data_8B9T # _entry.id 8B9T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8B9T pdb_00008b9t 10.2210/pdb8b9t/pdb WWPDB D_1292125953 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8B9T _pdbx_database_status.recvd_initial_deposition_date 2022-10-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Stewart, B.Z.' 1 0000-0001-8286-0087 'Kvansakul, M.' 2 0000-0003-2639-2498 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stewart, B.Z.' 1 0000-0001-8286-0087 primary 'Caria, S.' 2 0000-0001-7289-2093 primary 'Humbert, P.O.' 3 0000-0002-1366-6691 primary 'Kvansakul, M.' 4 0000-0003-2639-2498 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8B9T _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.611 _cell.length_a_esd ? _cell.length_b 70.611 _cell.length_b_esd ? _cell.length_c 140.782 _cell.length_c_esd ? _cell.volume 607886.483 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8B9T _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall 'P 61 2 (x,y,z+5/12)' _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein scribble homolog' 10082.529 1 ? ? ? 'At the n-terminal of chain B, the sequence GPLGS is part of the expression tag' 2 polymer syn 'Protein E6' 1236.360 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305 4 ? ? ? ? 5 non-polymer syn 'ISOPROPYL ALCOHOL' 60.095 1 ? ? ? ? 6 water nat water 18.015 26 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Scribble,hScrib,Protein LAP4' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GPLGSVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVS ALLRPCLELSLLVRRD ; ;GPLGSVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVS ALLRPCLELSLLVRRD ; A ? 2 'polypeptide(L)' no no SSRTRRETQL SSRTRRETQL B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 VAL n 1 7 GLU n 1 8 GLU n 1 9 ILE n 1 10 ARG n 1 11 LEU n 1 12 PRO n 1 13 ARG n 1 14 ALA n 1 15 GLY n 1 16 GLY n 1 17 PRO n 1 18 LEU n 1 19 GLY n 1 20 LEU n 1 21 SER n 1 22 ILE n 1 23 VAL n 1 24 GLY n 1 25 GLY n 1 26 SER n 1 27 ASP n 1 28 HIS n 1 29 SER n 1 30 SER n 1 31 HIS n 1 32 PRO n 1 33 PHE n 1 34 GLY n 1 35 VAL n 1 36 GLN n 1 37 GLU n 1 38 PRO n 1 39 GLY n 1 40 VAL n 1 41 PHE n 1 42 ILE n 1 43 SER n 1 44 LYS n 1 45 VAL n 1 46 LEU n 1 47 PRO n 1 48 ARG n 1 49 GLY n 1 50 LEU n 1 51 ALA n 1 52 ALA n 1 53 ARG n 1 54 SER n 1 55 GLY n 1 56 LEU n 1 57 ARG n 1 58 VAL n 1 59 GLY n 1 60 ASP n 1 61 ARG n 1 62 ILE n 1 63 LEU n 1 64 ALA n 1 65 VAL n 1 66 ASN n 1 67 GLY n 1 68 GLN n 1 69 ASP n 1 70 VAL n 1 71 ARG n 1 72 ASP n 1 73 ALA n 1 74 THR n 1 75 HIS n 1 76 GLN n 1 77 GLU n 1 78 ALA n 1 79 VAL n 1 80 SER n 1 81 ALA n 1 82 LEU n 1 83 LEU n 1 84 ARG n 1 85 PRO n 1 86 CYS n 1 87 LEU n 1 88 GLU n 1 89 LEU n 1 90 SER n 1 91 LEU n 1 92 LEU n 1 93 VAL n 1 94 ARG n 1 95 ARG n 1 96 ASP n 2 1 SER n 2 2 SER n 2 3 ARG n 2 4 THR n 2 5 ARG n 2 6 ARG n 2 7 GLU n 2 8 THR n 2 9 GLN n 2 10 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 96 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SCRIB, CRIB1, KIAA0147, LAP4, SCRB1, VARTUL' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Codon+ _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 10 _pdbx_entity_src_syn.organism_scientific 'Human papillomavirus type 16' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 333760 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SCRIB_HUMAN Q14160 ? 1 ;VEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVSALLRP CLELSLLVRRD ; 1002 2 UNP A0A384KQK8_HPV16 A0A384KQK8 ? 2 SSRTRRETQL 149 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8B9T A 6 ? 96 ? Q14160 1002 ? 1092 ? 1002 1092 2 2 8B9T B 1 ? 10 ? A0A384KQK8 149 ? 158 ? 149 158 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8B9T GLY A 1 ? UNP Q14160 ? ? 'expression tag' 997 1 1 8B9T PRO A 2 ? UNP Q14160 ? ? 'expression tag' 998 2 1 8B9T LEU A 3 ? UNP Q14160 ? ? 'expression tag' 999 3 1 8B9T GLY A 4 ? UNP Q14160 ? ? 'expression tag' 1000 4 1 8B9T SER A 5 ? UNP Q14160 ? ? 'expression tag' 1001 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EPE non-polymer . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES 'C8 H18 N2 O4 S' 238.305 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPA non-polymer . 'ISOPROPYL ALCOHOL' 2-PROPANOL 'C3 H8 O' 60.095 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8B9T _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 76.19 _exptl_crystal.description 'hexagonal dipyramid' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.5 M NaCl, 0.1 m Na HEPES pH 8.0' _exptl_crystal_grow.pdbx_pH_range 7.0-8.0 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-08-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95372 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95372 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate 65.73 _reflns.entry_id 8B9T _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 37.23 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7707 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.44 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.2 _reflns.pdbx_Rmerge_I_obs 0.1008 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.29 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.589 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.61 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 732 _reflns_shell.percent_possible_all 97.98 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.363 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.939 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 72.32 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8B9T _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 37.23 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7673 _refine.ls_number_reflns_R_free 373 _refine.ls_number_reflns_R_work 7300 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.48 _refine.ls_percent_reflns_R_free 4.86 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2747 _refine.ls_R_factor_R_free 0.2812 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2743 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6XA6 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.2697 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3352 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 37.23 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 828 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 737 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 65 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0151 ? 806 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.6119 ? 1083 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0593 ? 117 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0173 ? 134 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 23.7104 ? 330 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.50 2.86 . . 118 2336 99.07 . . . 0.3620 . 0.3366 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.86 3.60 . . 114 2408 99.64 . . . 0.3478 . 0.3116 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.61 37.23 . . 141 2556 99.70 . . . 0.2503 . 0.2522 . . . . . . . . . . . # _struct.entry_id 8B9T _struct.title 'Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8B9T _struct_keywords.text 'Scribble, human papillomavirus, E6, PDZ domain, cell polarity, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 5 ? I N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 49 ? GLY A 55 ? GLY A 1045 GLY A 1051 1 ? 7 HELX_P HELX_P2 AA2 THR A 74 ? ARG A 84 ? THR A 1070 ARG A 1080 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? C NA . NA ? ? ? 1_555 F EPE . O3S ? ? A NA 1101 A EPE 1104 1_555 ? ? ? ? ? ? ? 2.285 ? ? metalc2 metalc ? ? C NA . NA ? ? ? 1_555 G EPE . O2S ? ? A NA 1101 A EPE 1105 1_555 ? ? ? ? ? ? ? 2.543 ? ? metalc3 metalc ? ? C NA . NA ? ? ? 1_555 I HOH . O ? ? A NA 1101 A HOH 1201 1_555 ? ? ? ? ? ? ? 3.178 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 5 ? PRO A 12 ? SER A 1001 PRO A 1008 AA1 2 GLU A 88 ? ARG A 95 ? GLU A 1084 ARG A 1091 AA1 3 ARG A 61 ? VAL A 65 ? ARG A 1057 VAL A 1061 AA1 4 GLN A 68 ? ASP A 69 ? GLN A 1064 ASP A 1065 AA2 1 SER A 5 ? PRO A 12 ? SER A 1001 PRO A 1008 AA2 2 GLU A 88 ? ARG A 95 ? GLU A 1084 ARG A 1091 AA2 3 ARG A 61 ? VAL A 65 ? ARG A 1057 VAL A 1061 AA2 4 VAL A 40 ? VAL A 45 ? VAL A 1036 VAL A 1041 AA2 5 LEU A 20 ? GLY A 24 ? LEU A 1016 GLY A 1020 AA2 6 THR B 8 ? LEU B 10 ? THR B 156 LEU B 158 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 11 ? N LEU A 1007 O LEU A 89 ? O LEU A 1085 AA1 2 3 O ARG A 94 ? O ARG A 1090 N ARG A 61 ? N ARG A 1057 AA1 3 4 N VAL A 65 ? N VAL A 1061 O GLN A 68 ? O GLN A 1064 AA2 1 2 N LEU A 11 ? N LEU A 1007 O LEU A 89 ? O LEU A 1085 AA2 2 3 O ARG A 94 ? O ARG A 1090 N ARG A 61 ? N ARG A 1057 AA2 3 4 O ILE A 62 ? O ILE A 1058 N VAL A 40 ? N VAL A 1036 AA2 4 5 O PHE A 41 ? O PHE A 1037 N VAL A 23 ? N VAL A 1019 AA2 5 6 N LEU A 20 ? N LEU A 1016 O LEU B 10 ? O LEU B 158 # _atom_sites.entry_id 8B9T _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014162 _atom_sites.fract_transf_matrix[1][2] 0.008176 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016353 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007103 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? NA ? ? 9.38062 1.54875 ? ? 3.38349 72.32734 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 997 ? ? ? A . n A 1 2 PRO 2 998 ? ? ? A . n A 1 3 LEU 3 999 ? ? ? A . n A 1 4 GLY 4 1000 1000 GLY GLY A . n A 1 5 SER 5 1001 1001 SER SER A . n A 1 6 VAL 6 1002 1002 VAL VAL A . n A 1 7 GLU 7 1003 1003 GLU GLU A . n A 1 8 GLU 8 1004 1004 GLU GLU A . n A 1 9 ILE 9 1005 1005 ILE ILE A . n A 1 10 ARG 10 1006 1006 ARG ARG A . n A 1 11 LEU 11 1007 1007 LEU LEU A . n A 1 12 PRO 12 1008 1008 PRO PRO A . n A 1 13 ARG 13 1009 1009 ARG ARG A . n A 1 14 ALA 14 1010 ? ? ? A . n A 1 15 GLY 15 1011 1011 GLY GLY A . n A 1 16 GLY 16 1012 1012 GLY GLY A . n A 1 17 PRO 17 1013 1013 PRO PRO A . n A 1 18 LEU 18 1014 1014 LEU LEU A . n A 1 19 GLY 19 1015 1015 GLY GLY A . n A 1 20 LEU 20 1016 1016 LEU LEU A . n A 1 21 SER 21 1017 1017 SER SER A . n A 1 22 ILE 22 1018 1018 ILE ILE A . n A 1 23 VAL 23 1019 1019 VAL VAL A . n A 1 24 GLY 24 1020 1020 GLY GLY A . n A 1 25 GLY 25 1021 1021 GLY GLY A . n A 1 26 SER 26 1022 1022 SER SER A . n A 1 27 ASP 27 1023 1023 ASP ASP A . n A 1 28 HIS 28 1024 1024 HIS HIS A . n A 1 29 SER 29 1025 1025 SER SER A . n A 1 30 SER 30 1026 1026 SER SER A . n A 1 31 HIS 31 1027 1027 HIS HIS A . n A 1 32 PRO 32 1028 1028 PRO PRO A . n A 1 33 PHE 33 1029 1029 PHE PHE A . n A 1 34 GLY 34 1030 ? ? ? A . n A 1 35 VAL 35 1031 ? ? ? A . n A 1 36 GLN 36 1032 1032 GLN GLN A . n A 1 37 GLU 37 1033 1033 GLU GLU A . n A 1 38 PRO 38 1034 1034 PRO PRO A . n A 1 39 GLY 39 1035 1035 GLY GLY A . n A 1 40 VAL 40 1036 1036 VAL VAL A . n A 1 41 PHE 41 1037 1037 PHE PHE A . n A 1 42 ILE 42 1038 1038 ILE ILE A . n A 1 43 SER 43 1039 1039 SER SER A . n A 1 44 LYS 44 1040 1040 LYS LYS A . n A 1 45 VAL 45 1041 1041 VAL VAL A . n A 1 46 LEU 46 1042 1042 LEU LEU A . n A 1 47 PRO 47 1043 1043 PRO PRO A . n A 1 48 ARG 48 1044 1044 ARG ARG A . n A 1 49 GLY 49 1045 1045 GLY GLY A . n A 1 50 LEU 50 1046 1046 LEU LEU A . n A 1 51 ALA 51 1047 1047 ALA ALA A . n A 1 52 ALA 52 1048 1048 ALA ALA A . n A 1 53 ARG 53 1049 1049 ARG ARG A . n A 1 54 SER 54 1050 1050 SER SER A . n A 1 55 GLY 55 1051 1051 GLY GLY A . n A 1 56 LEU 56 1052 1052 LEU LEU A . n A 1 57 ARG 57 1053 1053 ARG ARG A . n A 1 58 VAL 58 1054 1054 VAL VAL A . n A 1 59 GLY 59 1055 1055 GLY GLY A . n A 1 60 ASP 60 1056 1056 ASP ASP A . n A 1 61 ARG 61 1057 1057 ARG ARG A . n A 1 62 ILE 62 1058 1058 ILE ILE A . n A 1 63 LEU 63 1059 1059 LEU LEU A . n A 1 64 ALA 64 1060 1060 ALA ALA A . n A 1 65 VAL 65 1061 1061 VAL VAL A . n A 1 66 ASN 66 1062 1062 ASN ASN A . n A 1 67 GLY 67 1063 1063 GLY GLY A . n A 1 68 GLN 68 1064 1064 GLN GLN A . n A 1 69 ASP 69 1065 1065 ASP ASP A . n A 1 70 VAL 70 1066 1066 VAL VAL A . n A 1 71 ARG 71 1067 1067 ARG ARG A . n A 1 72 ASP 72 1068 1068 ASP ASP A . n A 1 73 ALA 73 1069 1069 ALA ALA A . n A 1 74 THR 74 1070 1070 THR THR A . n A 1 75 HIS 75 1071 1071 HIS HIS A . n A 1 76 GLN 76 1072 1072 GLN GLN A . n A 1 77 GLU 77 1073 1073 GLU GLU A . n A 1 78 ALA 78 1074 1074 ALA ALA A . n A 1 79 VAL 79 1075 1075 VAL VAL A . n A 1 80 SER 80 1076 1076 SER SER A . n A 1 81 ALA 81 1077 1077 ALA ALA A . n A 1 82 LEU 82 1078 1078 LEU LEU A . n A 1 83 LEU 83 1079 1079 LEU LEU A . n A 1 84 ARG 84 1080 1080 ARG ARG A . n A 1 85 PRO 85 1081 1081 PRO PRO A . n A 1 86 CYS 86 1082 1082 CYS CYS A . n A 1 87 LEU 87 1083 1083 LEU LEU A . n A 1 88 GLU 88 1084 1084 GLU GLU A . n A 1 89 LEU 89 1085 1085 LEU LEU A . n A 1 90 SER 90 1086 1086 SER SER A . n A 1 91 LEU 91 1087 1087 LEU LEU A . n A 1 92 LEU 92 1088 1088 LEU LEU A . n A 1 93 VAL 93 1089 1089 VAL VAL A . n A 1 94 ARG 94 1090 1090 ARG ARG A . n A 1 95 ARG 95 1091 1091 ARG ARG A . n A 1 96 ASP 96 1092 1092 ASP ASP A . n B 2 1 SER 1 149 ? ? ? B . n B 2 2 SER 2 150 ? ? ? B . n B 2 3 ARG 3 151 151 ARG ARG B . n B 2 4 THR 4 152 152 THR THR B . n B 2 5 ARG 5 153 153 ARG ARG B . n B 2 6 ARG 6 154 154 ARG ARG B . n B 2 7 GLU 7 155 155 GLU GLU B . n B 2 8 THR 8 156 156 THR THR B . n B 2 9 GLN 9 157 157 GLN GLN B . n B 2 10 LEU 10 158 158 LEU LEU B . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email m.kvansakul@latrobe.edu.au _pdbx_contact_author.name_first Marc _pdbx_contact_author.name_last Kvansakul _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2639-2498 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 NA 1 1101 1 NA NA A . D 4 EPE 1 1102 2 EPE EPE A . E 4 EPE 1 1103 3 EPE EPE A . F 4 EPE 1 1104 4 EPE EPE A . G 4 EPE 1 1105 5 EPE EPE A . H 5 IPA 1 1106 6 IPA IPA A . I 6 HOH 1 1201 15 HOH HOH A . I 6 HOH 2 1202 7 HOH HOH A . I 6 HOH 3 1203 26 HOH HOH A . I 6 HOH 4 1204 17 HOH HOH A . I 6 HOH 5 1205 13 HOH HOH A . I 6 HOH 6 1206 16 HOH HOH A . I 6 HOH 7 1207 2 HOH HOH A . I 6 HOH 8 1208 1 HOH HOH A . I 6 HOH 9 1209 23 HOH HOH A . I 6 HOH 10 1210 20 HOH HOH A . I 6 HOH 11 1211 21 HOH HOH A . I 6 HOH 12 1212 4 HOH HOH A . I 6 HOH 13 1213 3 HOH HOH A . I 6 HOH 14 1214 12 HOH HOH A . I 6 HOH 15 1215 25 HOH HOH A . I 6 HOH 16 1216 9 HOH HOH A . I 6 HOH 17 1217 22 HOH HOH A . I 6 HOH 18 1218 11 HOH HOH A . I 6 HOH 19 1219 10 HOH HOH A . I 6 HOH 20 1220 5 HOH HOH A . I 6 HOH 21 1221 8 HOH HOH A . I 6 HOH 22 1222 18 HOH HOH A . I 6 HOH 23 1223 14 HOH HOH A . I 6 HOH 24 1224 6 HOH HOH A . I 6 HOH 25 1225 24 HOH HOH A . I 6 HOH 26 1226 19 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2280 ? 1 MORE 2 ? 1 'SSA (A^2)' 6330 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O3S ? F EPE . ? A EPE 1104 ? 1_555 NA ? C NA . ? A NA 1101 ? 1_555 O2S ? G EPE . ? A EPE 1105 ? 1_555 129.5 ? 2 O3S ? F EPE . ? A EPE 1104 ? 1_555 NA ? C NA . ? A NA 1101 ? 1_555 O ? I HOH . ? A HOH 1201 ? 1_555 94.3 ? 3 O2S ? G EPE . ? A EPE 1105 ? 1_555 NA ? C NA . ? A NA 1101 ? 1_555 O ? I HOH . ? A HOH 1201 ? 1_555 86.9 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/6 3 y,-x+y,z+5/6 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 x-y,-y,-z 7 -x,-x+y,-z+2/3 8 -x,-y,z+1/2 9 y,x,-z+1/3 10 -y,-x,-z+5/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+1/6 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 29.4120609011 _pdbx_refine_tls.origin_y -11.862134485 _pdbx_refine_tls.origin_z 3.9200487087 _pdbx_refine_tls.T[1][1] 0.370633589743 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0230008489842 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0459339538896 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.243090872266 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.116739297913 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.396290370831 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 5.19851624918 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.0513628975848 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.385851115115 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 6.90302535132 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.410119329159 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 6.48648665375 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.159849086949 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.135769646057 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0022399187161 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.165721444994 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.00414854366821 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.145683902922 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.363039294302 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.035232096052 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.155078348403 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1000 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id I _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id D _pdbx_refine_tls_group.end_auth_seq_id 6 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 8B9T _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 1054 ? ? -37.51 134.79 2 1 ASN A 1062 ? ? 39.69 50.93 3 1 ARG B 154 ? ? -167.87 114.41 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 1225 ? 5.95 . 2 1 O ? A HOH 1226 ? 6.56 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 1027 ? CG ? A HIS 31 CG 2 1 Y 1 A HIS 1027 ? ND1 ? A HIS 31 ND1 3 1 Y 1 A HIS 1027 ? CD2 ? A HIS 31 CD2 4 1 Y 1 A HIS 1027 ? CE1 ? A HIS 31 CE1 5 1 Y 1 A HIS 1027 ? NE2 ? A HIS 31 NE2 6 1 Y 1 B ARG 153 ? CG ? B ARG 5 CG 7 1 Y 1 B ARG 153 ? CD ? B ARG 5 CD 8 1 Y 1 B ARG 153 ? NE ? B ARG 5 NE 9 1 Y 1 B ARG 153 ? CZ ? B ARG 5 CZ 10 1 Y 1 B ARG 153 ? NH1 ? B ARG 5 NH1 11 1 Y 1 B ARG 153 ? NH2 ? B ARG 5 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 997 ? A GLY 1 2 1 Y 1 A PRO 998 ? A PRO 2 3 1 Y 1 A LEU 999 ? A LEU 3 4 1 Y 1 A ALA 1010 ? A ALA 14 5 1 Y 1 A GLY 1030 ? A GLY 34 6 1 Y 1 A VAL 1031 ? A VAL 35 7 1 Y 1 B SER 149 ? B SER 1 8 1 Y 1 B SER 150 ? B SER 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EPE N1 N N N 88 EPE C2 C N N 89 EPE C3 C N N 90 EPE N4 N N N 91 EPE C5 C N N 92 EPE C6 C N N 93 EPE C7 C N N 94 EPE C8 C N N 95 EPE O8 O N N 96 EPE C9 C N N 97 EPE C10 C N N 98 EPE S S N N 99 EPE O1S O N N 100 EPE O2S O N N 101 EPE O3S O N N 102 EPE H21 H N N 103 EPE H22 H N N 104 EPE H31 H N N 105 EPE H32 H N N 106 EPE H51 H N N 107 EPE H52 H N N 108 EPE H61 H N N 109 EPE H62 H N N 110 EPE H71 H N N 111 EPE H72 H N N 112 EPE H81 H N N 113 EPE H82 H N N 114 EPE HO8 H N N 115 EPE H91 H N N 116 EPE H92 H N N 117 EPE H101 H N N 118 EPE H102 H N N 119 EPE HOS3 H N N 120 GLN N N N N 121 GLN CA C N S 122 GLN C C N N 123 GLN O O N N 124 GLN CB C N N 125 GLN CG C N N 126 GLN CD C N N 127 GLN OE1 O N N 128 GLN NE2 N N N 129 GLN OXT O N N 130 GLN H H N N 131 GLN H2 H N N 132 GLN HA H N N 133 GLN HB2 H N N 134 GLN HB3 H N N 135 GLN HG2 H N N 136 GLN HG3 H N N 137 GLN HE21 H N N 138 GLN HE22 H N N 139 GLN HXT H N N 140 GLU N N N N 141 GLU CA C N S 142 GLU C C N N 143 GLU O O N N 144 GLU CB C N N 145 GLU CG C N N 146 GLU CD C N N 147 GLU OE1 O N N 148 GLU OE2 O N N 149 GLU OXT O N N 150 GLU H H N N 151 GLU H2 H N N 152 GLU HA H N N 153 GLU HB2 H N N 154 GLU HB3 H N N 155 GLU HG2 H N N 156 GLU HG3 H N N 157 GLU HE2 H N N 158 GLU HXT H N N 159 GLY N N N N 160 GLY CA C N N 161 GLY C C N N 162 GLY O O N N 163 GLY OXT O N N 164 GLY H H N N 165 GLY H2 H N N 166 GLY HA2 H N N 167 GLY HA3 H N N 168 GLY HXT H N N 169 HIS N N N N 170 HIS CA C N S 171 HIS C C N N 172 HIS O O N N 173 HIS CB C N N 174 HIS CG C Y N 175 HIS ND1 N Y N 176 HIS CD2 C Y N 177 HIS CE1 C Y N 178 HIS NE2 N Y N 179 HIS OXT O N N 180 HIS H H N N 181 HIS H2 H N N 182 HIS HA H N N 183 HIS HB2 H N N 184 HIS HB3 H N N 185 HIS HD1 H N N 186 HIS HD2 H N N 187 HIS HE1 H N N 188 HIS HE2 H N N 189 HIS HXT H N N 190 HOH O O N N 191 HOH H1 H N N 192 HOH H2 H N N 193 ILE N N N N 194 ILE CA C N S 195 ILE C C N N 196 ILE O O N N 197 ILE CB C N S 198 ILE CG1 C N N 199 ILE CG2 C N N 200 ILE CD1 C N N 201 ILE OXT O N N 202 ILE H H N N 203 ILE H2 H N N 204 ILE HA H N N 205 ILE HB H N N 206 ILE HG12 H N N 207 ILE HG13 H N N 208 ILE HG21 H N N 209 ILE HG22 H N N 210 ILE HG23 H N N 211 ILE HD11 H N N 212 ILE HD12 H N N 213 ILE HD13 H N N 214 ILE HXT H N N 215 IPA C1 C N N 216 IPA C2 C N N 217 IPA C3 C N N 218 IPA O2 O N N 219 IPA H11 H N N 220 IPA H12 H N N 221 IPA H13 H N N 222 IPA H2 H N N 223 IPA H31 H N N 224 IPA H32 H N N 225 IPA H33 H N N 226 IPA HO2 H N N 227 LEU N N N N 228 LEU CA C N S 229 LEU C C N N 230 LEU O O N N 231 LEU CB C N N 232 LEU CG C N N 233 LEU CD1 C N N 234 LEU CD2 C N N 235 LEU OXT O N N 236 LEU H H N N 237 LEU H2 H N N 238 LEU HA H N N 239 LEU HB2 H N N 240 LEU HB3 H N N 241 LEU HG H N N 242 LEU HD11 H N N 243 LEU HD12 H N N 244 LEU HD13 H N N 245 LEU HD21 H N N 246 LEU HD22 H N N 247 LEU HD23 H N N 248 LEU HXT H N N 249 LYS N N N N 250 LYS CA C N S 251 LYS C C N N 252 LYS O O N N 253 LYS CB C N N 254 LYS CG C N N 255 LYS CD C N N 256 LYS CE C N N 257 LYS NZ N N N 258 LYS OXT O N N 259 LYS H H N N 260 LYS H2 H N N 261 LYS HA H N N 262 LYS HB2 H N N 263 LYS HB3 H N N 264 LYS HG2 H N N 265 LYS HG3 H N N 266 LYS HD2 H N N 267 LYS HD3 H N N 268 LYS HE2 H N N 269 LYS HE3 H N N 270 LYS HZ1 H N N 271 LYS HZ2 H N N 272 LYS HZ3 H N N 273 LYS HXT H N N 274 NA NA NA N N 275 PHE N N N N 276 PHE CA C N S 277 PHE C C N N 278 PHE O O N N 279 PHE CB C N N 280 PHE CG C Y N 281 PHE CD1 C Y N 282 PHE CD2 C Y N 283 PHE CE1 C Y N 284 PHE CE2 C Y N 285 PHE CZ C Y N 286 PHE OXT O N N 287 PHE H H N N 288 PHE H2 H N N 289 PHE HA H N N 290 PHE HB2 H N N 291 PHE HB3 H N N 292 PHE HD1 H N N 293 PHE HD2 H N N 294 PHE HE1 H N N 295 PHE HE2 H N N 296 PHE HZ H N N 297 PHE HXT H N N 298 PRO N N N N 299 PRO CA C N S 300 PRO C C N N 301 PRO O O N N 302 PRO CB C N N 303 PRO CG C N N 304 PRO CD C N N 305 PRO OXT O N N 306 PRO H H N N 307 PRO HA H N N 308 PRO HB2 H N N 309 PRO HB3 H N N 310 PRO HG2 H N N 311 PRO HG3 H N N 312 PRO HD2 H N N 313 PRO HD3 H N N 314 PRO HXT H N N 315 SER N N N N 316 SER CA C N S 317 SER C C N N 318 SER O O N N 319 SER CB C N N 320 SER OG O N N 321 SER OXT O N N 322 SER H H N N 323 SER H2 H N N 324 SER HA H N N 325 SER HB2 H N N 326 SER HB3 H N N 327 SER HG H N N 328 SER HXT H N N 329 THR N N N N 330 THR CA C N S 331 THR C C N N 332 THR O O N N 333 THR CB C N R 334 THR OG1 O N N 335 THR CG2 C N N 336 THR OXT O N N 337 THR H H N N 338 THR H2 H N N 339 THR HA H N N 340 THR HB H N N 341 THR HG1 H N N 342 THR HG21 H N N 343 THR HG22 H N N 344 THR HG23 H N N 345 THR HXT H N N 346 VAL N N N N 347 VAL CA C N S 348 VAL C C N N 349 VAL O O N N 350 VAL CB C N N 351 VAL CG1 C N N 352 VAL CG2 C N N 353 VAL OXT O N N 354 VAL H H N N 355 VAL H2 H N N 356 VAL HA H N N 357 VAL HB H N N 358 VAL HG11 H N N 359 VAL HG12 H N N 360 VAL HG13 H N N 361 VAL HG21 H N N 362 VAL HG22 H N N 363 VAL HG23 H N N 364 VAL HXT H N N 365 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EPE N1 C2 sing N N 83 EPE N1 C6 sing N N 84 EPE N1 C9 sing N N 85 EPE C2 C3 sing N N 86 EPE C2 H21 sing N N 87 EPE C2 H22 sing N N 88 EPE C3 N4 sing N N 89 EPE C3 H31 sing N N 90 EPE C3 H32 sing N N 91 EPE N4 C5 sing N N 92 EPE N4 C7 sing N N 93 EPE C5 C6 sing N N 94 EPE C5 H51 sing N N 95 EPE C5 H52 sing N N 96 EPE C6 H61 sing N N 97 EPE C6 H62 sing N N 98 EPE C7 C8 sing N N 99 EPE C7 H71 sing N N 100 EPE C7 H72 sing N N 101 EPE C8 O8 sing N N 102 EPE C8 H81 sing N N 103 EPE C8 H82 sing N N 104 EPE O8 HO8 sing N N 105 EPE C9 C10 sing N N 106 EPE C9 H91 sing N N 107 EPE C9 H92 sing N N 108 EPE C10 S sing N N 109 EPE C10 H101 sing N N 110 EPE C10 H102 sing N N 111 EPE S O1S doub N N 112 EPE S O2S doub N N 113 EPE S O3S sing N N 114 EPE O3S HOS3 sing N N 115 GLN N CA sing N N 116 GLN N H sing N N 117 GLN N H2 sing N N 118 GLN CA C sing N N 119 GLN CA CB sing N N 120 GLN CA HA sing N N 121 GLN C O doub N N 122 GLN C OXT sing N N 123 GLN CB CG sing N N 124 GLN CB HB2 sing N N 125 GLN CB HB3 sing N N 126 GLN CG CD sing N N 127 GLN CG HG2 sing N N 128 GLN CG HG3 sing N N 129 GLN CD OE1 doub N N 130 GLN CD NE2 sing N N 131 GLN NE2 HE21 sing N N 132 GLN NE2 HE22 sing N N 133 GLN OXT HXT sing N N 134 GLU N CA sing N N 135 GLU N H sing N N 136 GLU N H2 sing N N 137 GLU CA C sing N N 138 GLU CA CB sing N N 139 GLU CA HA sing N N 140 GLU C O doub N N 141 GLU C OXT sing N N 142 GLU CB CG sing N N 143 GLU CB HB2 sing N N 144 GLU CB HB3 sing N N 145 GLU CG CD sing N N 146 GLU CG HG2 sing N N 147 GLU CG HG3 sing N N 148 GLU CD OE1 doub N N 149 GLU CD OE2 sing N N 150 GLU OE2 HE2 sing N N 151 GLU OXT HXT sing N N 152 GLY N CA sing N N 153 GLY N H sing N N 154 GLY N H2 sing N N 155 GLY CA C sing N N 156 GLY CA HA2 sing N N 157 GLY CA HA3 sing N N 158 GLY C O doub N N 159 GLY C OXT sing N N 160 GLY OXT HXT sing N N 161 HIS N CA sing N N 162 HIS N H sing N N 163 HIS N H2 sing N N 164 HIS CA C sing N N 165 HIS CA CB sing N N 166 HIS CA HA sing N N 167 HIS C O doub N N 168 HIS C OXT sing N N 169 HIS CB CG sing N N 170 HIS CB HB2 sing N N 171 HIS CB HB3 sing N N 172 HIS CG ND1 sing Y N 173 HIS CG CD2 doub Y N 174 HIS ND1 CE1 doub Y N 175 HIS ND1 HD1 sing N N 176 HIS CD2 NE2 sing Y N 177 HIS CD2 HD2 sing N N 178 HIS CE1 NE2 sing Y N 179 HIS CE1 HE1 sing N N 180 HIS NE2 HE2 sing N N 181 HIS OXT HXT sing N N 182 HOH O H1 sing N N 183 HOH O H2 sing N N 184 ILE N CA sing N N 185 ILE N H sing N N 186 ILE N H2 sing N N 187 ILE CA C sing N N 188 ILE CA CB sing N N 189 ILE CA HA sing N N 190 ILE C O doub N N 191 ILE C OXT sing N N 192 ILE CB CG1 sing N N 193 ILE CB CG2 sing N N 194 ILE CB HB sing N N 195 ILE CG1 CD1 sing N N 196 ILE CG1 HG12 sing N N 197 ILE CG1 HG13 sing N N 198 ILE CG2 HG21 sing N N 199 ILE CG2 HG22 sing N N 200 ILE CG2 HG23 sing N N 201 ILE CD1 HD11 sing N N 202 ILE CD1 HD12 sing N N 203 ILE CD1 HD13 sing N N 204 ILE OXT HXT sing N N 205 IPA C1 C2 sing N N 206 IPA C1 H11 sing N N 207 IPA C1 H12 sing N N 208 IPA C1 H13 sing N N 209 IPA C2 C3 sing N N 210 IPA C2 O2 sing N N 211 IPA C2 H2 sing N N 212 IPA C3 H31 sing N N 213 IPA C3 H32 sing N N 214 IPA C3 H33 sing N N 215 IPA O2 HO2 sing N N 216 LEU N CA sing N N 217 LEU N H sing N N 218 LEU N H2 sing N N 219 LEU CA C sing N N 220 LEU CA CB sing N N 221 LEU CA HA sing N N 222 LEU C O doub N N 223 LEU C OXT sing N N 224 LEU CB CG sing N N 225 LEU CB HB2 sing N N 226 LEU CB HB3 sing N N 227 LEU CG CD1 sing N N 228 LEU CG CD2 sing N N 229 LEU CG HG sing N N 230 LEU CD1 HD11 sing N N 231 LEU CD1 HD12 sing N N 232 LEU CD1 HD13 sing N N 233 LEU CD2 HD21 sing N N 234 LEU CD2 HD22 sing N N 235 LEU CD2 HD23 sing N N 236 LEU OXT HXT sing N N 237 LYS N CA sing N N 238 LYS N H sing N N 239 LYS N H2 sing N N 240 LYS CA C sing N N 241 LYS CA CB sing N N 242 LYS CA HA sing N N 243 LYS C O doub N N 244 LYS C OXT sing N N 245 LYS CB CG sing N N 246 LYS CB HB2 sing N N 247 LYS CB HB3 sing N N 248 LYS CG CD sing N N 249 LYS CG HG2 sing N N 250 LYS CG HG3 sing N N 251 LYS CD CE sing N N 252 LYS CD HD2 sing N N 253 LYS CD HD3 sing N N 254 LYS CE NZ sing N N 255 LYS CE HE2 sing N N 256 LYS CE HE3 sing N N 257 LYS NZ HZ1 sing N N 258 LYS NZ HZ2 sing N N 259 LYS NZ HZ3 sing N N 260 LYS OXT HXT sing N N 261 PHE N CA sing N N 262 PHE N H sing N N 263 PHE N H2 sing N N 264 PHE CA C sing N N 265 PHE CA CB sing N N 266 PHE CA HA sing N N 267 PHE C O doub N N 268 PHE C OXT sing N N 269 PHE CB CG sing N N 270 PHE CB HB2 sing N N 271 PHE CB HB3 sing N N 272 PHE CG CD1 doub Y N 273 PHE CG CD2 sing Y N 274 PHE CD1 CE1 sing Y N 275 PHE CD1 HD1 sing N N 276 PHE CD2 CE2 doub Y N 277 PHE CD2 HD2 sing N N 278 PHE CE1 CZ doub Y N 279 PHE CE1 HE1 sing N N 280 PHE CE2 CZ sing Y N 281 PHE CE2 HE2 sing N N 282 PHE CZ HZ sing N N 283 PHE OXT HXT sing N N 284 PRO N CA sing N N 285 PRO N CD sing N N 286 PRO N H sing N N 287 PRO CA C sing N N 288 PRO CA CB sing N N 289 PRO CA HA sing N N 290 PRO C O doub N N 291 PRO C OXT sing N N 292 PRO CB CG sing N N 293 PRO CB HB2 sing N N 294 PRO CB HB3 sing N N 295 PRO CG CD sing N N 296 PRO CG HG2 sing N N 297 PRO CG HG3 sing N N 298 PRO CD HD2 sing N N 299 PRO CD HD3 sing N N 300 PRO OXT HXT sing N N 301 SER N CA sing N N 302 SER N H sing N N 303 SER N H2 sing N N 304 SER CA C sing N N 305 SER CA CB sing N N 306 SER CA HA sing N N 307 SER C O doub N N 308 SER C OXT sing N N 309 SER CB OG sing N N 310 SER CB HB2 sing N N 311 SER CB HB3 sing N N 312 SER OG HG sing N N 313 SER OXT HXT sing N N 314 THR N CA sing N N 315 THR N H sing N N 316 THR N H2 sing N N 317 THR CA C sing N N 318 THR CA CB sing N N 319 THR CA HA sing N N 320 THR C O doub N N 321 THR C OXT sing N N 322 THR CB OG1 sing N N 323 THR CB CG2 sing N N 324 THR CB HB sing N N 325 THR OG1 HG1 sing N N 326 THR CG2 HG21 sing N N 327 THR CG2 HG22 sing N N 328 THR CG2 HG23 sing N N 329 THR OXT HXT sing N N 330 VAL N CA sing N N 331 VAL N H sing N N 332 VAL N H2 sing N N 333 VAL CA C sing N N 334 VAL CA CB sing N N 335 VAL CA HA sing N N 336 VAL C O doub N N 337 VAL C OXT sing N N 338 VAL CB CG1 sing N N 339 VAL CB CG2 sing N N 340 VAL CB HB sing N N 341 VAL CG1 HG11 sing N N 342 VAL CG1 HG12 sing N N 343 VAL CG1 HG13 sing N N 344 VAL CG2 HG21 sing N N 345 VAL CG2 HG22 sing N N 346 VAL CG2 HG23 sing N N 347 VAL OXT HXT sing N N 348 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Health and Medical Research Council (NHMRC, Australia)' Australia APP1103871 1 'Australian Research Council (ARC)' Australia FT130101349 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SODIUM ION' NA 4 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 5 'ISOPROPYL ALCOHOL' IPA 6 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 61 2 2' _space_group.name_Hall 'P 61 2 (x,y,z+5/12)' _space_group.IT_number 178 _space_group.crystal_system hexagonal _space_group.id 1 #