data_8B8S # _entry.id 8B8S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8B8S pdb_00008b8s 10.2210/pdb8b8s/pdb WWPDB D_1292125681 ? ? BMRB 34761 ? 10.13018/BMR34761 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-09 2 'Structure model' 1 1 2023-01-11 3 'Structure model' 1 2 2023-02-08 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_citation.page_first' 3 3 'Structure model' '_citation.page_last' 4 3 'Structure model' '_citation.year' 5 3 'Structure model' '_citation_author.identifier_ORCID' 6 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8B8S _pdbx_database_status.recvd_initial_deposition_date 2022-10-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type SASBDB 'SASDQT5 entry constain same protein molecular system (RRM1,2 of NPL3)' SASDQT5 'associated SAS data' BMRB 'Solution structure of tandem RRM1 and RRM2 domains of yeast NPL3' 34761 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email sattler@helmholtz-muenchen.de _pdbx_contact_author.name_first Michael _pdbx_contact_author.name_last Sattler _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1594-0527 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kachariya, N.' 1 0000-0002-0839-3668 'Sattler, M.' 2 0000-0002-1594-0527 'Keil, P.' 3 ? 'Strasser, K.' 4 0000-0003-3533-5516 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary 'Nucleic Acids Res.' NARHAD 0389 1362-4962 ? ? 51 ? 831 851 'Npl3 functions in mRNP assembly by recruitment of mRNP components to the transcription site and their transfer onto the mRNA.' 2023 ? 10.1093/nar/gkac1206 36583366 ? ? ? ? ? ? ? ? ? US ? ? 1 Biorxiv ? ? 2692-8205 ? ? ? ? ? ? 'Npl3 functions in mRNP assembly by recruitment of mRNP components to the transcription site and their transfer onto the mRNA' 2022 ? 10.1101/2022.07.22.501171 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Keil, P.' 1 ? primary 'Wulf, A.' 2 ? primary 'Kachariya, N.' 3 ? primary 'Reuscher, S.' 4 ? primary 'Huhn, K.' 5 ? primary 'Silbern, I.' 6 ? primary 'Altmuller, J.' 7 ? primary 'Keller, M.' 8 ? primary 'Stehle, R.' 9 ? primary 'Zarnack, K.' 10 ? primary 'Sattler, M.' 11 ? primary 'Urlaub, H.' 12 ? primary 'Strasser, K.' 13 ? 1 'Keil, P.' 14 ? 1 'Wulf, A.' 15 ? 1 'Kachariya, N.' 16 ? 1 'Reuscher, S.' 17 ? 1 'Huhn, K.' 18 ? 1 'Silbern, I.' 19 ? 1 'Altmuller, J.' 20 ? 1 'Stehle, R.' 21 ? 1 'Zarnack, K.' 22 ? 1 'Sattler, M.' 23 ? 1 'Urlaub, H.' 24 ? 1 'Strasser, K.' 25 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Serine/arginine (SR)-type shuttling mRNA binding protein NPL3' _entity.formula_weight 18228.414 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Mitochondrial targeting suppressor 1 protein,Nuclear polyadenylated RNA-binding protein 1,Nuclear protein localization protein 3,Polyadenylate-binding protein NPL3 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILNGFAFVEFEEAESAAKAIEEVHGKSFANQPLEVVYSKLPAKR YRITMKNLPEGCSWQDLKDLARENSLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITVERDDNPPPI R ; _entity_poly.pdbx_seq_one_letter_code_can ;GELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILNGFAFVEFEEAESAAKAIEEVHGKSFANQPLEVVYSKLPAKR YRITMKNLPEGCSWQDLKDLARENSLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITVERDDNPPPI R ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 LEU n 1 4 SER n 1 5 ASN n 1 6 THR n 1 7 ARG n 1 8 LEU n 1 9 PHE n 1 10 VAL n 1 11 ARG n 1 12 PRO n 1 13 PHE n 1 14 PRO n 1 15 LEU n 1 16 ASP n 1 17 VAL n 1 18 GLN n 1 19 GLU n 1 20 SER n 1 21 GLU n 1 22 LEU n 1 23 ASN n 1 24 GLU n 1 25 ILE n 1 26 PHE n 1 27 GLY n 1 28 PRO n 1 29 PHE n 1 30 GLY n 1 31 PRO n 1 32 MET n 1 33 LYS n 1 34 GLU n 1 35 VAL n 1 36 LYS n 1 37 ILE n 1 38 LEU n 1 39 ASN n 1 40 GLY n 1 41 PHE n 1 42 ALA n 1 43 PHE n 1 44 VAL n 1 45 GLU n 1 46 PHE n 1 47 GLU n 1 48 GLU n 1 49 ALA n 1 50 GLU n 1 51 SER n 1 52 ALA n 1 53 ALA n 1 54 LYS n 1 55 ALA n 1 56 ILE n 1 57 GLU n 1 58 GLU n 1 59 VAL n 1 60 HIS n 1 61 GLY n 1 62 LYS n 1 63 SER n 1 64 PHE n 1 65 ALA n 1 66 ASN n 1 67 GLN n 1 68 PRO n 1 69 LEU n 1 70 GLU n 1 71 VAL n 1 72 VAL n 1 73 TYR n 1 74 SER n 1 75 LYS n 1 76 LEU n 1 77 PRO n 1 78 ALA n 1 79 LYS n 1 80 ARG n 1 81 TYR n 1 82 ARG n 1 83 ILE n 1 84 THR n 1 85 MET n 1 86 LYS n 1 87 ASN n 1 88 LEU n 1 89 PRO n 1 90 GLU n 1 91 GLY n 1 92 CYS n 1 93 SER n 1 94 TRP n 1 95 GLN n 1 96 ASP n 1 97 LEU n 1 98 LYS n 1 99 ASP n 1 100 LEU n 1 101 ALA n 1 102 ARG n 1 103 GLU n 1 104 ASN n 1 105 SER n 1 106 LEU n 1 107 GLU n 1 108 THR n 1 109 THR n 1 110 PHE n 1 111 SER n 1 112 SER n 1 113 VAL n 1 114 ASN n 1 115 THR n 1 116 ARG n 1 117 ASP n 1 118 PHE n 1 119 ASP n 1 120 GLY n 1 121 THR n 1 122 GLY n 1 123 ALA n 1 124 LEU n 1 125 GLU n 1 126 PHE n 1 127 PRO n 1 128 SER n 1 129 GLU n 1 130 GLU n 1 131 ILE n 1 132 LEU n 1 133 VAL n 1 134 GLU n 1 135 ALA n 1 136 LEU n 1 137 GLU n 1 138 ARG n 1 139 LEU n 1 140 ASN n 1 141 ASN n 1 142 ILE n 1 143 GLU n 1 144 PHE n 1 145 ARG n 1 146 GLY n 1 147 SER n 1 148 VAL n 1 149 ILE n 1 150 THR n 1 151 VAL n 1 152 GLU n 1 153 ARG n 1 154 ASP n 1 155 ASP n 1 156 ASN n 1 157 PRO n 1 158 PRO n 1 159 PRO n 1 160 ILE n 1 161 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 161 _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NPL3, MTR13, MTS1, NAB1, NOP3, YDR432W, D9461.19' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details Uniprot _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc '204508 / S288c' _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type 'Expression vector' _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET family vector' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 120 120 GLY GLY A . n A 1 2 GLU 2 121 121 GLU GLU A . n A 1 3 LEU 3 122 122 LEU LEU A . n A 1 4 SER 4 123 123 SER SER A . n A 1 5 ASN 5 124 124 ASN ASN A . n A 1 6 THR 6 125 125 THR THR A . n A 1 7 ARG 7 126 126 ARG ARG A . n A 1 8 LEU 8 127 127 LEU LEU A . n A 1 9 PHE 9 128 128 PHE PHE A . n A 1 10 VAL 10 129 129 VAL VAL A . n A 1 11 ARG 11 130 130 ARG ARG A . n A 1 12 PRO 12 131 131 PRO PRO A . n A 1 13 PHE 13 132 132 PHE PHE A . n A 1 14 PRO 14 133 133 PRO PRO A . n A 1 15 LEU 15 134 134 LEU LEU A . n A 1 16 ASP 16 135 135 ASP ASP A . n A 1 17 VAL 17 136 136 VAL VAL A . n A 1 18 GLN 18 137 137 GLN GLN A . n A 1 19 GLU 19 138 138 GLU GLU A . n A 1 20 SER 20 139 139 SER SER A . n A 1 21 GLU 21 140 140 GLU GLU A . n A 1 22 LEU 22 141 141 LEU LEU A . n A 1 23 ASN 23 142 142 ASN ASN A . n A 1 24 GLU 24 143 143 GLU GLU A . n A 1 25 ILE 25 144 144 ILE ILE A . n A 1 26 PHE 26 145 145 PHE PHE A . n A 1 27 GLY 27 146 146 GLY GLY A . n A 1 28 PRO 28 147 147 PRO PRO A . n A 1 29 PHE 29 148 148 PHE PHE A . n A 1 30 GLY 30 149 149 GLY GLY A . n A 1 31 PRO 31 150 150 PRO PRO A . n A 1 32 MET 32 151 151 MET MET A . n A 1 33 LYS 33 152 152 LYS LYS A . n A 1 34 GLU 34 153 153 GLU GLU A . n A 1 35 VAL 35 154 154 VAL VAL A . n A 1 36 LYS 36 155 155 LYS LYS A . n A 1 37 ILE 37 156 156 ILE ILE A . n A 1 38 LEU 38 157 157 LEU LEU A . n A 1 39 ASN 39 158 158 ASN ASN A . n A 1 40 GLY 40 159 159 GLY GLY A . n A 1 41 PHE 41 160 160 PHE PHE A . n A 1 42 ALA 42 161 161 ALA ALA A . n A 1 43 PHE 43 162 162 PHE PHE A . n A 1 44 VAL 44 163 163 VAL VAL A . n A 1 45 GLU 45 164 164 GLU GLU A . n A 1 46 PHE 46 165 165 PHE PHE A . n A 1 47 GLU 47 166 166 GLU GLU A . n A 1 48 GLU 48 167 167 GLU GLU A . n A 1 49 ALA 49 168 168 ALA ALA A . n A 1 50 GLU 50 169 169 GLU GLU A . n A 1 51 SER 51 170 170 SER SER A . n A 1 52 ALA 52 171 171 ALA ALA A . n A 1 53 ALA 53 172 172 ALA ALA A . n A 1 54 LYS 54 173 173 LYS LYS A . n A 1 55 ALA 55 174 174 ALA ALA A . n A 1 56 ILE 56 175 175 ILE ILE A . n A 1 57 GLU 57 176 176 GLU GLU A . n A 1 58 GLU 58 177 177 GLU GLU A . n A 1 59 VAL 59 178 178 VAL VAL A . n A 1 60 HIS 60 179 179 HIS HIS A . n A 1 61 GLY 61 180 180 GLY GLY A . n A 1 62 LYS 62 181 181 LYS LYS A . n A 1 63 SER 63 182 182 SER SER A . n A 1 64 PHE 64 183 183 PHE PHE A . n A 1 65 ALA 65 184 184 ALA ALA A . n A 1 66 ASN 66 185 185 ASN ASN A . n A 1 67 GLN 67 186 186 GLN GLN A . n A 1 68 PRO 68 187 187 PRO PRO A . n A 1 69 LEU 69 188 188 LEU LEU A . n A 1 70 GLU 70 189 189 GLU GLU A . n A 1 71 VAL 71 190 190 VAL VAL A . n A 1 72 VAL 72 191 191 VAL VAL A . n A 1 73 TYR 73 192 192 TYR TYR A . n A 1 74 SER 74 193 193 SER SER A . n A 1 75 LYS 75 194 194 LYS LYS A . n A 1 76 LEU 76 195 195 LEU LEU A . n A 1 77 PRO 77 196 196 PRO PRO A . n A 1 78 ALA 78 197 197 ALA ALA A . n A 1 79 LYS 79 198 198 LYS LYS A . n A 1 80 ARG 80 199 199 ARG ARG A . n A 1 81 TYR 81 200 200 TYR TYR A . n A 1 82 ARG 82 201 201 ARG ARG A . n A 1 83 ILE 83 202 202 ILE ILE A . n A 1 84 THR 84 203 203 THR THR A . n A 1 85 MET 85 204 204 MET MET A . n A 1 86 LYS 86 205 205 LYS LYS A . n A 1 87 ASN 87 206 206 ASN ASN A . n A 1 88 LEU 88 207 207 LEU LEU A . n A 1 89 PRO 89 208 208 PRO PRO A . n A 1 90 GLU 90 209 209 GLU GLU A . n A 1 91 GLY 91 210 210 GLY GLY A . n A 1 92 CYS 92 211 211 CYS CYS A . n A 1 93 SER 93 212 212 SER SER A . n A 1 94 TRP 94 213 213 TRP TRP A . n A 1 95 GLN 95 214 214 GLN GLN A . n A 1 96 ASP 96 215 215 ASP ASP A . n A 1 97 LEU 97 216 216 LEU LEU A . n A 1 98 LYS 98 217 217 LYS LYS A . n A 1 99 ASP 99 218 218 ASP ASP A . n A 1 100 LEU 100 219 219 LEU LEU A . n A 1 101 ALA 101 220 220 ALA ALA A . n A 1 102 ARG 102 221 221 ARG ARG A . n A 1 103 GLU 103 222 222 GLU GLU A . n A 1 104 ASN 104 223 223 ASN ASN A . n A 1 105 SER 105 224 224 SER SER A . n A 1 106 LEU 106 225 225 LEU LEU A . n A 1 107 GLU 107 226 226 GLU GLU A . n A 1 108 THR 108 227 227 THR THR A . n A 1 109 THR 109 228 228 THR THR A . n A 1 110 PHE 110 229 229 PHE PHE A . n A 1 111 SER 111 230 230 SER SER A . n A 1 112 SER 112 231 231 SER SER A . n A 1 113 VAL 113 232 232 VAL VAL A . n A 1 114 ASN 114 233 233 ASN ASN A . n A 1 115 THR 115 234 234 THR THR A . n A 1 116 ARG 116 235 235 ARG ARG A . n A 1 117 ASP 117 236 236 ASP ASP A . n A 1 118 PHE 118 237 237 PHE PHE A . n A 1 119 ASP 119 238 238 ASP ASP A . n A 1 120 GLY 120 239 239 GLY GLY A . n A 1 121 THR 121 240 240 THR THR A . n A 1 122 GLY 122 241 241 GLY GLY A . n A 1 123 ALA 123 242 242 ALA ALA A . n A 1 124 LEU 124 243 243 LEU LEU A . n A 1 125 GLU 125 244 244 GLU GLU A . n A 1 126 PHE 126 245 245 PHE PHE A . n A 1 127 PRO 127 246 246 PRO PRO A . n A 1 128 SER 128 247 247 SER SER A . n A 1 129 GLU 129 248 248 GLU GLU A . n A 1 130 GLU 130 249 249 GLU GLU A . n A 1 131 ILE 131 250 250 ILE ILE A . n A 1 132 LEU 132 251 251 LEU LEU A . n A 1 133 VAL 133 252 252 VAL VAL A . n A 1 134 GLU 134 253 253 GLU GLU A . n A 1 135 ALA 135 254 254 ALA ALA A . n A 1 136 LEU 136 255 255 LEU LEU A . n A 1 137 GLU 137 256 256 GLU GLU A . n A 1 138 ARG 138 257 257 ARG ARG A . n A 1 139 LEU 139 258 258 LEU LEU A . n A 1 140 ASN 140 259 259 ASN ASN A . n A 1 141 ASN 141 260 260 ASN ASN A . n A 1 142 ILE 142 261 261 ILE ILE A . n A 1 143 GLU 143 262 262 GLU GLU A . n A 1 144 PHE 144 263 263 PHE PHE A . n A 1 145 ARG 145 264 264 ARG ARG A . n A 1 146 GLY 146 265 265 GLY GLY A . n A 1 147 SER 147 266 266 SER SER A . n A 1 148 VAL 148 267 267 VAL VAL A . n A 1 149 ILE 149 268 268 ILE ILE A . n A 1 150 THR 150 269 269 THR THR A . n A 1 151 VAL 151 270 270 VAL VAL A . n A 1 152 GLU 152 271 271 GLU GLU A . n A 1 153 ARG 153 272 272 ARG ARG A . n A 1 154 ASP 154 273 273 ASP ASP A . n A 1 155 ASP 155 274 274 ASP ASP A . n A 1 156 ASN 156 275 275 ASN ASN A . n A 1 157 PRO 157 276 276 PRO PRO A . n A 1 158 PRO 158 277 277 PRO PRO A . n A 1 159 PRO 159 278 278 PRO PRO A . n A 1 160 ILE 160 279 279 ILE ILE A . n A 1 161 ARG 161 280 280 ARG ARG A . n # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.entry_id _exptl.crystals_number _exptl.details _exptl.method _exptl.method_details ? ? ? ? ? 8B8S ? ? 'SOLUTION NMR' ? ? ? ? ? ? 8B8S ? ? 'SOLUTION SCATTERING' ? # _struct.entry_id 8B8S _struct.title 'Solution structure of tandem RRM1 and RRM2 domains of yeast NPL3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8B8S _struct_keywords.text ;Serine/arginine (SR)-type mRNA binding protein, Paramagnetic relaxation enhancement (PRE) based solution NMR structure, RNA BINDING PROTEIN ; _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NOP3_YEAST _struct_ref.pdbx_db_accession Q01560 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILNGFAFVEFEEAESAAKAIEEVHGKSFANQPLEVVYSKLPAKR YRITMKNLPEGCSWQDLKDLARENSLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITVERDDNPPPI R ; _struct_ref.pdbx_align_begin 120 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8B8S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 161 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q01560 _struct_ref_seq.db_align_beg 120 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 280 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 120 _struct_ref_seq.pdbx_auth_seq_align_end 280 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 18 ? GLY A 27 ? GLN A 137 GLY A 146 1 ? 10 HELX_P HELX_P2 AA2 GLU A 48 ? VAL A 59 ? GLU A 167 VAL A 178 1 ? 12 HELX_P HELX_P3 AA3 SER A 93 ? ASN A 104 ? SER A 212 ASN A 223 1 ? 12 HELX_P HELX_P4 AA4 SER A 128 ? ASN A 140 ? SER A 247 ASN A 259 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 32 ? LEU A 38 ? MET A 151 LEU A 157 AA1 2 PHE A 41 ? PHE A 46 ? PHE A 160 PHE A 165 AA1 3 LEU A 8 ? VAL A 10 ? LEU A 127 VAL A 129 AA1 4 VAL A 71 ? TYR A 73 ? VAL A 190 TYR A 192 AA2 1 SER A 63 ? PHE A 64 ? SER A 182 PHE A 183 AA2 2 GLN A 67 ? PRO A 68 ? GLN A 186 PRO A 187 AA3 1 PHE A 110 ? VAL A 113 ? PHE A 229 VAL A 232 AA3 2 GLY A 122 ? GLU A 125 ? GLY A 241 GLU A 244 AA3 3 ARG A 82 ? LYS A 86 ? ARG A 201 LYS A 205 AA3 4 SER A 147 ? GLU A 152 ? SER A 266 GLU A 271 AA3 5 ILE A 142 ? PHE A 144 ? ILE A 261 PHE A 263 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 36 ? N LYS A 155 O PHE A 43 ? O PHE A 162 AA1 2 3 O VAL A 44 ? O VAL A 163 N LEU A 8 ? N LEU A 127 AA1 3 4 N PHE A 9 ? N PHE A 128 O VAL A 72 ? O VAL A 191 AA2 1 2 N PHE A 64 ? N PHE A 183 O GLN A 67 ? O GLN A 186 AA3 1 2 N SER A 112 ? N SER A 231 O ALA A 123 ? O ALA A 242 AA3 2 3 O LEU A 124 ? O LEU A 243 N ILE A 83 ? N ILE A 202 AA3 3 4 N THR A 84 ? N THR A 203 O GLU A 152 ? O GLU A 271 AA3 4 5 O SER A 147 ? O SER A 266 N PHE A 144 ? N PHE A 263 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A CYS 211 ? ? OD2 A ASP 215 ? ? 2.04 2 2 O A CYS 211 ? ? OD2 A ASP 215 ? ? 2.04 3 3 O A CYS 211 ? ? OD2 A ASP 215 ? ? 2.04 4 4 O A CYS 211 ? ? OD2 A ASP 215 ? ? 2.04 5 5 O A CYS 211 ? ? OD2 A ASP 215 ? ? 2.04 6 6 O A CYS 211 ? ? OD2 A ASP 215 ? ? 2.04 7 7 O A CYS 211 ? ? OD2 A ASP 215 ? ? 2.04 8 8 O A CYS 211 ? ? OD2 A ASP 215 ? ? 2.04 9 9 O A CYS 211 ? ? OD2 A ASP 215 ? ? 2.04 10 10 O A CYS 211 ? ? OD2 A ASP 215 ? ? 2.04 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A CYS 211 ? ? N A SER 212 ? ? CA A SER 212 ? ? 139.99 121.70 18.29 2.50 Y 2 2 C A CYS 211 ? ? N A SER 212 ? ? CA A SER 212 ? ? 140.06 121.70 18.36 2.50 Y 3 3 C A CYS 211 ? ? N A SER 212 ? ? CA A SER 212 ? ? 139.99 121.70 18.29 2.50 Y 4 4 C A CYS 211 ? ? N A SER 212 ? ? CA A SER 212 ? ? 139.98 121.70 18.28 2.50 Y 5 5 C A CYS 211 ? ? N A SER 212 ? ? CA A SER 212 ? ? 139.95 121.70 18.25 2.50 Y 6 6 C A CYS 211 ? ? N A SER 212 ? ? CA A SER 212 ? ? 139.98 121.70 18.28 2.50 Y 7 7 C A CYS 211 ? ? N A SER 212 ? ? CA A SER 212 ? ? 139.97 121.70 18.27 2.50 Y 8 8 C A CYS 211 ? ? N A SER 212 ? ? CA A SER 212 ? ? 139.97 121.70 18.27 2.50 Y 9 9 C A CYS 211 ? ? N A SER 212 ? ? CA A SER 212 ? ? 139.88 121.70 18.18 2.50 Y 10 10 C A CYS 211 ? ? N A SER 212 ? ? CA A SER 212 ? ? 139.95 121.70 18.25 2.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 121 ? ? -142.36 23.70 2 1 LEU A 122 ? ? -73.99 -100.21 3 1 ASN A 124 ? ? -179.85 -36.57 4 1 ARG A 126 ? ? 178.97 118.55 5 1 PRO A 133 ? ? -69.72 -161.35 6 1 PRO A 147 ? ? -69.80 60.42 7 1 PHE A 148 ? ? -149.01 -41.56 8 1 PRO A 150 ? ? -69.74 90.83 9 1 MET A 151 ? ? -59.20 109.32 10 1 ASN A 158 ? ? -61.45 93.83 11 1 GLU A 177 ? ? -95.22 -61.88 12 1 PHE A 183 ? ? -171.85 132.43 13 1 SER A 193 ? ? -40.09 87.84 14 1 PRO A 196 ? ? -100.23 -151.28 15 1 LYS A 198 ? ? 59.82 153.25 16 1 PRO A 208 ? ? -69.80 66.36 17 1 CYS A 211 ? ? 5.05 -108.14 18 1 SER A 212 ? ? 123.97 174.74 19 1 ASN A 260 ? ? 60.30 86.00 20 1 PRO A 277 ? ? -33.25 142.75 21 2 GLU A 121 ? ? -139.22 -36.92 22 2 LEU A 122 ? ? -120.85 -78.62 23 2 ASN A 124 ? ? -164.20 -36.55 24 2 ARG A 126 ? ? 179.05 118.67 25 2 PRO A 133 ? ? -69.65 -161.54 26 2 PRO A 147 ? ? -69.84 60.34 27 2 PHE A 148 ? ? -148.94 -41.48 28 2 PRO A 150 ? ? -69.80 90.97 29 2 MET A 151 ? ? -59.40 109.42 30 2 ASN A 158 ? ? -61.51 93.89 31 2 GLU A 177 ? ? -95.10 -61.81 32 2 PHE A 183 ? ? -171.92 132.50 33 2 SER A 193 ? ? -26.13 -32.89 34 2 LYS A 194 ? ? -67.48 -168.76 35 2 PRO A 196 ? ? -99.05 -139.15 36 2 ALA A 197 ? ? -154.94 -157.92 37 2 LYS A 198 ? ? -46.97 162.55 38 2 PRO A 208 ? ? -69.71 66.29 39 2 CYS A 211 ? ? 5.04 -107.92 40 2 SER A 212 ? ? 123.52 174.63 41 2 ASN A 260 ? ? 60.27 86.12 42 2 PRO A 276 ? ? -49.39 153.80 43 2 PRO A 278 ? ? -101.17 -95.90 44 2 ILE A 279 ? ? -125.74 -139.69 45 3 SER A 123 ? ? 55.33 12.67 46 3 ASN A 124 ? ? -33.69 -36.61 47 3 ARG A 126 ? ? 179.01 118.68 48 3 PRO A 133 ? ? -69.68 -161.53 49 3 PRO A 147 ? ? -69.88 60.44 50 3 PHE A 148 ? ? -149.01 -41.58 51 3 PRO A 150 ? ? -69.84 91.25 52 3 MET A 151 ? ? -59.75 109.44 53 3 ASN A 158 ? ? -61.60 93.95 54 3 GLU A 177 ? ? -94.92 -61.83 55 3 PHE A 183 ? ? -172.09 132.33 56 3 SER A 193 ? ? -42.75 91.43 57 3 LYS A 194 ? ? -156.64 -131.17 58 3 LEU A 195 ? ? -170.66 130.98 59 3 PRO A 196 ? ? -100.49 -162.71 60 3 ALA A 197 ? ? 179.67 147.59 61 3 LYS A 198 ? ? 61.66 130.98 62 3 PRO A 208 ? ? -69.77 66.31 63 3 CYS A 211 ? ? 5.06 -108.13 64 3 SER A 212 ? ? 123.99 174.71 65 3 ASN A 260 ? ? 60.26 86.03 66 3 PRO A 278 ? ? -64.20 93.66 67 3 ILE A 279 ? ? 6.32 70.78 68 4 SER A 123 ? ? 70.32 86.13 69 4 ASN A 124 ? ? 179.62 -36.73 70 4 ARG A 126 ? ? 178.99 118.61 71 4 PRO A 133 ? ? -69.73 -161.47 72 4 PRO A 147 ? ? -69.77 60.39 73 4 PHE A 148 ? ? -148.97 -41.66 74 4 PRO A 150 ? ? -69.78 90.96 75 4 MET A 151 ? ? -59.37 109.40 76 4 ASN A 158 ? ? -61.24 93.81 77 4 GLU A 177 ? ? -95.06 -61.81 78 4 PHE A 183 ? ? -172.00 132.39 79 4 SER A 193 ? ? 44.36 -92.96 80 4 LYS A 194 ? ? -174.59 145.80 81 4 LEU A 195 ? ? -171.42 148.38 82 4 ALA A 197 ? ? 171.48 156.52 83 4 PRO A 208 ? ? -69.77 66.28 84 4 CYS A 211 ? ? 4.99 -107.96 85 4 SER A 212 ? ? 123.79 174.64 86 4 ASN A 260 ? ? 60.35 86.04 87 4 PRO A 278 ? ? -28.22 -42.79 88 4 ILE A 279 ? ? -66.39 -170.10 89 5 LEU A 122 ? ? -65.36 84.80 90 5 SER A 123 ? ? 57.52 173.01 91 5 ASN A 124 ? ? -147.52 -36.90 92 5 ARG A 126 ? ? 179.07 118.62 93 5 PRO A 133 ? ? -69.78 -161.43 94 5 PRO A 147 ? ? -69.90 60.42 95 5 PHE A 148 ? ? -149.00 -41.58 96 5 PRO A 150 ? ? -69.85 91.02 97 5 MET A 151 ? ? -59.43 109.36 98 5 ASN A 158 ? ? -61.48 93.87 99 5 GLU A 177 ? ? -94.98 -61.87 100 5 PHE A 183 ? ? -171.81 132.43 101 5 SER A 193 ? ? -41.34 86.13 102 5 LYS A 194 ? ? -179.34 -143.97 103 5 PRO A 196 ? ? -102.95 -139.24 104 5 ALA A 197 ? ? -130.13 -147.28 105 5 LYS A 198 ? ? -55.54 176.57 106 5 PRO A 208 ? ? -69.79 66.32 107 5 CYS A 211 ? ? 5.05 -107.99 108 5 SER A 212 ? ? 123.77 174.70 109 5 ASN A 260 ? ? 60.29 86.03 110 5 PRO A 278 ? ? -39.18 168.83 111 6 GLU A 121 ? ? -141.77 47.42 112 6 SER A 123 ? ? 34.63 88.36 113 6 ASN A 124 ? ? 175.90 -36.83 114 6 ARG A 126 ? ? 178.95 118.51 115 6 PRO A 133 ? ? -69.69 -161.46 116 6 PRO A 147 ? ? -69.77 60.38 117 6 PHE A 148 ? ? -148.94 -41.62 118 6 PRO A 150 ? ? -69.85 91.17 119 6 MET A 151 ? ? -59.66 109.42 120 6 ASN A 158 ? ? -61.54 93.84 121 6 GLU A 177 ? ? -95.05 -61.83 122 6 PHE A 183 ? ? -171.99 132.48 123 6 SER A 193 ? ? -19.00 -44.97 124 6 LYS A 194 ? ? -45.05 162.66 125 6 PRO A 196 ? ? -102.05 -162.88 126 6 ALA A 197 ? ? -122.09 -113.54 127 6 PRO A 208 ? ? -69.82 66.36 128 6 CYS A 211 ? ? 5.02 -108.09 129 6 SER A 212 ? ? 123.89 174.68 130 6 ASN A 260 ? ? 60.28 86.04 131 6 PRO A 277 ? ? -26.44 110.03 132 6 PRO A 278 ? ? -66.52 -113.60 133 7 GLU A 121 ? ? -144.97 -82.59 134 7 ASN A 124 ? ? -130.68 -36.73 135 7 ARG A 126 ? ? 179.03 118.53 136 7 PRO A 133 ? ? -69.57 -161.46 137 7 PRO A 147 ? ? -69.74 60.36 138 7 PHE A 148 ? ? -149.00 -41.49 139 7 PRO A 150 ? ? -69.83 90.79 140 7 MET A 151 ? ? -59.10 109.25 141 7 ASN A 158 ? ? -61.51 93.92 142 7 GLU A 177 ? ? -94.96 -61.78 143 7 PHE A 183 ? ? -172.04 132.42 144 7 SER A 193 ? ? -39.53 101.08 145 7 LYS A 194 ? ? 174.14 164.06 146 7 PRO A 196 ? ? -94.69 -147.73 147 7 LYS A 198 ? ? 62.00 129.07 148 7 PRO A 208 ? ? -69.70 66.28 149 7 CYS A 211 ? ? 5.04 -108.01 150 7 SER A 212 ? ? 123.76 174.64 151 7 ASN A 260 ? ? 60.30 86.06 152 7 PRO A 278 ? ? -64.33 -158.12 153 8 GLU A 121 ? ? -75.72 -79.07 154 8 LEU A 122 ? ? -75.01 -149.21 155 8 ARG A 126 ? ? 179.00 118.65 156 8 PRO A 133 ? ? -69.65 -161.52 157 8 PRO A 147 ? ? -69.86 60.40 158 8 PHE A 148 ? ? -148.93 -41.59 159 8 PRO A 150 ? ? -69.90 90.91 160 8 MET A 151 ? ? -59.12 109.30 161 8 ASN A 158 ? ? -61.41 93.81 162 8 GLU A 177 ? ? -95.04 -61.86 163 8 PHE A 183 ? ? -171.99 132.38 164 8 SER A 193 ? ? 21.70 -78.33 165 8 ALA A 197 ? ? -87.10 -158.16 166 8 LYS A 198 ? ? 61.80 105.22 167 8 PRO A 208 ? ? -69.74 66.25 168 8 CYS A 211 ? ? 5.02 -108.08 169 8 SER A 212 ? ? 123.98 174.77 170 8 ASN A 260 ? ? 60.20 86.03 171 8 PRO A 277 ? ? -44.09 153.12 172 9 SER A 123 ? ? -158.28 44.00 173 9 ARG A 126 ? ? 179.07 118.64 174 9 PRO A 133 ? ? -69.63 -161.52 175 9 PRO A 147 ? ? -69.76 60.40 176 9 PHE A 148 ? ? -148.96 -41.63 177 9 PRO A 150 ? ? -69.90 90.98 178 9 MET A 151 ? ? -59.30 109.29 179 9 ASN A 158 ? ? -61.86 93.84 180 9 GLU A 177 ? ? -95.04 -61.75 181 9 PHE A 183 ? ? -172.04 132.39 182 9 SER A 193 ? ? -40.32 77.83 183 9 LYS A 194 ? ? 151.69 157.27 184 9 PRO A 196 ? ? -97.18 -147.09 185 9 LYS A 198 ? ? 65.72 126.19 186 9 PRO A 208 ? ? -69.80 66.32 187 9 CYS A 211 ? ? 4.98 -108.12 188 9 SER A 212 ? ? 124.02 174.62 189 9 ASN A 260 ? ? 60.18 86.10 190 9 ILE A 279 ? ? -68.53 92.24 191 10 LEU A 122 ? ? -160.64 44.04 192 10 SER A 123 ? ? 71.92 94.89 193 10 ASN A 124 ? ? -147.70 -36.64 194 10 ARG A 126 ? ? 178.99 118.59 195 10 PRO A 133 ? ? -69.64 -161.48 196 10 PRO A 147 ? ? -69.82 60.41 197 10 PHE A 148 ? ? -148.97 -41.55 198 10 PRO A 150 ? ? -69.73 91.19 199 10 MET A 151 ? ? -59.75 109.52 200 10 ASN A 158 ? ? -60.93 93.73 201 10 GLU A 177 ? ? -95.17 -61.82 202 10 PHE A 183 ? ? -172.10 132.25 203 10 SER A 193 ? ? -20.54 120.61 204 10 LYS A 194 ? ? 87.14 140.12 205 10 LEU A 195 ? ? -170.30 79.25 206 10 PRO A 196 ? ? -96.99 -146.35 207 10 ALA A 197 ? ? 75.91 155.76 208 10 LYS A 198 ? ? -52.50 175.73 209 10 PRO A 208 ? ? -69.89 66.36 210 10 CYS A 211 ? ? 5.06 -108.03 211 10 SER A 212 ? ? 123.83 174.65 212 10 ASN A 260 ? ? 60.30 85.99 213 10 PRO A 278 ? ? -93.26 49.61 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 GLY A 210 ? ? 12.42 2 2 GLY A 210 ? ? 12.42 3 3 GLY A 210 ? ? 12.42 4 4 GLY A 210 ? ? 12.42 5 5 GLY A 210 ? ? 12.41 6 6 GLY A 210 ? ? 12.38 7 7 GLY A 210 ? ? 12.41 8 8 GLY A 210 ? ? 12.38 9 9 GLY A 210 ? ? 12.38 10 10 GLY A 210 ? ? 12.44 # _pdbx_nmr_ensemble.entry_id 8B8S _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8B8S _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '150 uM [U-100% 15N] RRM1,2 of NPL3, 90% H2O/10% D2O' '90% H2O/10% D2O' sample-1 solution ? 2 '1000 uM [U-100% 13C; U-100% 15N] RRM1,2 of NPL3, 90% H2O/10% D2O' '90% H2O/10% D2O' sample-1 solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'RRM1,2 of NPL3' 150 ? uM '[U-100% 15N]' 2 'RRM1,2 of NPL3' 1000 ? uM '[U-100% 13C; U-100% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 70 _pdbx_nmr_exptl_sample_conditions.details ;For PRE (Paramagnetic Relaxation Enhancement) NMR measurement, the IPSL (3-{2-Iodoacetamid}-PROXYL) spin label attached at defined positions on each RRM domain and 1H-15N HSQC spectra recorded at oxidized and reduced state of the protein sample. The reduced state of the spectra measured by adding 10x molar excess of ascorbate in the sample. ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCACB' 1 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HCACO' 1 isotropic 6 1 1 '3D H(CCO)NH' 1 isotropic 7 1 1 '3D C(CO)NH' 1 isotropic # _pdbx_nmr_refine.entry_id 8B8S _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The ensemble structures are based on total of 100 distance restrains derived from PRE experiments, where 69 and 31 are intra- and inter-domain restrains. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 collection TopSpin 3.5pl6 'Bruker Biospin' 6 processing TopSpin ? 'Bruker Biospin' 7 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'chemical shift assignment' 'CcpNmr Analysis' 2.5.0 CCPN 4 'peak picking' 'CcpNmr Analysis' 2.5.0 CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number SPP1935 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 950 'Cryogenic cool probe' 2 'AVANCE III' ? Bruker 900 'Cryogenic cool probe' 3 'AVANCE III' ? Bruker 800 'Cryogenic cool probe' # _atom_sites.entry_id 8B8S _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #