data_8B9O # _entry.id 8B9O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8B9O pdb_00008b9o 10.2210/pdb8b9o/pdb WWPDB D_1292125978 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-07-05 2 'Structure model' 1 1 2023-07-12 3 'Structure model' 1 2 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8B9O _pdbx_database_status.recvd_initial_deposition_date 2022-10-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email tim.clausen@imp.ac.at _pdbx_contact_author.name_first Tim _pdbx_contact_author.name_last Clausen _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1582-6924 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Meinhart, A.' 1 ? 'Hoi, D.M.' 2 ? 'Clausen, T.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Cell _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1097-4172 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 186 _citation.language ? _citation.page_first 2176 _citation.page_last ? _citation.title 'Clp-targeting BacPROTACs impair mycobacterial proteostasis and survival.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.cell.2023.04.009 _citation.pdbx_database_id_PubMed 37137307 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hoi, D.M.' 1 ? primary 'Junker, S.' 2 ? primary 'Junk, L.' 3 ? primary 'Schwechel, K.' 4 ? primary 'Fischel, K.' 5 ? primary 'Podlesainski, D.' 6 ? primary 'Hawkins, P.M.E.' 7 ? primary 'van Geelen, L.' 8 ? primary 'Kaschani, F.' 9 ? primary 'Leodolter, J.' 10 ? primary 'Morreale, F.E.' 11 ? primary 'Kleine, S.' 12 ? primary 'Guha, S.' 13 ? primary 'Rumpel, K.' 14 ? primary 'Schmiedel, V.M.' 15 ? primary 'Weinstabl, H.' 16 ? primary 'Meinhart, A.' 17 ? primary 'Payne, R.J.' 18 ? primary 'Kaiser, M.' 19 ? primary 'Hartl, M.' 20 ? primary 'Boehmelt, G.' 21 ? primary 'Kazmaier, U.' 22 ? primary 'Kalscheuer, R.' 23 ? primary 'Clausen, T.' 24 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Clp amino terminal domain protein' 16818.041 1 ? ? ? ? 2 non-polymer syn phospho-arginine 254.181 1 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MFGRFTPRARNVIVVAHNLAHDARNAEITPDHLLLGLFADTEGLAAKLLAGQGVDADAVRAAVTLPPSTGEAAALIPFDT AAKKALELTFRQALRLGHNYIGTEHILLALVDAEDGDGPLHRLGVDAERFEADLRTALEPFMTKPAELEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MFGRFTPRARNVIVVAHNLAHDARNAEITPDHLLLGLFADTEGLAAKLLAGQGVDADAVRAAVTLPPSTGEAAALIPFDT AAKKALELTFRQALRLGHNYIGTEHILLALVDAEDGDGPLHRLGVDAERFEADLRTALEPFMTKPAELEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 phospho-arginine RPI 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 GLY n 1 4 ARG n 1 5 PHE n 1 6 THR n 1 7 PRO n 1 8 ARG n 1 9 ALA n 1 10 ARG n 1 11 ASN n 1 12 VAL n 1 13 ILE n 1 14 VAL n 1 15 VAL n 1 16 ALA n 1 17 HIS n 1 18 ASN n 1 19 LEU n 1 20 ALA n 1 21 HIS n 1 22 ASP n 1 23 ALA n 1 24 ARG n 1 25 ASN n 1 26 ALA n 1 27 GLU n 1 28 ILE n 1 29 THR n 1 30 PRO n 1 31 ASP n 1 32 HIS n 1 33 LEU n 1 34 LEU n 1 35 LEU n 1 36 GLY n 1 37 LEU n 1 38 PHE n 1 39 ALA n 1 40 ASP n 1 41 THR n 1 42 GLU n 1 43 GLY n 1 44 LEU n 1 45 ALA n 1 46 ALA n 1 47 LYS n 1 48 LEU n 1 49 LEU n 1 50 ALA n 1 51 GLY n 1 52 GLN n 1 53 GLY n 1 54 VAL n 1 55 ASP n 1 56 ALA n 1 57 ASP n 1 58 ALA n 1 59 VAL n 1 60 ARG n 1 61 ALA n 1 62 ALA n 1 63 VAL n 1 64 THR n 1 65 LEU n 1 66 PRO n 1 67 PRO n 1 68 SER n 1 69 THR n 1 70 GLY n 1 71 GLU n 1 72 ALA n 1 73 ALA n 1 74 ALA n 1 75 LEU n 1 76 ILE n 1 77 PRO n 1 78 PHE n 1 79 ASP n 1 80 THR n 1 81 ALA n 1 82 ALA n 1 83 LYS n 1 84 LYS n 1 85 ALA n 1 86 LEU n 1 87 GLU n 1 88 LEU n 1 89 THR n 1 90 PHE n 1 91 ARG n 1 92 GLN n 1 93 ALA n 1 94 LEU n 1 95 ARG n 1 96 LEU n 1 97 GLY n 1 98 HIS n 1 99 ASN n 1 100 TYR n 1 101 ILE n 1 102 GLY n 1 103 THR n 1 104 GLU n 1 105 HIS n 1 106 ILE n 1 107 LEU n 1 108 LEU n 1 109 ALA n 1 110 LEU n 1 111 VAL n 1 112 ASP n 1 113 ALA n 1 114 GLU n 1 115 ASP n 1 116 GLY n 1 117 ASP n 1 118 GLY n 1 119 PRO n 1 120 LEU n 1 121 HIS n 1 122 ARG n 1 123 LEU n 1 124 GLY n 1 125 VAL n 1 126 ASP n 1 127 ALA n 1 128 GLU n 1 129 ARG n 1 130 PHE n 1 131 GLU n 1 132 ALA n 1 133 ASP n 1 134 LEU n 1 135 ARG n 1 136 THR n 1 137 ALA n 1 138 LEU n 1 139 GLU n 1 140 PRO n 1 141 PHE n 1 142 MET n 1 143 THR n 1 144 LYS n 1 145 PRO n 1 146 ALA n 1 147 GLU n 1 148 LEU n 1 149 GLU n 1 150 HIS n 1 151 HIS n 1 152 HIS n 1 153 HIS n 1 154 HIS n 1 155 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 155 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MSMEG_2792 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700084 / mc(2)155' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycolicibacterium smegmatis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1772 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RPI 'L-peptide linking' n phospho-arginine ? 'C6 H15 N4 O5 P' 254.181 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 98 ? ? ? A . n A 1 2 PHE 2 99 99 PHE PHE A . n A 1 3 GLY 3 100 100 GLY GLY A . n A 1 4 ARG 4 101 101 ARG ARG A . n A 1 5 PHE 5 102 102 PHE PHE A . n A 1 6 THR 6 103 103 THR THR A . n A 1 7 PRO 7 104 104 PRO PRO A . n A 1 8 ARG 8 105 105 ARG ARG A . n A 1 9 ALA 9 106 106 ALA ALA A . n A 1 10 ARG 10 107 107 ARG ARG A . n A 1 11 ASN 11 108 108 ASN ASN A . n A 1 12 VAL 12 109 109 VAL VAL A . n A 1 13 ILE 13 110 110 ILE ILE A . n A 1 14 VAL 14 111 111 VAL VAL A . n A 1 15 VAL 15 112 112 VAL VAL A . n A 1 16 ALA 16 113 113 ALA ALA A . n A 1 17 HIS 17 114 114 HIS HIS A . n A 1 18 ASN 18 115 115 ASN ASN A . n A 1 19 LEU 19 116 116 LEU LEU A . n A 1 20 ALA 20 117 117 ALA ALA A . n A 1 21 HIS 21 118 118 HIS HIS A . n A 1 22 ASP 22 119 119 ASP ASP A . n A 1 23 ALA 23 120 120 ALA ALA A . n A 1 24 ARG 24 121 121 ARG ARG A . n A 1 25 ASN 25 122 122 ASN ASN A . n A 1 26 ALA 26 123 123 ALA ALA A . n A 1 27 GLU 27 124 124 GLU GLU A . n A 1 28 ILE 28 125 125 ILE ILE A . n A 1 29 THR 29 126 126 THR THR A . n A 1 30 PRO 30 127 127 PRO PRO A . n A 1 31 ASP 31 128 128 ASP ASP A . n A 1 32 HIS 32 129 129 HIS HIS A . n A 1 33 LEU 33 130 130 LEU LEU A . n A 1 34 LEU 34 131 131 LEU LEU A . n A 1 35 LEU 35 132 132 LEU LEU A . n A 1 36 GLY 36 133 133 GLY GLY A . n A 1 37 LEU 37 134 134 LEU LEU A . n A 1 38 PHE 38 135 135 PHE PHE A . n A 1 39 ALA 39 136 136 ALA ALA A . n A 1 40 ASP 40 137 137 ASP ASP A . n A 1 41 THR 41 138 138 THR THR A . n A 1 42 GLU 42 139 139 GLU GLU A . n A 1 43 GLY 43 140 140 GLY GLY A . n A 1 44 LEU 44 141 141 LEU LEU A . n A 1 45 ALA 45 142 142 ALA ALA A . n A 1 46 ALA 46 143 143 ALA ALA A . n A 1 47 LYS 47 144 144 LYS LYS A . n A 1 48 LEU 48 145 145 LEU LEU A . n A 1 49 LEU 49 146 146 LEU LEU A . n A 1 50 ALA 50 147 147 ALA ALA A . n A 1 51 GLY 51 148 148 GLY GLY A . n A 1 52 GLN 52 149 149 GLN GLN A . n A 1 53 GLY 53 150 150 GLY GLY A . n A 1 54 VAL 54 151 151 VAL VAL A . n A 1 55 ASP 55 152 152 ASP ASP A . n A 1 56 ALA 56 153 153 ALA ALA A . n A 1 57 ASP 57 154 154 ASP ASP A . n A 1 58 ALA 58 155 155 ALA ALA A . n A 1 59 VAL 59 156 156 VAL VAL A . n A 1 60 ARG 60 157 157 ARG ARG A . n A 1 61 ALA 61 158 158 ALA ALA A . n A 1 62 ALA 62 159 159 ALA ALA A . n A 1 63 VAL 63 160 160 VAL VAL A . n A 1 64 THR 64 161 161 THR THR A . n A 1 65 LEU 65 162 162 LEU LEU A . n A 1 66 PRO 66 163 163 PRO PRO A . n A 1 67 PRO 67 164 164 PRO PRO A . n A 1 68 SER 68 165 165 SER SER A . n A 1 69 THR 69 166 166 THR THR A . n A 1 70 GLY 70 167 167 GLY GLY A . n A 1 71 GLU 71 168 ? ? ? A . n A 1 72 ALA 72 169 ? ? ? A . n A 1 73 ALA 73 170 170 ALA ALA A . n A 1 74 ALA 74 171 171 ALA ALA A . n A 1 75 LEU 75 172 172 LEU LEU A . n A 1 76 ILE 76 173 173 ILE ILE A . n A 1 77 PRO 77 174 174 PRO PRO A . n A 1 78 PHE 78 175 175 PHE PHE A . n A 1 79 ASP 79 176 176 ASP ASP A . n A 1 80 THR 80 177 177 THR THR A . n A 1 81 ALA 81 178 178 ALA ALA A . n A 1 82 ALA 82 179 179 ALA ALA A . n A 1 83 LYS 83 180 180 LYS LYS A . n A 1 84 LYS 84 181 181 LYS LYS A . n A 1 85 ALA 85 182 182 ALA ALA A . n A 1 86 LEU 86 183 183 LEU LEU A . n A 1 87 GLU 87 184 184 GLU GLU A . n A 1 88 LEU 88 185 185 LEU LEU A . n A 1 89 THR 89 186 186 THR THR A . n A 1 90 PHE 90 187 187 PHE PHE A . n A 1 91 ARG 91 188 188 ARG ARG A . n A 1 92 GLN 92 189 189 GLN GLN A . n A 1 93 ALA 93 190 190 ALA ALA A . n A 1 94 LEU 94 191 191 LEU LEU A . n A 1 95 ARG 95 192 192 ARG ARG A . n A 1 96 LEU 96 193 193 LEU LEU A . n A 1 97 GLY 97 194 194 GLY GLY A . n A 1 98 HIS 98 195 195 HIS HIS A . n A 1 99 ASN 99 196 196 ASN ASN A . n A 1 100 TYR 100 197 197 TYR TYR A . n A 1 101 ILE 101 198 198 ILE ILE A . n A 1 102 GLY 102 199 199 GLY GLY A . n A 1 103 THR 103 200 200 THR THR A . n A 1 104 GLU 104 201 201 GLU GLU A . n A 1 105 HIS 105 202 202 HIS HIS A . n A 1 106 ILE 106 203 203 ILE ILE A . n A 1 107 LEU 107 204 204 LEU LEU A . n A 1 108 LEU 108 205 205 LEU LEU A . n A 1 109 ALA 109 206 206 ALA ALA A . n A 1 110 LEU 110 207 207 LEU LEU A . n A 1 111 VAL 111 208 208 VAL VAL A . n A 1 112 ASP 112 209 209 ASP ASP A . n A 1 113 ALA 113 210 210 ALA ALA A . n A 1 114 GLU 114 211 211 GLU GLU A . n A 1 115 ASP 115 212 212 ASP ASP A . n A 1 116 GLY 116 213 213 GLY GLY A . n A 1 117 ASP 117 214 214 ASP ASP A . n A 1 118 GLY 118 215 215 GLY GLY A . n A 1 119 PRO 119 216 216 PRO PRO A . n A 1 120 LEU 120 217 217 LEU LEU A . n A 1 121 HIS 121 218 218 HIS HIS A . n A 1 122 ARG 122 219 219 ARG ARG A . n A 1 123 LEU 123 220 220 LEU LEU A . n A 1 124 GLY 124 221 221 GLY GLY A . n A 1 125 VAL 125 222 222 VAL VAL A . n A 1 126 ASP 126 223 223 ASP ASP A . n A 1 127 ALA 127 224 224 ALA ALA A . n A 1 128 GLU 128 225 225 GLU GLU A . n A 1 129 ARG 129 226 226 ARG ARG A . n A 1 130 PHE 130 227 227 PHE PHE A . n A 1 131 GLU 131 228 228 GLU GLU A . n A 1 132 ALA 132 229 229 ALA ALA A . n A 1 133 ASP 133 230 230 ASP ASP A . n A 1 134 LEU 134 231 231 LEU LEU A . n A 1 135 ARG 135 232 232 ARG ARG A . n A 1 136 THR 136 233 233 THR THR A . n A 1 137 ALA 137 234 234 ALA ALA A . n A 1 138 LEU 138 235 235 LEU LEU A . n A 1 139 GLU 139 236 236 GLU GLU A . n A 1 140 PRO 140 237 237 PRO PRO A . n A 1 141 PHE 141 238 238 PHE PHE A . n A 1 142 MET 142 239 239 MET MET A . n A 1 143 THR 143 240 240 THR THR A . n A 1 144 LYS 144 241 ? ? ? A . n A 1 145 PRO 145 242 ? ? ? A . n A 1 146 ALA 146 243 ? ? ? A . n A 1 147 GLU 147 244 ? ? ? A . n A 1 148 LEU 148 245 ? ? ? A . n A 1 149 GLU 149 246 ? ? ? A . n A 1 150 HIS 150 247 247 HIS HIS A . n A 1 151 HIS 151 248 248 HIS HIS A . n A 1 152 HIS 152 249 249 HIS HIS A . n A 1 153 HIS 153 250 ? ? ? A . n A 1 154 HIS 154 251 ? ? ? A . n A 1 155 HIS 155 252 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 RPI 1 301 307 RPI PAR A . C 3 HOH 1 401 4 HOH HOH A . C 3 HOH 2 402 6 HOH HOH A . C 3 HOH 3 403 1 HOH HOH A . C 3 HOH 4 404 2 HOH HOH A . C 3 HOH 5 405 3 HOH HOH A . C 3 HOH 6 406 5 HOH HOH A . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id RPI _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 301 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id OXT _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id B _pdbx_unobs_or_zero_occ_atoms.label_comp_id RPI _pdbx_unobs_or_zero_occ_atoms.label_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.label_atom_id OXT # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20_4459: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 91.75 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8B9O _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.080 _cell.length_a_esd ? _cell.length_b 40.630 _cell.length_b_esd ? _cell.length_c 64.430 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8B9O _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8B9O _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '12.5% (w/v) PEG 1000, 12.5% (w/v) PEG 3350, 12.5% (v/v) MPD, 0.02 M of each amino acid and 0.1 M MES/imidazole pH 6.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-12-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0332 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0332 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8B9O _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 99.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8941 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.55 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.06 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 610 _reflns_shell.percent_possible_all 89.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.981 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.669 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8B9O _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 32.20 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8936 _refine.ls_number_reflns_R_free 446 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.83 _refine.ls_percent_reflns_R_free 4.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2064 _refine.ls_R_factor_R_free 0.2266 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2053 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3WDB _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.85 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.23 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1087 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 1108 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 32.20 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? ? ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.611 ? ? ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 6.702 ? 157 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.041 ? 178 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 199 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.00 2.29 . . 144 2757 97.00 . . . 0.3284 . 0.2834 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.29 2.89 . . 150 2847 100.00 . . . 0.3179 . 0.2695 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.89 32.20 . . 152 2886 99.00 . . . 0.1970 . 0.1814 . . . . . . . . . . . # _struct.entry_id 8B9O _struct.title 'Structure of the C-terminal domain of ClpC2 from Mycobacterium smegmatis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8B9O _struct_keywords.text 'stress resistance protein, CYTOSOLIC PROTEIN' _struct_keywords.pdbx_keywords 'CYTOSOLIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0QW35_MYCS2 _struct_ref.pdbx_db_accession A0QW35 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;FGRFTPRARNVIVVAHNLAHDARNAEITPDHLLLGLFADTEGLAAKLLAGQGVDADAVRAAVTLPPSTGEAAALIPFDTA AKKALELTFRQALRLGHNYIGTEHILLALVDAEDGDGPLHRLGVDAERFEADLRTALEPFMT ; _struct_ref.pdbx_align_begin 99 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8B9O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 143 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0QW35 _struct_ref_seq.db_align_beg 99 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 240 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 99 _struct_ref_seq.pdbx_auth_seq_align_end 240 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8B9O MET A 1 ? UNP A0QW35 ? ? 'initiating methionine' 98 1 1 8B9O LYS A 144 ? UNP A0QW35 ? ? 'expression tag' 241 2 1 8B9O PRO A 145 ? UNP A0QW35 ? ? 'expression tag' 242 3 1 8B9O ALA A 146 ? UNP A0QW35 ? ? 'expression tag' 243 4 1 8B9O GLU A 147 ? UNP A0QW35 ? ? 'expression tag' 244 5 1 8B9O LEU A 148 ? UNP A0QW35 ? ? 'expression tag' 245 6 1 8B9O GLU A 149 ? UNP A0QW35 ? ? 'expression tag' 246 7 1 8B9O HIS A 150 ? UNP A0QW35 ? ? 'expression tag' 247 8 1 8B9O HIS A 151 ? UNP A0QW35 ? ? 'expression tag' 248 9 1 8B9O HIS A 152 ? UNP A0QW35 ? ? 'expression tag' 249 10 1 8B9O HIS A 153 ? UNP A0QW35 ? ? 'expression tag' 250 11 1 8B9O HIS A 154 ? UNP A0QW35 ? ? 'expression tag' 251 12 1 8B9O HIS A 155 ? UNP A0QW35 ? ? 'expression tag' 252 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8330 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 6 ? ARG A 24 ? THR A 103 ARG A 121 1 ? 19 HELX_P HELX_P2 AA2 THR A 29 ? PHE A 38 ? THR A 126 PHE A 135 1 ? 10 HELX_P HELX_P3 AA3 GLY A 43 ? GLN A 52 ? GLY A 140 GLN A 149 1 ? 10 HELX_P HELX_P4 AA4 ASP A 55 ? ALA A 62 ? ASP A 152 ALA A 159 1 ? 8 HELX_P HELX_P5 AA5 ASP A 79 ? GLY A 97 ? ASP A 176 GLY A 194 1 ? 19 HELX_P HELX_P6 AA6 GLY A 102 ? ALA A 113 ? GLY A 199 ALA A 210 1 ? 12 HELX_P HELX_P7 AA7 GLY A 118 ? LEU A 123 ? GLY A 215 LEU A 220 1 ? 6 HELX_P HELX_P8 AA8 ASP A 126 ? GLU A 139 ? ASP A 223 GLU A 236 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 171 ? ? 61.57 -59.89 2 1 ASP A 214 ? ? -104.61 40.79 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -8.7560 -12.9748 13.2939 0.4229 ? -0.0860 ? -0.0420 ? 0.4742 ? -0.0541 ? 0.5421 ? 1.8434 ? 1.5085 ? -1.3518 ? 5.2986 ? -1.7620 ? 6.5415 ? -0.2236 ? 0.5569 ? -0.4289 ? -0.4090 ? 0.7330 ? 0.5738 ? 0.3939 ? -1.0801 ? -0.4545 ? 2 'X-RAY DIFFRACTION' ? refined 1.2059 -17.4257 18.1106 0.5343 ? 0.0870 ? -0.0149 ? 0.4490 ? -0.1428 ? 0.5048 ? 5.7111 ? 1.5744 ? 3.6245 ? 6.8208 ? -0.9296 ? 7.4124 ? 0.0951 ? 0.5907 ? -0.6113 ? -0.2390 ? -0.0174 ? -0.7628 ? 1.3586 ? 0.0835 ? 0.0006 ? 3 'X-RAY DIFFRACTION' ? refined -0.5822 0.0050 14.1542 0.3262 ? 0.0402 ? 0.0451 ? 0.3324 ? -0.1007 ? 0.3106 ? 4.1640 ? -0.2818 ? 0.6876 ? 8.2091 ? -1.1000 ? 9.9429 ? 0.2950 ? 0.5244 ? -0.0061 ? -0.1717 ? 0.0004 ? -0.1957 ? -0.5670 ? 0.0181 ? -0.2332 ? 4 'X-RAY DIFFRACTION' ? refined 6.4130 -4.5145 15.4362 0.4242 ? 0.0129 ? -0.0567 ? 0.4329 ? -0.1022 ? 0.4254 ? 3.8266 ? 1.1795 ? -1.0963 ? 3.4537 ? -1.5143 ? 3.2910 ? -0.1069 ? 0.1450 ? -0.2850 ? 0.3259 ? -0.2468 ? -0.7735 ? -0.4231 ? 0.5100 ? 0.3185 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 177 through 199 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 200 through 240 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 99 through 135 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 136 through 176 ) ; # _pdbx_entry_details.entry_id 8B9O _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 98 ? A MET 1 2 1 Y 1 A GLU 168 ? A GLU 71 3 1 Y 1 A ALA 169 ? A ALA 72 4 1 Y 1 A LYS 241 ? A LYS 144 5 1 Y 1 A PRO 242 ? A PRO 145 6 1 Y 1 A ALA 243 ? A ALA 146 7 1 Y 1 A GLU 244 ? A GLU 147 8 1 Y 1 A LEU 245 ? A LEU 148 9 1 Y 1 A GLU 246 ? A GLU 149 10 1 Y 1 A HIS 250 ? A HIS 153 11 1 Y 1 A HIS 251 ? A HIS 154 12 1 Y 1 A HIS 252 ? A HIS 155 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 RPI P P N N 276 RPI N N N N 277 RPI CA C N S 278 RPI CB C N N 279 RPI CG C N N 280 RPI CD C N N 281 RPI NE N N N 282 RPI CZ C N N 283 RPI NH1 N N N 284 RPI NH2 N N N 285 RPI O1P O N N 286 RPI O2P O N N 287 RPI O3P O N N 288 RPI C C N N 289 RPI O O N N 290 RPI OXT O N N 291 RPI H H N N 292 RPI H2 H N N 293 RPI HA H N N 294 RPI H5 H N N 295 RPI H6 H N N 296 RPI H7 H N N 297 RPI H8 H N N 298 RPI H9 H N N 299 RPI H10 H N N 300 RPI H11 H N N 301 RPI H12 H N N 302 RPI H14 H N N 303 RPI H15 H N N 304 RPI H16 H N N 305 RPI HXT H N N 306 SER N N N N 307 SER CA C N S 308 SER C C N N 309 SER O O N N 310 SER CB C N N 311 SER OG O N N 312 SER OXT O N N 313 SER H H N N 314 SER H2 H N N 315 SER HA H N N 316 SER HB2 H N N 317 SER HB3 H N N 318 SER HG H N N 319 SER HXT H N N 320 THR N N N N 321 THR CA C N S 322 THR C C N N 323 THR O O N N 324 THR CB C N R 325 THR OG1 O N N 326 THR CG2 C N N 327 THR OXT O N N 328 THR H H N N 329 THR H2 H N N 330 THR HA H N N 331 THR HB H N N 332 THR HG1 H N N 333 THR HG21 H N N 334 THR HG22 H N N 335 THR HG23 H N N 336 THR HXT H N N 337 TYR N N N N 338 TYR CA C N S 339 TYR C C N N 340 TYR O O N N 341 TYR CB C N N 342 TYR CG C Y N 343 TYR CD1 C Y N 344 TYR CD2 C Y N 345 TYR CE1 C Y N 346 TYR CE2 C Y N 347 TYR CZ C Y N 348 TYR OH O N N 349 TYR OXT O N N 350 TYR H H N N 351 TYR H2 H N N 352 TYR HA H N N 353 TYR HB2 H N N 354 TYR HB3 H N N 355 TYR HD1 H N N 356 TYR HD2 H N N 357 TYR HE1 H N N 358 TYR HE2 H N N 359 TYR HH H N N 360 TYR HXT H N N 361 VAL N N N N 362 VAL CA C N S 363 VAL C C N N 364 VAL O O N N 365 VAL CB C N N 366 VAL CG1 C N N 367 VAL CG2 C N N 368 VAL OXT O N N 369 VAL H H N N 370 VAL H2 H N N 371 VAL HA H N N 372 VAL HB H N N 373 VAL HG11 H N N 374 VAL HG12 H N N 375 VAL HG13 H N N 376 VAL HG21 H N N 377 VAL HG22 H N N 378 VAL HG23 H N N 379 VAL HXT H N N 380 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 RPI O2P P doub N N 264 RPI NH2 P sing N N 265 RPI NH2 CZ sing N N 266 RPI O1P P sing N N 267 RPI NH1 CZ doub N N 268 RPI P O3P sing N N 269 RPI CZ NE sing N N 270 RPI NE CD sing N N 271 RPI CD CG sing N N 272 RPI CG CB sing N N 273 RPI CB CA sing N N 274 RPI CA C sing N N 275 RPI CA N sing N N 276 RPI O C doub N N 277 RPI C OXT sing N N 278 RPI N H sing N N 279 RPI N H2 sing N N 280 RPI CA HA sing N N 281 RPI CB H5 sing N N 282 RPI CB H6 sing N N 283 RPI CG H7 sing N N 284 RPI CG H8 sing N N 285 RPI CD H9 sing N N 286 RPI CD H10 sing N N 287 RPI NE H11 sing N N 288 RPI NH1 H12 sing N N 289 RPI NH2 H14 sing N N 290 RPI O1P H15 sing N N 291 RPI O3P H16 sing N N 292 RPI OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TYR N CA sing N N 323 TYR N H sing N N 324 TYR N H2 sing N N 325 TYR CA C sing N N 326 TYR CA CB sing N N 327 TYR CA HA sing N N 328 TYR C O doub N N 329 TYR C OXT sing N N 330 TYR CB CG sing N N 331 TYR CB HB2 sing N N 332 TYR CB HB3 sing N N 333 TYR CG CD1 doub Y N 334 TYR CG CD2 sing Y N 335 TYR CD1 CE1 sing Y N 336 TYR CD1 HD1 sing N N 337 TYR CD2 CE2 doub Y N 338 TYR CD2 HD2 sing N N 339 TYR CE1 CZ doub Y N 340 TYR CE1 HE1 sing N N 341 TYR CE2 CZ sing Y N 342 TYR CE2 HE2 sing N N 343 TYR CZ OH sing N N 344 TYR OH HH sing N N 345 TYR OXT HXT sing N N 346 VAL N CA sing N N 347 VAL N H sing N N 348 VAL N H2 sing N N 349 VAL CA C sing N N 350 VAL CA CB sing N N 351 VAL CA HA sing N N 352 VAL C O doub N N 353 VAL C OXT sing N N 354 VAL CB CG1 sing N N 355 VAL CB CG2 sing N N 356 VAL CB HB sing N N 357 VAL CG1 HG11 sing N N 358 VAL CG1 HG12 sing N N 359 VAL CG1 HG13 sing N N 360 VAL CG2 HG21 sing N N 361 VAL CG2 HG22 sing N N 362 VAL CG2 HG23 sing N N 363 VAL OXT HXT sing N N 364 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Research Council (ERC)' 'European Union' 'AdG 694978' 1 'Vienna Science and Technology Fund (WWTF)' Austria LS17029 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3WDB _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8B9O _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019577 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000598 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024612 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015528 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_