or name O or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 286 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 287 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or (resid 288 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name OD2)) or (resid 289 and (name N or name CA or name C or name O or name CB )) or (resid 290 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)))) ; ens_1 d_2 ;(chain "B" and ((resid 259 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 260 and (name N or name CA or name C or name O or name CB or name OG1 or name CG2)) or (resid 261 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 262 and (name N or name CA or name C or name O or name CB or name OG1 or name CG2)) or (resid 263 and (name N or name CA or name C or name O )) or (resid 264 through 265 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2)) or (resid 266 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 267 and (name N or name CA or name C or name O or name CB )) or (resid 268 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2)) or (resid 269 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 270 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2)) or (resid 271 through 272 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 274 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 275 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 276 and (name N or name CA or name C or name O or name CB or name OG )) or (resid 278 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 279 and (name N or name CA or name C or name O )) or (resid 280 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 281 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name OD2)) or (resid 282 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 283 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2)) or (resid 284 through 285 and (name N or name CA or name C or name O or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 286 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 287 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or (resid 288 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name OD2)) or (resid 289 and (name N or name CA or name C or name O or name CB )) or (resid 290 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)))) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details ens_1 d_1 1 A PRO 4 . A LEU 17 . A PRO 259 A LEU 272 ? ? ens_1 d_1 2 A GLU 19 . A SER 21 . A GLU 274 A SER 276 ? ? ens_1 d_1 3 A GLU 27 . A LEU 35 . A GLU 282 A LEU 290 ? ? ens_1 d_2 1 B PRO 4 . B LEU 17 . B PRO 259 B LEU 272 ? ? ens_1 d_2 2 B GLU 19 . B SER 21 . B GLU 274 B SER 276 ? ? ens_1 d_2 3 B GLU 27 . B LEU 35 . B GLU 282 B LEU 290 ? ? # _struct_ncs_ens.id ens_1 _struct_ncs_ens.details ? # _struct_ncs_ens_gen.ens_id ens_1 _struct_ncs_ens_gen.dom_id_1 d_2 _struct_ncs_ens_gen.dom_id_2 d_1 _struct_ncs_ens_gen.oper_id 1 # _struct.entry_id 8AXO _struct.title 'Crystal structure of the C-terminal domain of Trypanosoma brucei CFAP410' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8AXO _struct_keywords.text 'Cilia, Flagella, Coiled-coil, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q38DI2_TRYB2 _struct_ref.pdbx_db_accession Q38DI2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QIGPTETGVVQAVKVLLSELSVEGLDEVRRFIDALQ _struct_ref.pdbx_align_begin 256 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8AXO A 1 ? 36 ? Q38DI2 256 ? 291 ? 256 291 2 1 8AXO B 1 ? 36 ? Q38DI2 256 ? 291 ? 256 291 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6600 ? 1 MORE -60 ? 1 'SSA (A^2)' 6100 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Static light scattering coupled gel filtration' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 5 ? SER A 18 ? THR A 260 SER A 273 1 ? 14 HELX_P HELX_P2 AA2 SER A 21 ? LEU A 35 ? SER A 276 LEU A 290 1 ? 15 HELX_P HELX_P3 AA3 THR B 5 ? SER B 18 ? THR B 260 SER B 273 1 ? 14 HELX_P HELX_P4 AA4 SER B 21 ? LEU B 35 ? SER B 276 LEU B 290 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O B HOH 301 ? ? O B HOH 305 ? ? 1.70 2 1 O A HOH 314 ? ? O A HOH 316 ? ? 1.86 3 1 OD1 A ASP 288 ? ? O A HOH 301 ? ? 1.96 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O B HOH 308 ? ? 1_555 O B HOH 308 ? ? 6_344 1.87 2 1 OE2 A GLU 261 ? ? 1_555 OG A SER 276 ? ? 4_555 1.99 3 1 O B HOH 314 ? ? 1_555 O B HOH 314 ? ? 6_344 2.09 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 256 ? A GLN 1 2 1 Y 1 A ILE 257 ? A ILE 2 3 1 Y 1 A GLY 258 ? A GLY 3 4 1 Y 1 A GLN 291 ? A GLN 36 5 1 Y 1 B GLN 256 ? B GLN 1 6 1 Y 1 B ILE 257 ? B ILE 2 7 1 Y 1 B GLY 258 ? B GLY 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HOH O O N N 106 HOH H1 H N N 107 HOH H2 H N N 108 ILE N N N N 109 ILE CA C N S 110 ILE C C N N 111 ILE O O N N 112 ILE CB C N S 113 ILE CG1 C N N 114 ILE CG2 C N N 115 ILE CD1 C N N 116 ILE OXT O N N 117 ILE H H N N 118 ILE H2 H N N 119 ILE HA H N N 120 ILE HB H N N 121 ILE HG12 H N N 122 ILE HG13 H N N 123 ILE HG21 H N N 124 ILE HG22 H N N 125 ILE HG23 H N N 126 ILE HD11 H N N 127 ILE HD12 H N N 128 ILE HD13 H N N 129 ILE HXT H N N 130 LEU N N N N 131 LEU CA C N S 132 LEU C C N N 133 LEU O O N N 134 LEU CB C N N 135 LEU CG C N N 136 LEU CD1 C N N 137 LEU CD2 C N N 138 LEU OXT O N N 139 LEU H H N N 140 LEU H2 H N N 141 LEU HA H N N 142 LEU HB2 H N N 143 LEU HB3 H N N 144 LEU HG H N N 145 LEU HD11 H N N 146 LEU HD12 H N N 147 LEU HD13 H N N 148 LEU HD21 H N N 149 LEU HD22 H N N 150 LEU HD23 H N N 151 LEU HXT H N N 152 LYS N N N N 153 LYS CA C N S 154 LYS C C N N 155 LYS O O N N 156 LYS CB C N N 157 LYS CG C N N 158 LYS CD C N N 159 LYS CE C N N 160 LYS NZ N N N 161 LYS OXT O N N 162 LYS H H N N 163 LYS H2 H N N 164 LYS HA H N N 165 LYS HB2 H N N 166 LYS HB3 H N N 167 LYS HG2 H N N 168 LYS HG3 H N N 169 LYS HD2 H N N 170 LYS HD3 H N N 171 LYS HE2 H N N 172 LYS HE3 H N N 173 LYS HZ1 H N N 174 LYS HZ2 H N N 175 LYS HZ3 H N N 176 LYS HXT H N N 177 PHE N N N N 178 PHE CA C N S 179 PHE C C N N 180 PHE O O N N 181 PHE CB C N N 182 PHE CG C Y N 183 PHE CD1 C Y N 184 PHE CD2 C Y N 185 PHE CE1 C Y N 186 PHE CE2 C Y N 187 PHE CZ C Y N 188 PHE OXT O N N 189 PHE H H N N 190 PHE H2 H N N 191 PHE HA H N N 192 PHE HB2 H N N 193 PHE HB3 H N N 194 PHE HD1 H N N 195 PHE HD2 H N N 196 PHE HE1 H N N 197 PHE HE2 H N N 198 PHE HZ H N N 199 PHE HXT H N N 200 PRO N N N N 201 PRO CA C N S 202 PRO C C N N 203 PRO O O N N 204 PRO CB C N N 205 PRO CG C N N 206 PRO CD C N N 207 PRO OXT O N N 208 PRO H H N N 209 PRO HA H N N 210 PRO HB2 H N N 211 PRO HB3 H N N 212 PRO HG2 H N N 213 PRO HG3 H N N 214 PRO HD2 H N N 215 PRO HD3 H N N 216 PRO HXT H N N 217 SER N N N N 218 SER CA C N S 219 SER C C N N 220 SER O O N N 221 SER CB C N N 222 SER OG O N N 223 SER OXT O N N 224 SER H H N N 225 SER H2 H N N 226 SER HA H N N 227 SER HB2 H N N 228 SER HB3 H N N 229 SER HG H N N 230 SER HXT H N N 231 THR N N N N 232 THR CA C N S 233 THR C C N N 234 THR O O N N 235 THR CB C N R 236 THR OG1 O N N 237 THR CG2 C N N 238 THR OXT O N N 239 THR H H N N 240 THR H2 H N N 241 THR HA H N N 242 THR HB H N N 243 THR HG1 H N N 244 THR HG21 H N N 245 THR HG22 H N N 246 THR HG23 H N N 247 THR HXT H N N 248 VAL N N N N 249 VAL CA C N S 250 VAL C C N N 251 VAL O O N N 252 VAL CB C N N 253 VAL CG1 C N N 254 VAL CG2 C N N 255 VAL OXT O N N 256 VAL H H N N 257 VAL H2 H N N 258 VAL HA H N N 259 VAL HB H N N 260 VAL HG11 H N N 261 VAL HG12 H N N 262 VAL HG13 H N N 263 VAL HG21 H N N 264 VAL HG22 H N N 265 VAL HG23 H N N 266 VAL HXT H N N 267 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HOH O H1 sing N N 100 HOH O H2 sing N N 101 ILE N CA sing N N 102 ILE N H sing N N 103 ILE N H2 sing N N 104 ILE CA C sing N N 105 ILE CA CB sing N N 106 ILE CA HA sing N N 107 ILE C O doub N N 108 ILE C OXT sing N N 109 ILE CB CG1 sing N N 110 ILE CB CG2 sing N N 111 ILE CB HB sing N N 112 ILE CG1 CD1 sing N N 113 ILE CG1 HG12 sing N N 114 ILE CG1 HG13 sing N N 115 ILE CG2 HG21 sing N N 116 ILE CG2 HG22 sing N N 117 ILE CG2 HG23 sing N N 118 ILE CD1 HD11 sing N N 119 ILE CD1 HD12 sing N N 120 ILE CD1 HD13 sing N N 121 ILE OXT HXT sing N N 122 LEU N CA sing N N 123 LEU N H sing N N 124 LEU N H2 sing N N 125 LEU CA C sing N N 126 LEU CA CB sing N N 127 LEU CA HA sing N N 128 LEU C O doub N N 129 LEU C OXT sing N N 130 LEU CB CG sing N N 131 LEU CB HB2 sing N N 132 LEU CB HB3 sing N N 133 LEU CG CD1 sing N N 134 LEU CG CD2 sing N N 135 LEU CG HG sing N N 136 LEU CD1 HD11 sing N N 137 LEU CD1 HD12 sing N N 138 LEU CD1 HD13 sing N N 139 LEU CD2 HD21 sing N N 140 LEU CD2 HD22 sing N N 141 LEU CD2 HD23 sing N N 142 LEU OXT HXT sing N N 143 LYS N CA sing N N 144 LYS N H sing N N 145 LYS N H2 sing N N 146 LYS CA C sing N N 147 LYS CA CB sing N N 148 LYS CA HA sing N N 149 LYS C O doub N N 150 LYS C OXT sing N N 151 LYS CB CG sing N N 152 LYS CB HB2 sing N N 153 LYS CB HB3 sing N N 154 LYS CG CD sing N N 155 LYS CG HG2 sing N N 156 LYS CG HG3 sing N N 157 LYS CD CE sing N N 158 LYS CD HD2 sing N N 159 LYS CD HD3 sing N N 160 LYS CE NZ sing N N 161 LYS CE HE2 sing N N 162 LYS CE HE3 sing N N 163 LYS NZ HZ1 sing N N 164 LYS NZ HZ2 sing N N 165 LYS NZ HZ3 sing N N 166 LYS OXT HXT sing N N 167 PHE N CA sing N N 168 PHE N H sing N N 169 PHE N H2 sing N N 170 PHE CA C sing N N 171 PHE CA CB sing N N 172 PHE CA HA sing N N 173 PHE C O doub N N 174 PHE C OXT sing N N 175 PHE CB CG sing N N 176 PHE CB HB2 sing N N 177 PHE CB HB3 sing N N 178 PHE CG CD1 doub Y N 179 PHE CG CD2 sing Y N 180 PHE CD1 CE1 sing Y N 181 PHE CD1 HD1 sing N N 182 PHE CD2 CE2 doub Y N 183 PHE CD2 HD2 sing N N 184 PHE CE1 CZ doub Y N 185 PHE CE1 HE1 sing N N 186 PHE CE2 CZ sing Y N 187 PHE CE2 HE2 sing N N 188 PHE CZ HZ sing N N 189 PHE OXT HXT sing N N 190 PRO N CA sing N N 191 PRO N CD sing N N 192 PRO N H sing N N 193 PRO CA C sing N N 194 PRO CA CB sing N N 195 PRO CA HA sing N N 196 PRO C O doub N N 197 PRO C OXT sing N N 198 PRO CB CG sing N N 199 PRO CB HB2 sing N N 200 PRO CB HB3 sing N N 201 PRO CG CD sing N N 202 PRO CG HG2 sing N N 203 PRO CG HG3 sing N N 204 PRO CD HD2 sing N N 205 PRO CD HD3 sing N N 206 PRO OXT HXT sing N N 207 SER N CA sing N N 208 SER N H sing N N 209 SER N H2 sing N N 210 SER CA C sing N N 211 SER CA CB sing N N 212 SER CA HA sing N N 213 SER C O doub N N 214 SER C OXT sing N N 215 SER CB OG sing N N 216 SER CB HB2 sing N N 217 SER CB HB3 sing N N 218 SER OG HG sing N N 219 SER OXT HXT sing N N 220 THR N CA sing N N 221 THR N H sing N N 222 THR N H2 sing N N 223 THR CA C sing N N 224 THR CA CB sing N N 225 THR CA HA sing N N 226 THR C O doub N N 227 THR C OXT sing N N 228 THR CB OG1 sing N N 229 THR CB CG2 sing N N 230 THR CB HB sing N N 231 THR OG1 HG1 sing N N 232 THR CG2 HG21 sing N N 233 THR CG2 HG22 sing N N 234 THR CG2 HG23 sing N N 235 THR OXT HXT sing N N 236 VAL N CA sing N N 237 VAL N H sing N N 238 VAL N H2 sing N N 239 VAL CA C sing N N 240 VAL CA CB sing N N 241 VAL CA HA sing N N 242 VAL C O doub N N 243 VAL C OXT sing N N 244 VAL CB CG1 sing N N 245 VAL CB CG2 sing N N 246 VAL CB HB sing N N 247 VAL CG1 HG11 sing N N 248 VAL CG1 HG12 sing N N 249 VAL CG1 HG13 sing N N 250 VAL CG2 HG21 sing N N 251 VAL CG2 HG22 sing N N 252 VAL CG2 HG23 sing N N 253 VAL OXT HXT sing N N 254 # _pdbx_audit_support.funding_organization 'Austrian Science Fund' _pdbx_audit_support.country Austria _pdbx_audit_support.grant_number I5960-B2 _pdbx_audit_support.ordinal 1 # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 8AXO _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.024933 _atom_sites.fract_transf_matrix[1][2] 0.014395 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.028790 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015953 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_