data_8B7T # _entry.id 8B7T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.382 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8B7T pdb_00008b7t 10.2210/pdb8b7t/pdb WWPDB D_1292125887 ? ? BMRB 34760 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'CPSF73 CTD3' _pdbx_database_related.db_id 34760 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8B7T _pdbx_database_status.recvd_initial_deposition_date 2022-10-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Thore, S.' 1 0000-0001-7058-3887 'Mackereth, C.' 2 0000-0002-0776-7947 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary 'Open Biology' ? ? 2046-2441 ? ? 13 ? 230221 230221 'Molecular details of the CPSF73-CPSF100 C-terminal heterodimer and interaction with Symplekin.' 2023 ? 10.1098/rsob.230221 37989222 ? ? ? ? ? ? ? ? ? US ? ? 1 Biorxiv ? ? 2692-8205 ? ? ? ? ? ? 'Molecular details of the CPSF73-CPSF100 C-terminal heterodimer and interaction with Symplekin' 2023 ? 10.1101/2023.04.19.537554 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Thore, S.' 1 0000-0001-7058-3887 primary 'Raoelijaona, F.' 2 ? primary 'Talenton, V.' 3 ? primary 'Fribourg, S.' 4 ? primary 'Mackereth, C.D.' 5 0000-0002-0776-7947 1 'Thore, S.' 6 ? 1 'Raoelijaona, F.' 7 ? 1 'Talenton, V.' 8 ? 1 'Fribourg, S.' 9 ? 1 'Mackereth, C.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description CPSF73 _entity.formula_weight 8497.995 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSGLKTKSVRLSKMGKKELLVSVLKNHFMVEKENDDIKVMNGDMMARISGDGVTGDAGIVDKINECIKKIEAIYLRD _entity_poly.pdbx_seq_one_letter_code_can GSGLKTKSVRLSKMGKKELLVSVLKNHFMVEKENDDIKVMNGDMMARISGDGVTGDAGIVDKINECIKKIEAIYLRD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 LEU n 1 5 LYS n 1 6 THR n 1 7 LYS n 1 8 SER n 1 9 VAL n 1 10 ARG n 1 11 LEU n 1 12 SER n 1 13 LYS n 1 14 MET n 1 15 GLY n 1 16 LYS n 1 17 LYS n 1 18 GLU n 1 19 LEU n 1 20 LEU n 1 21 VAL n 1 22 SER n 1 23 VAL n 1 24 LEU n 1 25 LYS n 1 26 ASN n 1 27 HIS n 1 28 PHE n 1 29 MET n 1 30 VAL n 1 31 GLU n 1 32 LYS n 1 33 GLU n 1 34 ASN n 1 35 ASP n 1 36 ASP n 1 37 ILE n 1 38 LYS n 1 39 VAL n 1 40 MET n 1 41 ASN n 1 42 GLY n 1 43 ASP n 1 44 MET n 1 45 MET n 1 46 ALA n 1 47 ARG n 1 48 ILE n 1 49 SER n 1 50 GLY n 1 51 ASP n 1 52 GLY n 1 53 VAL n 1 54 THR n 1 55 GLY n 1 56 ASP n 1 57 ALA n 1 58 GLY n 1 59 ILE n 1 60 VAL n 1 61 ASP n 1 62 LYS n 1 63 ILE n 1 64 ASN n 1 65 GLU n 1 66 CYS n 1 67 ILE n 1 68 LYS n 1 69 LYS n 1 70 ILE n 1 71 GLU n 1 72 ALA n 1 73 ILE n 1 74 TYR n 1 75 LEU n 1 76 ARG n 1 77 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 77 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ECU10_0900 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain GB-M1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Encephalitozoon cuniculi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6035 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain lysY _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-MCN _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8SUE4_ENCCU _struct_ref.pdbx_db_accession Q8SUE4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GLKTKSVRLSKMGKKELLVSVLKNHFMVEKENDDIKVMNGDMMARISGDGVTGDAGIVDKINECIKKIEAIYLRD _struct_ref.pdbx_align_begin 569 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8B7T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8SUE4 _struct_ref_seq.db_align_beg 569 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 643 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 569 _struct_ref_seq.pdbx_auth_seq_align_end 643 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8B7T GLY A 1 ? UNP Q8SUE4 ? ? 'expression tag' 567 1 1 8B7T SER A 2 ? UNP Q8SUE4 ? ? 'expression tag' 568 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 2 isotropic 3 1 1 '2D 1H-13C HSQC methyl' 2 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HN(CA)CO' 1 isotropic 6 1 1 '3D HNCA' 1 isotropic 7 1 1 '3D HNCACB' 1 isotropic 8 1 1 '3D CBCA(CO)NH' 1 isotropic 9 1 1 '3D HNHA' 2 isotropic 10 1 1 '3D HA(CACO)NH' 2 isotropic 11 1 1 '3D HCCH-TOCSY' 2 isotropic 12 1 1 '3D H(CCO)NH' 2 isotropic 13 1 1 '3D H(CCO)NH' 2 isotropic 14 1 1 '3D 1H-15N NOESY' 2 isotropic 15 1 2 '3D 1H-13C NOESY' 2 isotropic 16 1 3 '2D 1H-1H TOCSY' 2 isotropic 17 1 3 '2D DQF-COSY' 2 isotropic 18 1 3 '2D 1H-1H NOESY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '800 uM [U-13C; U-15N] CPSF73, 20 mM TRIS, 150 mM sodium chloride, 2 mM DTT, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C15N_H2O solution ? 2 '800 uM [U-13C; U-15N] CPSF73, 20 mM TRIS, 150 mM sodium chloride, 2 mM DTT, 100% D2O' '100% D2O' 13C15N_D2O solution ? 3 '800 uM CPSF73, 20 mM TRIS, 150 mM sodium chloride, 2 mM DTT, 100% D2O' '100% D2O' unlabelled_D2O solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE NEO' ? Bruker 800 ? 2 'AVANCE NEO' ? Bruker 700 ? # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 8B7T 'simulated annealing' ? 1 8B7T 'simulated annealing' ? 2 # _pdbx_nmr_ensemble.entry_id 8B7T _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8B7T _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' Sparky ? Goddard 4 'peak picking' Sparky ? Goddard 5 collection TopSpin ? 'Bruker Biospin' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8B7T _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8B7T _struct.title 'CPSF73 CTD3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8B7T _struct_keywords.text 'Cleavage and polyadenylation specifity factor, RNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 15 ? ASN A 26 ? GLY A 581 ASN A 592 1 ? 12 HELX_P HELX_P2 AA2 ASP A 56 ? LEU A 75 ? ASP A 622 LEU A 641 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 29 ? GLU A 33 ? MET A 595 GLU A 599 AA1 2 ASP A 36 ? ASN A 41 ? ASP A 602 ASN A 607 AA1 3 MET A 44 ? ILE A 48 ? MET A 610 ILE A 614 AA1 4 VAL A 53 ? GLY A 55 ? VAL A 619 GLY A 621 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 31 ? N GLU A 597 O LYS A 38 ? O LYS A 604 AA1 2 3 N ILE A 37 ? N ILE A 603 O ILE A 48 ? O ILE A 614 AA1 3 4 N ARG A 47 ? N ARG A 613 O THR A 54 ? O THR A 620 # _atom_sites.entry_id 8B7T _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 567 567 GLY GLY A . n A 1 2 SER 2 568 568 SER SER A . n A 1 3 GLY 3 569 569 GLY GLY A . n A 1 4 LEU 4 570 570 LEU LEU A . n A 1 5 LYS 5 571 571 LYS LYS A . n A 1 6 THR 6 572 572 THR THR A . n A 1 7 LYS 7 573 573 LYS LYS A . n A 1 8 SER 8 574 574 SER SER A . n A 1 9 VAL 9 575 575 VAL VAL A . n A 1 10 ARG 10 576 576 ARG ARG A . n A 1 11 LEU 11 577 577 LEU LEU A . n A 1 12 SER 12 578 578 SER SER A . n A 1 13 LYS 13 579 579 LYS LYS A . n A 1 14 MET 14 580 580 MET MET A . n A 1 15 GLY 15 581 581 GLY GLY A . n A 1 16 LYS 16 582 582 LYS LYS A . n A 1 17 LYS 17 583 583 LYS LYS A . n A 1 18 GLU 18 584 584 GLU GLU A . n A 1 19 LEU 19 585 585 LEU LEU A . n A 1 20 LEU 20 586 586 LEU LEU A . n A 1 21 VAL 21 587 587 VAL VAL A . n A 1 22 SER 22 588 588 SER SER A . n A 1 23 VAL 23 589 589 VAL VAL A . n A 1 24 LEU 24 590 590 LEU LEU A . n A 1 25 LYS 25 591 591 LYS LYS A . n A 1 26 ASN 26 592 592 ASN ASN A . n A 1 27 HIS 27 593 593 HIS HIS A . n A 1 28 PHE 28 594 594 PHE PHE A . n A 1 29 MET 29 595 595 MET MET A . n A 1 30 VAL 30 596 596 VAL VAL A . n A 1 31 GLU 31 597 597 GLU GLU A . n A 1 32 LYS 32 598 598 LYS LYS A . n A 1 33 GLU 33 599 599 GLU GLU A . n A 1 34 ASN 34 600 600 ASN ASN A . n A 1 35 ASP 35 601 601 ASP ASP A . n A 1 36 ASP 36 602 602 ASP ASP A . n A 1 37 ILE 37 603 603 ILE ILE A . n A 1 38 LYS 38 604 604 LYS LYS A . n A 1 39 VAL 39 605 605 VAL VAL A . n A 1 40 MET 40 606 606 MET MET A . n A 1 41 ASN 41 607 607 ASN ASN A . n A 1 42 GLY 42 608 608 GLY GLY A . n A 1 43 ASP 43 609 609 ASP ASP A . n A 1 44 MET 44 610 610 MET MET A . n A 1 45 MET 45 611 611 MET MET A . n A 1 46 ALA 46 612 612 ALA ALA A . n A 1 47 ARG 47 613 613 ARG ARG A . n A 1 48 ILE 48 614 614 ILE ILE A . n A 1 49 SER 49 615 615 SER SER A . n A 1 50 GLY 50 616 616 GLY GLY A . n A 1 51 ASP 51 617 617 ASP ASP A . n A 1 52 GLY 52 618 618 GLY GLY A . n A 1 53 VAL 53 619 619 VAL VAL A . n A 1 54 THR 54 620 620 THR THR A . n A 1 55 GLY 55 621 621 GLY GLY A . n A 1 56 ASP 56 622 622 ASP ASP A . n A 1 57 ALA 57 623 623 ALA ALA A . n A 1 58 GLY 58 624 624 GLY GLY A . n A 1 59 ILE 59 625 625 ILE ILE A . n A 1 60 VAL 60 626 626 VAL VAL A . n A 1 61 ASP 61 627 627 ASP ASP A . n A 1 62 LYS 62 628 628 LYS LYS A . n A 1 63 ILE 63 629 629 ILE ILE A . n A 1 64 ASN 64 630 630 ASN ASN A . n A 1 65 GLU 65 631 631 GLU GLU A . n A 1 66 CYS 66 632 632 CYS CYS A . n A 1 67 ILE 67 633 633 ILE ILE A . n A 1 68 LYS 68 634 634 LYS LYS A . n A 1 69 LYS 69 635 635 LYS LYS A . n A 1 70 ILE 70 636 636 ILE ILE A . n A 1 71 GLU 71 637 637 GLU GLU A . n A 1 72 ALA 72 638 638 ALA ALA A . n A 1 73 ILE 73 639 639 ILE ILE A . n A 1 74 TYR 74 640 640 TYR TYR A . n A 1 75 LEU 75 641 641 LEU LEU A . n A 1 76 ARG 76 642 642 ARG ARG A . n A 1 77 ASP 77 643 643 ASP ASP A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email cameron.mackereth@inserm.fr _pdbx_contact_author.name_first Cameron _pdbx_contact_author.name_last Mackereth _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0776-7947 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-05-03 2 'Structure model' 1 1 2023-12-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 2 'Structure model' citation_author # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 CPSF73 800 ? uM '[U-13C; U-15N]' 1 TRIS 20 ? mM 'natural abundance' 1 'sodium chloride' 150 ? mM 'natural abundance' 1 DTT 2 ? mM 'natural abundance' 2 CPSF73 800 ? uM '[U-13C; U-15N]' 2 TRIS 20 ? mM 'natural abundance' 2 'sodium chloride' 150 ? mM 'natural abundance' 2 DTT 2 ? mM 'natural abundance' 3 CPSF73 800 ? uM 'natural abundance' 3 TRIS 20 ? mM 'natural abundance' 3 'sodium chloride' 150 ? mM 'natural abundance' 3 DTT 2 ? mM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HZ2 A LYS 628 ? ? OE1 A GLU 631 ? ? 1.59 2 12 OE2 A GLU 599 ? ? HZ1 A LYS 604 ? ? 1.60 3 15 HZ2 A LYS 582 ? ? OE1 A GLU 637 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 568 ? ? -100.93 61.34 2 1 VAL A 575 ? ? 73.46 -61.79 3 1 ASP A 601 ? ? 58.69 15.33 4 1 ASP A 617 ? ? -141.77 29.45 5 1 ARG A 642 ? ? 71.91 127.38 6 2 SER A 574 ? ? -80.89 42.67 7 2 VAL A 575 ? ? 61.19 82.69 8 2 ARG A 576 ? ? -100.34 58.29 9 2 LYS A 579 ? ? -68.27 98.41 10 2 ARG A 642 ? ? 72.74 110.30 11 3 THR A 572 ? ? -100.61 77.71 12 3 LYS A 573 ? ? -65.11 96.63 13 3 SER A 574 ? ? -79.73 39.42 14 3 VAL A 575 ? ? 58.57 92.23 15 3 ARG A 642 ? ? 63.59 99.04 16 4 LEU A 570 ? ? -75.38 -74.01 17 4 LYS A 571 ? ? -92.08 -65.79 18 4 ASP A 601 ? ? 77.18 -7.29 19 4 ASP A 609 ? ? 71.38 -2.09 20 4 ASP A 617 ? ? -175.45 -43.12 21 4 ARG A 642 ? ? 64.16 95.02 22 5 SER A 574 ? ? -85.90 35.15 23 5 SER A 578 ? ? 64.27 85.57 24 5 ARG A 642 ? ? 64.46 87.32 25 6 ARG A 576 ? ? 70.00 103.86 26 6 MET A 580 ? ? 68.61 120.81 27 6 ARG A 642 ? ? 70.50 124.72 28 7 SER A 568 ? ? -90.73 53.53 29 7 LYS A 579 ? ? 66.62 -77.65 30 7 ASP A 601 ? ? 58.14 19.12 31 7 ARG A 642 ? ? 68.46 98.04 32 8 SER A 578 ? ? -103.17 -165.21 33 8 MET A 580 ? ? -89.73 47.56 34 8 ASP A 617 ? ? -170.35 -44.98 35 8 ARG A 642 ? ? 69.58 106.29 36 9 LEU A 570 ? ? 70.96 -54.66 37 9 LYS A 579 ? ? 69.87 159.41 38 9 ASP A 617 ? ? -161.98 -40.60 39 9 ARG A 642 ? ? 68.79 129.96 40 10 LEU A 570 ? ? -108.14 44.17 41 10 VAL A 575 ? ? 65.62 109.53 42 10 ASP A 601 ? ? 59.68 17.28 43 10 ARG A 642 ? ? 71.22 102.93 44 11 LEU A 570 ? ? -112.87 76.79 45 11 LYS A 571 ? ? -94.15 -69.37 46 11 ASP A 601 ? ? 59.77 14.30 47 11 ARG A 642 ? ? 69.09 112.95 48 12 LEU A 577 ? ? 70.79 140.05 49 12 LYS A 579 ? ? 64.44 88.66 50 12 ARG A 642 ? ? 72.64 128.30 51 14 LYS A 579 ? ? -123.70 -65.36 52 14 ARG A 642 ? ? 69.90 100.60 53 15 ASP A 617 ? ? 56.19 71.90 54 15 ARG A 642 ? ? 72.06 113.77 55 16 LEU A 570 ? ? -158.64 14.38 56 16 LYS A 571 ? ? -109.45 -78.06 57 16 VAL A 575 ? ? 74.80 124.95 58 16 SER A 578 ? ? -153.16 84.62 59 16 LYS A 579 ? ? 68.22 157.19 60 16 ARG A 642 ? ? 71.78 108.86 61 17 SER A 574 ? ? 68.19 -67.55 62 17 VAL A 575 ? ? -174.74 135.95 63 17 ARG A 642 ? ? 69.04 142.89 64 18 SER A 578 ? ? -153.14 29.14 65 18 ASP A 601 ? ? 59.30 19.95 66 18 ASP A 617 ? ? -174.88 -45.53 67 18 ARG A 642 ? ? 70.99 98.00 68 19 SER A 568 ? ? -91.95 47.18 69 19 LYS A 571 ? ? 55.70 79.78 70 19 VAL A 575 ? ? 58.39 82.32 71 19 MET A 580 ? ? 66.17 -131.04 72 19 ASP A 617 ? ? -143.46 46.89 73 19 ARG A 642 ? ? 68.85 114.38 74 20 SER A 574 ? ? 70.67 84.85 75 20 VAL A 575 ? ? -58.77 98.98 76 20 ARG A 576 ? ? -127.06 -167.37 77 20 ARG A 642 ? ? 68.75 107.23 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 HIS N N N N 117 HIS CA C N S 118 HIS C C N N 119 HIS O O N N 120 HIS CB C N N 121 HIS CG C Y N 122 HIS ND1 N Y N 123 HIS CD2 C Y N 124 HIS CE1 C Y N 125 HIS NE2 N Y N 126 HIS OXT O N N 127 HIS H H N N 128 HIS H2 H N N 129 HIS HA H N N 130 HIS HB2 H N N 131 HIS HB3 H N N 132 HIS HD1 H N N 133 HIS HD2 H N N 134 HIS HE1 H N N 135 HIS HE2 H N N 136 HIS HXT H N N 137 ILE N N N N 138 ILE CA C N S 139 ILE C C N N 140 ILE O O N N 141 ILE CB C N S 142 ILE CG1 C N N 143 ILE CG2 C N N 144 ILE CD1 C N N 145 ILE OXT O N N 146 ILE H H N N 147 ILE H2 H N N 148 ILE HA H N N 149 ILE HB H N N 150 ILE HG12 H N N 151 ILE HG13 H N N 152 ILE HG21 H N N 153 ILE HG22 H N N 154 ILE HG23 H N N 155 ILE HD11 H N N 156 ILE HD12 H N N 157 ILE HD13 H N N 158 ILE HXT H N N 159 LEU N N N N 160 LEU CA C N S 161 LEU C C N N 162 LEU O O N N 163 LEU CB C N N 164 LEU CG C N N 165 LEU CD1 C N N 166 LEU CD2 C N N 167 LEU OXT O N N 168 LEU H H N N 169 LEU H2 H N N 170 LEU HA H N N 171 LEU HB2 H N N 172 LEU HB3 H N N 173 LEU HG H N N 174 LEU HD11 H N N 175 LEU HD12 H N N 176 LEU HD13 H N N 177 LEU HD21 H N N 178 LEU HD22 H N N 179 LEU HD23 H N N 180 LEU HXT H N N 181 LYS N N N N 182 LYS CA C N S 183 LYS C C N N 184 LYS O O N N 185 LYS CB C N N 186 LYS CG C N N 187 LYS CD C N N 188 LYS CE C N N 189 LYS NZ N N N 190 LYS OXT O N N 191 LYS H H N N 192 LYS H2 H N N 193 LYS HA H N N 194 LYS HB2 H N N 195 LYS HB3 H N N 196 LYS HG2 H N N 197 LYS HG3 H N N 198 LYS HD2 H N N 199 LYS HD3 H N N 200 LYS HE2 H N N 201 LYS HE3 H N N 202 LYS HZ1 H N N 203 LYS HZ2 H N N 204 LYS HZ3 H N N 205 LYS HXT H N N 206 MET N N N N 207 MET CA C N S 208 MET C C N N 209 MET O O N N 210 MET CB C N N 211 MET CG C N N 212 MET SD S N N 213 MET CE C N N 214 MET OXT O N N 215 MET H H N N 216 MET H2 H N N 217 MET HA H N N 218 MET HB2 H N N 219 MET HB3 H N N 220 MET HG2 H N N 221 MET HG3 H N N 222 MET HE1 H N N 223 MET HE2 H N N 224 MET HE3 H N N 225 MET HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 SER N CA sing N N 239 SER N H sing N N 240 SER N H2 sing N N 241 SER CA C sing N N 242 SER CA CB sing N N 243 SER CA HA sing N N 244 SER C O doub N N 245 SER C OXT sing N N 246 SER CB OG sing N N 247 SER CB HB2 sing N N 248 SER CB HB3 sing N N 249 SER OG HG sing N N 250 SER OXT HXT sing N N 251 THR N CA sing N N 252 THR N H sing N N 253 THR N H2 sing N N 254 THR CA C sing N N 255 THR CA CB sing N N 256 THR CA HA sing N N 257 THR C O doub N N 258 THR C OXT sing N N 259 THR CB OG1 sing N N 260 THR CB CG2 sing N N 261 THR CB HB sing N N 262 THR OG1 HG1 sing N N 263 THR CG2 HG21 sing N N 264 THR CG2 HG22 sing N N 265 THR CG2 HG23 sing N N 266 THR OXT HXT sing N N 267 TYR N CA sing N N 268 TYR N H sing N N 269 TYR N H2 sing N N 270 TYR CA C sing N N 271 TYR CA CB sing N N 272 TYR CA HA sing N N 273 TYR C O doub N N 274 TYR C OXT sing N N 275 TYR CB CG sing N N 276 TYR CB HB2 sing N N 277 TYR CB HB3 sing N N 278 TYR CG CD1 doub Y N 279 TYR CG CD2 sing Y N 280 TYR CD1 CE1 sing Y N 281 TYR CD1 HD1 sing N N 282 TYR CD2 CE2 doub Y N 283 TYR CD2 HD2 sing N N 284 TYR CE1 CZ doub Y N 285 TYR CE1 HE1 sing N N 286 TYR CE2 CZ sing Y N 287 TYR CE2 HE2 sing N N 288 TYR CZ OH sing N N 289 TYR OH HH sing N N 290 TYR OXT HXT sing N N 291 VAL N CA sing N N 292 VAL N H sing N N 293 VAL N H2 sing N N 294 VAL CA C sing N N 295 VAL CA CB sing N N 296 VAL CA HA sing N N 297 VAL C O doub N N 298 VAL C OXT sing N N 299 VAL CB CG1 sing N N 300 VAL CB CG2 sing N N 301 VAL CB HB sing N N 302 VAL CG1 HG11 sing N N 303 VAL CG1 HG12 sing N N 304 VAL CG1 HG13 sing N N 305 VAL CG2 HG21 sing N N 306 VAL CG2 HG22 sing N N 307 VAL CG2 HG23 sing N N 308 VAL OXT HXT sing N N 309 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details 'Final C-terminal domain of E. cuniculi CPSF73, as defined by limited proteolysis' #