data_8BVI # _entry.id 8BVI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8BVI pdb_00008bvi 10.2210/pdb8bvi/pdb WWPDB D_1292127196 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8BVI _pdbx_database_status.recvd_initial_deposition_date 2022-12-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hammerstad, M.' 1 0000-0003-0872-3441 'Schroer, L.' 2 0000-0001-9396-4893 'Hersleth, H.-P.' 3 0000-0002-1142-9983 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'METTL9-like histidine methyltransferases' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schroer, L.' 1 ? primary 'Hammerstad, M.' 2 ? primary 'Weirich, S.' 3 ? primary 'Hersleth, H.-P.' 4 ? primary 'Groensberg, I.A.' 5 ? primary 'Hagen, L.' 6 ? primary 'Slupphaug, G.' 7 ? primary 'Davydova, E.' 8 ? primary 'Falnes, P.O.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8BVI _cell.details ? _cell.formula_units_Z ? _cell.length_a 106.898 _cell.length_a_esd ? _cell.length_b 106.898 _cell.length_b_esd ? _cell.length_c 106.898 _cell.length_c_esd ? _cell.volume 1221542.945 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8BVI _symmetry.cell_setting ? _symmetry.Int_Tables_number 198 _symmetry.space_group_name_Hall 'P 2ac 2ab 3' _symmetry.space_group_name_H-M 'P 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DREV methyltransferase' 33902.297 1 ? ? ? 'Methyltransferase-like protein 9' 2 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Methyltransferase-like protein 9' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSMASEERTSALRIRCAHCDAVFDERALPYDADVDSLASSALREKFVRLSLDSESVEFLNRARARGRDECERLARKC TELRRTMSLTEANAILGRGKMFVFSDAHVETLMRACGEGAGGGWFLDVGAGEGEVTRTLARRFAGTCATESSPGMASRLR EKGFDVVLESDTVENVVRETRARGGDVSEDGFDVVAALNLCDRVRSPRALLRDLKRALKAKTGILILAIVVPFRPFVENA DGTRSQPDERLDVPSAGSWESGVDALWTELIAPLGFDLVTLSRVPYISEGDHLYDAYVLDDAVFVLRAPP ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMASEERTSALRIRCAHCDAVFDERALPYDADVDSLASSALREKFVRLSLDSESVEFLNRARARGRDECERLARKC TELRRTMSLTEANAILGRGKMFVFSDAHVETLMRACGEGAGGGWFLDVGAGEGEVTRTLARRFAGTCATESSPGMASRLR EKGFDVVLESDTVENVVRETRARGGDVSEDGFDVVAALNLCDRVRSPRALLRDLKRALKAKTGILILAIVVPFRPFVENA DGTRSQPDERLDVPSAGSWESGVDALWTELIAPLGFDLVTLSRVPYISEGDHLYDAYVLDDAVFVLRAPP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 ALA n 1 8 SER n 1 9 GLU n 1 10 GLU n 1 11 ARG n 1 12 THR n 1 13 SER n 1 14 ALA n 1 15 LEU n 1 16 ARG n 1 17 ILE n 1 18 ARG n 1 19 CYS n 1 20 ALA n 1 21 HIS n 1 22 CYS n 1 23 ASP n 1 24 ALA n 1 25 VAL n 1 26 PHE n 1 27 ASP n 1 28 GLU n 1 29 ARG n 1 30 ALA n 1 31 LEU n 1 32 PRO n 1 33 TYR n 1 34 ASP n 1 35 ALA n 1 36 ASP n 1 37 VAL n 1 38 ASP n 1 39 SER n 1 40 LEU n 1 41 ALA n 1 42 SER n 1 43 SER n 1 44 ALA n 1 45 LEU n 1 46 ARG n 1 47 GLU n 1 48 LYS n 1 49 PHE n 1 50 VAL n 1 51 ARG n 1 52 LEU n 1 53 SER n 1 54 LEU n 1 55 ASP n 1 56 SER n 1 57 GLU n 1 58 SER n 1 59 VAL n 1 60 GLU n 1 61 PHE n 1 62 LEU n 1 63 ASN n 1 64 ARG n 1 65 ALA n 1 66 ARG n 1 67 ALA n 1 68 ARG n 1 69 GLY n 1 70 ARG n 1 71 ASP n 1 72 GLU n 1 73 CYS n 1 74 GLU n 1 75 ARG n 1 76 LEU n 1 77 ALA n 1 78 ARG n 1 79 LYS n 1 80 CYS n 1 81 THR n 1 82 GLU n 1 83 LEU n 1 84 ARG n 1 85 ARG n 1 86 THR n 1 87 MET n 1 88 SER n 1 89 LEU n 1 90 THR n 1 91 GLU n 1 92 ALA n 1 93 ASN n 1 94 ALA n 1 95 ILE n 1 96 LEU n 1 97 GLY n 1 98 ARG n 1 99 GLY n 1 100 LYS n 1 101 MET n 1 102 PHE n 1 103 VAL n 1 104 PHE n 1 105 SER n 1 106 ASP n 1 107 ALA n 1 108 HIS n 1 109 VAL n 1 110 GLU n 1 111 THR n 1 112 LEU n 1 113 MET n 1 114 ARG n 1 115 ALA n 1 116 CYS n 1 117 GLY n 1 118 GLU n 1 119 GLY n 1 120 ALA n 1 121 GLY n 1 122 GLY n 1 123 GLY n 1 124 TRP n 1 125 PHE n 1 126 LEU n 1 127 ASP n 1 128 VAL n 1 129 GLY n 1 130 ALA n 1 131 GLY n 1 132 GLU n 1 133 GLY n 1 134 GLU n 1 135 VAL n 1 136 THR n 1 137 ARG n 1 138 THR n 1 139 LEU n 1 140 ALA n 1 141 ARG n 1 142 ARG n 1 143 PHE n 1 144 ALA n 1 145 GLY n 1 146 THR n 1 147 CYS n 1 148 ALA n 1 149 THR n 1 150 GLU n 1 151 SER n 1 152 SER n 1 153 PRO n 1 154 GLY n 1 155 MET n 1 156 ALA n 1 157 SER n 1 158 ARG n 1 159 LEU n 1 160 ARG n 1 161 GLU n 1 162 LYS n 1 163 GLY n 1 164 PHE n 1 165 ASP n 1 166 VAL n 1 167 VAL n 1 168 LEU n 1 169 GLU n 1 170 SER n 1 171 ASP n 1 172 THR n 1 173 VAL n 1 174 GLU n 1 175 ASN n 1 176 VAL n 1 177 VAL n 1 178 ARG n 1 179 GLU n 1 180 THR n 1 181 ARG n 1 182 ALA n 1 183 ARG n 1 184 GLY n 1 185 GLY n 1 186 ASP n 1 187 VAL n 1 188 SER n 1 189 GLU n 1 190 ASP n 1 191 GLY n 1 192 PHE n 1 193 ASP n 1 194 VAL n 1 195 VAL n 1 196 ALA n 1 197 ALA n 1 198 LEU n 1 199 ASN n 1 200 LEU n 1 201 CYS n 1 202 ASP n 1 203 ARG n 1 204 VAL n 1 205 ARG n 1 206 SER n 1 207 PRO n 1 208 ARG n 1 209 ALA n 1 210 LEU n 1 211 LEU n 1 212 ARG n 1 213 ASP n 1 214 LEU n 1 215 LYS n 1 216 ARG n 1 217 ALA n 1 218 LEU n 1 219 LYS n 1 220 ALA n 1 221 LYS n 1 222 THR n 1 223 GLY n 1 224 ILE n 1 225 LEU n 1 226 ILE n 1 227 LEU n 1 228 ALA n 1 229 ILE n 1 230 VAL n 1 231 VAL n 1 232 PRO n 1 233 PHE n 1 234 ARG n 1 235 PRO n 1 236 PHE n 1 237 VAL n 1 238 GLU n 1 239 ASN n 1 240 ALA n 1 241 ASP n 1 242 GLY n 1 243 THR n 1 244 ARG n 1 245 SER n 1 246 GLN n 1 247 PRO n 1 248 ASP n 1 249 GLU n 1 250 ARG n 1 251 LEU n 1 252 ASP n 1 253 VAL n 1 254 PRO n 1 255 SER n 1 256 ALA n 1 257 GLY n 1 258 SER n 1 259 TRP n 1 260 GLU n 1 261 SER n 1 262 GLY n 1 263 VAL n 1 264 ASP n 1 265 ALA n 1 266 LEU n 1 267 TRP n 1 268 THR n 1 269 GLU n 1 270 LEU n 1 271 ILE n 1 272 ALA n 1 273 PRO n 1 274 LEU n 1 275 GLY n 1 276 PHE n 1 277 ASP n 1 278 LEU n 1 279 VAL n 1 280 THR n 1 281 LEU n 1 282 SER n 1 283 ARG n 1 284 VAL n 1 285 PRO n 1 286 TYR n 1 287 ILE n 1 288 SER n 1 289 GLU n 1 290 GLY n 1 291 ASP n 1 292 HIS n 1 293 LEU n 1 294 TYR n 1 295 ASP n 1 296 ALA n 1 297 TYR n 1 298 VAL n 1 299 LEU n 1 300 ASP n 1 301 ASP n 1 302 ALA n 1 303 VAL n 1 304 PHE n 1 305 VAL n 1 306 LEU n 1 307 ARG n 1 308 ALA n 1 309 PRO n 1 310 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 310 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene OT_ostta03g04640 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ostreococcus tauri' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 70448 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pGEX-6P-2 _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q01C52_OSTTA _struct_ref.pdbx_db_accession Q01C52 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASEERTSALRIRCAHCDAVFDERALPYDADVDSLASSALREKFVRLSLDSESVEFLNRARARGRDECERLARKCTELRR TMSLTEANAILGRGKMFVFSDAHVETLMRACGEGAGGGWFLDVGAGEGEVTRTLARRFAGTCATESSPGMASRLREKGFD VVLESDTVENVVRETRARGGDVSEDGFDVVAALNLCDRVRSPRALLRDLKRALKAKTGILILAIVVPFRPFVENADGTRS QPDERLDVPSAGSWESGVDALWTELIAPLGFDLVTLSRVPYISEGDHLYDAYVLDDAVFVLRAPP ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8BVI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 310 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q01C52 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 305 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 305 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8BVI GLY A 1 ? UNP Q01C52 ? ? 'expression tag' -4 1 1 8BVI PRO A 2 ? UNP Q01C52 ? ? 'expression tag' -3 2 1 8BVI LEU A 3 ? UNP Q01C52 ? ? 'expression tag' -2 3 1 8BVI GLY A 4 ? UNP Q01C52 ? ? 'expression tag' -1 4 1 8BVI SER A 5 ? UNP Q01C52 ? ? 'expression tag' 0 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8BVI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.97 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.6 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Hepes pH 7.5, 0.2 M L-proline, 10% w/v polyethylene glycol 3,350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-10-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.918402 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.918402 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 119.69 _reflns.entry_id 8BVI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.10 _reflns.d_resolution_low 75.59 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7642 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.00 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.124 _reflns.pdbx_Rpim_I_all 0.041 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.117 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.10 _reflns_shell.d_res_low 3.31 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1372 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.4 _reflns_shell.pdbx_chi_squared 1.0 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.010 _reflns_shell.pdbx_Rpim_I_all 0.648 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.553 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.900 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 131.37 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8BVI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.10 _refine.ls_d_res_low 47.81 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7607 _refine.ls_number_reflns_R_free 435 _refine.ls_number_reflns_R_work 7172 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.87 _refine.ls_percent_reflns_R_free 5.72 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2258 _refine.ls_R_factor_R_free 0.2801 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2225 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.0000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.6000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.4375 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4073 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.10 _refine_hist.d_res_low 47.81 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 2305 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2299 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0011 ? 2335 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.3318 ? 3159 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0378 ? 358 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0027 ? 420 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 7.8864 ? 869 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.10 3.31 . . 135 2352 99.84 . . . . 0.3283 . . . . . . . . . . . 0.3759 'X-RAY DIFFRACTION' 3.31 4.47 . . 136 2377 100.00 . . . . 0.2624 . . . . . . . . . . . 0.2887 'X-RAY DIFFRACTION' 4.47 47.81 . . 164 2443 99.77 . . . . 0.1902 . . . . . . . . . . . 0.2630 # _struct.entry_id 8BVI _struct.title 'Crystal structure of the METTL9-like histidine methyltransferase from Ostreococcus tauri' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8BVI _struct_keywords.text 'methyltransferase, histidine methyltransferase, Rossmann fold, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 36 ? LEU A 40 ? ASP A 31 LEU A 35 5 ? 5 HELX_P HELX_P2 AA2 SER A 43 ? LYS A 48 ? SER A 38 LYS A 43 1 ? 6 HELX_P HELX_P3 AA3 ASP A 55 ? ASN A 63 ? ASP A 50 ASN A 58 1 ? 9 HELX_P HELX_P4 AA4 GLY A 69 ? ARG A 84 ? GLY A 64 ARG A 79 1 ? 16 HELX_P HELX_P5 AA5 SER A 88 ? GLY A 97 ? SER A 83 GLY A 92 1 ? 10 HELX_P HELX_P6 AA6 SER A 105 ? CYS A 116 ? SER A 100 CYS A 111 1 ? 12 HELX_P HELX_P7 AA7 SER A 152 ? ARG A 160 ? SER A 147 ARG A 155 1 ? 9 HELX_P HELX_P8 AA8 ASN A 175 ? ARG A 183 ? ASN A 170 ARG A 178 1 ? 9 HELX_P HELX_P9 AA9 SER A 206 ? ARG A 216 ? SER A 201 ARG A 211 1 ? 11 HELX_P HELX_P10 AB1 SER A 258 ? THR A 268 ? SER A 253 THR A 263 1 ? 11 HELX_P HELX_P11 AB2 ILE A 271 ? GLY A 275 ? ILE A 266 GLY A 270 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 231 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 226 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 232 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 227 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.85 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 101 ? PHE A 102 ? MET A 96 PHE A 97 AA1 2 ASP A 277 ? GLU A 289 ? ASP A 272 GLU A 284 AA1 3 ALA A 296 ? ARG A 307 ? ALA A 291 ARG A 302 AA1 4 ILE A 224 ? VAL A 230 ? ILE A 219 VAL A 225 AA1 5 VAL A 194 ? LEU A 198 ? VAL A 189 LEU A 193 AA1 6 TRP A 124 ? VAL A 128 ? TRP A 119 VAL A 123 AA1 7 GLY A 145 ? THR A 149 ? GLY A 140 THR A 144 AA1 8 VAL A 166 ? LEU A 168 ? VAL A 161 LEU A 163 AA2 1 GLU A 238 ? ALA A 240 ? GLU A 233 ALA A 235 AA2 2 THR A 243 ? ARG A 244 ? THR A 238 ARG A 239 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 102 ? N PHE A 97 O ILE A 287 ? O ILE A 282 AA1 2 3 N TYR A 286 ? N TYR A 281 O LEU A 299 ? O LEU A 294 AA1 3 4 O PHE A 304 ? O PHE A 299 N LEU A 227 ? N LEU A 222 AA1 4 5 O ILE A 226 ? O ILE A 221 N ALA A 197 ? N ALA A 192 AA1 5 6 O ALA A 196 ? O ALA A 191 N LEU A 126 ? N LEU A 121 AA1 6 7 N PHE A 125 ? N PHE A 120 O CYS A 147 ? O CYS A 142 AA1 7 8 N ALA A 148 ? N ALA A 143 O LEU A 168 ? O LEU A 163 AA2 1 2 N ASN A 239 ? N ASN A 234 O THR A 243 ? O THR A 238 # _atom_sites.entry_id 8BVI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009355 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009355 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009355 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 ? ? ? A . n A 1 2 PRO 2 -3 ? ? ? A . n A 1 3 LEU 3 -2 ? ? ? A . n A 1 4 GLY 4 -1 ? ? ? A . n A 1 5 SER 5 0 ? ? ? A . n A 1 6 MET 6 1 ? ? ? A . n A 1 7 ALA 7 2 ? ? ? A . n A 1 8 SER 8 3 ? ? ? A . n A 1 9 GLU 9 4 ? ? ? A . n A 1 10 GLU 10 5 ? ? ? A . n A 1 11 ARG 11 6 ? ? ? A . n A 1 12 THR 12 7 7 THR THR A . n A 1 13 SER 13 8 8 SER SER A . n A 1 14 ALA 14 9 9 ALA ALA A . n A 1 15 LEU 15 10 10 LEU LEU A . n A 1 16 ARG 16 11 11 ARG ARG A . n A 1 17 ILE 17 12 12 ILE ILE A . n A 1 18 ARG 18 13 13 ARG ARG A . n A 1 19 CYS 19 14 14 CYS CYS A . n A 1 20 ALA 20 15 15 ALA ALA A . n A 1 21 HIS 21 16 16 HIS HIS A . n A 1 22 CYS 22 17 17 CYS CYS A . n A 1 23 ASP 23 18 18 ASP ASP A . n A 1 24 ALA 24 19 19 ALA ALA A . n A 1 25 VAL 25 20 20 VAL VAL A . n A 1 26 PHE 26 21 21 PHE PHE A . n A 1 27 ASP 27 22 22 ASP ASP A . n A 1 28 GLU 28 23 23 GLU GLU A . n A 1 29 ARG 29 24 24 ARG ARG A . n A 1 30 ALA 30 25 25 ALA ALA A . n A 1 31 LEU 31 26 26 LEU LEU A . n A 1 32 PRO 32 27 27 PRO PRO A . n A 1 33 TYR 33 28 28 TYR TYR A . n A 1 34 ASP 34 29 29 ASP ASP A . n A 1 35 ALA 35 30 30 ALA ALA A . n A 1 36 ASP 36 31 31 ASP ASP A . n A 1 37 VAL 37 32 32 VAL VAL A . n A 1 38 ASP 38 33 33 ASP ASP A . n A 1 39 SER 39 34 34 SER SER A . n A 1 40 LEU 40 35 35 LEU LEU A . n A 1 41 ALA 41 36 36 ALA ALA A . n A 1 42 SER 42 37 37 SER SER A . n A 1 43 SER 43 38 38 SER SER A . n A 1 44 ALA 44 39 39 ALA ALA A . n A 1 45 LEU 45 40 40 LEU LEU A . n A 1 46 ARG 46 41 41 ARG ARG A . n A 1 47 GLU 47 42 42 GLU GLU A . n A 1 48 LYS 48 43 43 LYS LYS A . n A 1 49 PHE 49 44 44 PHE PHE A . n A 1 50 VAL 50 45 45 VAL VAL A . n A 1 51 ARG 51 46 46 ARG ARG A . n A 1 52 LEU 52 47 47 LEU LEU A . n A 1 53 SER 53 48 48 SER SER A . n A 1 54 LEU 54 49 49 LEU LEU A . n A 1 55 ASP 55 50 50 ASP ASP A . n A 1 56 SER 56 51 51 SER SER A . n A 1 57 GLU 57 52 52 GLU GLU A . n A 1 58 SER 58 53 53 SER SER A . n A 1 59 VAL 59 54 54 VAL VAL A . n A 1 60 GLU 60 55 55 GLU GLU A . n A 1 61 PHE 61 56 56 PHE PHE A . n A 1 62 LEU 62 57 57 LEU LEU A . n A 1 63 ASN 63 58 58 ASN ASN A . n A 1 64 ARG 64 59 59 ARG ARG A . n A 1 65 ALA 65 60 60 ALA ALA A . n A 1 66 ARG 66 61 61 ARG ARG A . n A 1 67 ALA 67 62 62 ALA ALA A . n A 1 68 ARG 68 63 63 ARG ARG A . n A 1 69 GLY 69 64 64 GLY GLY A . n A 1 70 ARG 70 65 65 ARG ARG A . n A 1 71 ASP 71 66 66 ASP ASP A . n A 1 72 GLU 72 67 67 GLU GLU A . n A 1 73 CYS 73 68 68 CYS CYS A . n A 1 74 GLU 74 69 69 GLU GLU A . n A 1 75 ARG 75 70 70 ARG ARG A . n A 1 76 LEU 76 71 71 LEU LEU A . n A 1 77 ALA 77 72 72 ALA ALA A . n A 1 78 ARG 78 73 73 ARG ARG A . n A 1 79 LYS 79 74 74 LYS LYS A . n A 1 80 CYS 80 75 75 CYS CYS A . n A 1 81 THR 81 76 76 THR THR A . n A 1 82 GLU 82 77 77 GLU GLU A . n A 1 83 LEU 83 78 78 LEU LEU A . n A 1 84 ARG 84 79 79 ARG ARG A . n A 1 85 ARG 85 80 80 ARG ARG A . n A 1 86 THR 86 81 81 THR THR A . n A 1 87 MET 87 82 82 MET MET A . n A 1 88 SER 88 83 83 SER SER A . n A 1 89 LEU 89 84 84 LEU LEU A . n A 1 90 THR 90 85 85 THR THR A . n A 1 91 GLU 91 86 86 GLU GLU A . n A 1 92 ALA 92 87 87 ALA ALA A . n A 1 93 ASN 93 88 88 ASN ASN A . n A 1 94 ALA 94 89 89 ALA ALA A . n A 1 95 ILE 95 90 90 ILE ILE A . n A 1 96 LEU 96 91 91 LEU LEU A . n A 1 97 GLY 97 92 92 GLY GLY A . n A 1 98 ARG 98 93 93 ARG ARG A . n A 1 99 GLY 99 94 94 GLY GLY A . n A 1 100 LYS 100 95 95 LYS LYS A . n A 1 101 MET 101 96 96 MET MET A . n A 1 102 PHE 102 97 97 PHE PHE A . n A 1 103 VAL 103 98 98 VAL VAL A . n A 1 104 PHE 104 99 99 PHE PHE A . n A 1 105 SER 105 100 100 SER SER A . n A 1 106 ASP 106 101 101 ASP ASP A . n A 1 107 ALA 107 102 102 ALA ALA A . n A 1 108 HIS 108 103 103 HIS HIS A . n A 1 109 VAL 109 104 104 VAL VAL A . n A 1 110 GLU 110 105 105 GLU GLU A . n A 1 111 THR 111 106 106 THR THR A . n A 1 112 LEU 112 107 107 LEU LEU A . n A 1 113 MET 113 108 108 MET MET A . n A 1 114 ARG 114 109 109 ARG ARG A . n A 1 115 ALA 115 110 110 ALA ALA A . n A 1 116 CYS 116 111 111 CYS CYS A . n A 1 117 GLY 117 112 112 GLY GLY A . n A 1 118 GLU 118 113 113 GLU GLU A . n A 1 119 GLY 119 114 114 GLY GLY A . n A 1 120 ALA 120 115 115 ALA ALA A . n A 1 121 GLY 121 116 116 GLY GLY A . n A 1 122 GLY 122 117 117 GLY GLY A . n A 1 123 GLY 123 118 118 GLY GLY A . n A 1 124 TRP 124 119 119 TRP TRP A . n A 1 125 PHE 125 120 120 PHE PHE A . n A 1 126 LEU 126 121 121 LEU LEU A . n A 1 127 ASP 127 122 122 ASP ASP A . n A 1 128 VAL 128 123 123 VAL VAL A . n A 1 129 GLY 129 124 124 GLY GLY A . n A 1 130 ALA 130 125 125 ALA ALA A . n A 1 131 GLY 131 126 126 GLY GLY A . n A 1 132 GLU 132 127 127 GLU GLU A . n A 1 133 GLY 133 128 128 GLY GLY A . n A 1 134 GLU 134 129 129 GLU GLU A . n A 1 135 VAL 135 130 130 VAL VAL A . n A 1 136 THR 136 131 131 THR THR A . n A 1 137 ARG 137 132 132 ARG ARG A . n A 1 138 THR 138 133 133 THR THR A . n A 1 139 LEU 139 134 134 LEU LEU A . n A 1 140 ALA 140 135 135 ALA ALA A . n A 1 141 ARG 141 136 136 ARG ARG A . n A 1 142 ARG 142 137 137 ARG ARG A . n A 1 143 PHE 143 138 138 PHE PHE A . n A 1 144 ALA 144 139 139 ALA ALA A . n A 1 145 GLY 145 140 140 GLY GLY A . n A 1 146 THR 146 141 141 THR THR A . n A 1 147 CYS 147 142 142 CYS CYS A . n A 1 148 ALA 148 143 143 ALA ALA A . n A 1 149 THR 149 144 144 THR THR A . n A 1 150 GLU 150 145 145 GLU GLU A . n A 1 151 SER 151 146 146 SER SER A . n A 1 152 SER 152 147 147 SER SER A . n A 1 153 PRO 153 148 148 PRO PRO A . n A 1 154 GLY 154 149 149 GLY GLY A . n A 1 155 MET 155 150 150 MET MET A . n A 1 156 ALA 156 151 151 ALA ALA A . n A 1 157 SER 157 152 152 SER SER A . n A 1 158 ARG 158 153 153 ARG ARG A . n A 1 159 LEU 159 154 154 LEU LEU A . n A 1 160 ARG 160 155 155 ARG ARG A . n A 1 161 GLU 161 156 156 GLU GLU A . n A 1 162 LYS 162 157 157 LYS LYS A . n A 1 163 GLY 163 158 158 GLY GLY A . n A 1 164 PHE 164 159 159 PHE PHE A . n A 1 165 ASP 165 160 160 ASP ASP A . n A 1 166 VAL 166 161 161 VAL VAL A . n A 1 167 VAL 167 162 162 VAL VAL A . n A 1 168 LEU 168 163 163 LEU LEU A . n A 1 169 GLU 169 164 164 GLU GLU A . n A 1 170 SER 170 165 165 SER SER A . n A 1 171 ASP 171 166 166 ASP ASP A . n A 1 172 THR 172 167 167 THR THR A . n A 1 173 VAL 173 168 168 VAL VAL A . n A 1 174 GLU 174 169 169 GLU GLU A . n A 1 175 ASN 175 170 170 ASN ASN A . n A 1 176 VAL 176 171 171 VAL VAL A . n A 1 177 VAL 177 172 172 VAL VAL A . n A 1 178 ARG 178 173 173 ARG ARG A . n A 1 179 GLU 179 174 174 GLU GLU A . n A 1 180 THR 180 175 175 THR THR A . n A 1 181 ARG 181 176 176 ARG ARG A . n A 1 182 ALA 182 177 177 ALA ALA A . n A 1 183 ARG 183 178 178 ARG ARG A . n A 1 184 GLY 184 179 179 GLY GLY A . n A 1 185 GLY 185 180 180 GLY GLY A . n A 1 186 ASP 186 181 181 ASP ASP A . n A 1 187 VAL 187 182 182 VAL VAL A . n A 1 188 SER 188 183 183 SER SER A . n A 1 189 GLU 189 184 184 GLU GLU A . n A 1 190 ASP 190 185 185 ASP ASP A . n A 1 191 GLY 191 186 186 GLY GLY A . n A 1 192 PHE 192 187 187 PHE PHE A . n A 1 193 ASP 193 188 188 ASP ASP A . n A 1 194 VAL 194 189 189 VAL VAL A . n A 1 195 VAL 195 190 190 VAL VAL A . n A 1 196 ALA 196 191 191 ALA ALA A . n A 1 197 ALA 197 192 192 ALA ALA A . n A 1 198 LEU 198 193 193 LEU LEU A . n A 1 199 ASN 199 194 194 ASN ASN A . n A 1 200 LEU 200 195 195 LEU LEU A . n A 1 201 CYS 201 196 196 CYS CYS A . n A 1 202 ASP 202 197 197 ASP ASP A . n A 1 203 ARG 203 198 198 ARG ARG A . n A 1 204 VAL 204 199 199 VAL VAL A . n A 1 205 ARG 205 200 200 ARG ARG A . n A 1 206 SER 206 201 201 SER SER A . n A 1 207 PRO 207 202 202 PRO PRO A . n A 1 208 ARG 208 203 203 ARG ARG A . n A 1 209 ALA 209 204 204 ALA ALA A . n A 1 210 LEU 210 205 205 LEU LEU A . n A 1 211 LEU 211 206 206 LEU LEU A . n A 1 212 ARG 212 207 207 ARG ARG A . n A 1 213 ASP 213 208 208 ASP ASP A . n A 1 214 LEU 214 209 209 LEU LEU A . n A 1 215 LYS 215 210 210 LYS LYS A . n A 1 216 ARG 216 211 211 ARG ARG A . n A 1 217 ALA 217 212 212 ALA ALA A . n A 1 218 LEU 218 213 213 LEU LEU A . n A 1 219 LYS 219 214 214 LYS LYS A . n A 1 220 ALA 220 215 215 ALA ALA A . n A 1 221 LYS 221 216 216 LYS LYS A . n A 1 222 THR 222 217 217 THR THR A . n A 1 223 GLY 223 218 218 GLY GLY A . n A 1 224 ILE 224 219 219 ILE ILE A . n A 1 225 LEU 225 220 220 LEU LEU A . n A 1 226 ILE 226 221 221 ILE ILE A . n A 1 227 LEU 227 222 222 LEU LEU A . n A 1 228 ALA 228 223 223 ALA ALA A . n A 1 229 ILE 229 224 224 ILE ILE A . n A 1 230 VAL 230 225 225 VAL VAL A . n A 1 231 VAL 231 226 226 VAL VAL A . n A 1 232 PRO 232 227 227 PRO PRO A . n A 1 233 PHE 233 228 228 PHE PHE A . n A 1 234 ARG 234 229 229 ARG ARG A . n A 1 235 PRO 235 230 230 PRO PRO A . n A 1 236 PHE 236 231 231 PHE PHE A . n A 1 237 VAL 237 232 232 VAL VAL A . n A 1 238 GLU 238 233 233 GLU GLU A . n A 1 239 ASN 239 234 234 ASN ASN A . n A 1 240 ALA 240 235 235 ALA ALA A . n A 1 241 ASP 241 236 236 ASP ASP A . n A 1 242 GLY 242 237 237 GLY GLY A . n A 1 243 THR 243 238 238 THR THR A . n A 1 244 ARG 244 239 239 ARG ARG A . n A 1 245 SER 245 240 240 SER SER A . n A 1 246 GLN 246 241 241 GLN GLN A . n A 1 247 PRO 247 242 242 PRO PRO A . n A 1 248 ASP 248 243 243 ASP ASP A . n A 1 249 GLU 249 244 244 GLU GLU A . n A 1 250 ARG 250 245 245 ARG ARG A . n A 1 251 LEU 251 246 246 LEU LEU A . n A 1 252 ASP 252 247 247 ASP ASP A . n A 1 253 VAL 253 248 248 VAL VAL A . n A 1 254 PRO 254 249 249 PRO PRO A . n A 1 255 SER 255 250 250 SER SER A . n A 1 256 ALA 256 251 251 ALA ALA A . n A 1 257 GLY 257 252 252 GLY GLY A . n A 1 258 SER 258 253 253 SER SER A . n A 1 259 TRP 259 254 254 TRP TRP A . n A 1 260 GLU 260 255 255 GLU GLU A . n A 1 261 SER 261 256 256 SER SER A . n A 1 262 GLY 262 257 257 GLY GLY A . n A 1 263 VAL 263 258 258 VAL VAL A . n A 1 264 ASP 264 259 259 ASP ASP A . n A 1 265 ALA 265 260 260 ALA ALA A . n A 1 266 LEU 266 261 261 LEU LEU A . n A 1 267 TRP 267 262 262 TRP TRP A . n A 1 268 THR 268 263 263 THR THR A . n A 1 269 GLU 269 264 264 GLU GLU A . n A 1 270 LEU 270 265 265 LEU LEU A . n A 1 271 ILE 271 266 266 ILE ILE A . n A 1 272 ALA 272 267 267 ALA ALA A . n A 1 273 PRO 273 268 268 PRO PRO A . n A 1 274 LEU 274 269 269 LEU LEU A . n A 1 275 GLY 275 270 270 GLY GLY A . n A 1 276 PHE 276 271 271 PHE PHE A . n A 1 277 ASP 277 272 272 ASP ASP A . n A 1 278 LEU 278 273 273 LEU LEU A . n A 1 279 VAL 279 274 274 VAL VAL A . n A 1 280 THR 280 275 275 THR THR A . n A 1 281 LEU 281 276 276 LEU LEU A . n A 1 282 SER 282 277 277 SER SER A . n A 1 283 ARG 283 278 278 ARG ARG A . n A 1 284 VAL 284 279 279 VAL VAL A . n A 1 285 PRO 285 280 280 PRO PRO A . n A 1 286 TYR 286 281 281 TYR TYR A . n A 1 287 ILE 287 282 282 ILE ILE A . n A 1 288 SER 288 283 283 SER SER A . n A 1 289 GLU 289 284 284 GLU GLU A . n A 1 290 GLY 290 285 285 GLY GLY A . n A 1 291 ASP 291 286 286 ASP ASP A . n A 1 292 HIS 292 287 287 HIS HIS A . n A 1 293 LEU 293 288 288 LEU LEU A . n A 1 294 TYR 294 289 289 TYR TYR A . n A 1 295 ASP 295 290 290 ASP ASP A . n A 1 296 ALA 296 291 291 ALA ALA A . n A 1 297 TYR 297 292 292 TYR TYR A . n A 1 298 VAL 298 293 293 VAL VAL A . n A 1 299 LEU 299 294 294 LEU LEU A . n A 1 300 ASP 300 295 295 ASP ASP A . n A 1 301 ASP 301 296 296 ASP ASP A . n A 1 302 ALA 302 297 297 ALA ALA A . n A 1 303 VAL 303 298 298 VAL VAL A . n A 1 304 PHE 304 299 299 PHE PHE A . n A 1 305 VAL 305 300 300 VAL VAL A . n A 1 306 LEU 306 301 301 LEU LEU A . n A 1 307 ARG 307 302 302 ARG ARG A . n A 1 308 ALA 308 303 303 ALA ALA A . n A 1 309 PRO 309 304 304 PRO PRO A . n A 1 310 PRO 310 305 305 PRO PRO A . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email h.p.hersleth@ibv.uio.no _pdbx_contact_author.name_first Hans-Petter _pdbx_contact_author.name_last Hersleth _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1142-9983 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 1 HOH HOH A . B 2 HOH 2 402 4 HOH HOH A . B 2 HOH 3 403 3 HOH HOH A . B 2 HOH 4 404 2 HOH HOH A . B 2 HOH 5 405 6 HOH HOH A . B 2 HOH 6 406 5 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 16040 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 401 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-12-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 z,x,y 3 y,z,x 4 -y+1/2,-z,x+1/2 5 z+1/2,-x+1/2,-y 6 -y,z+1/2,-x+1/2 7 -z+1/2,-x,y+1/2 8 -z,x+1/2,-y+1/2 9 y+1/2,-z+1/2,-x 10 x+1/2,-y+1/2,-z 11 -x,y+1/2,-z+1/2 12 -x+1/2,-y,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -1.94108020813 29.5841569266 2.83278874435 0.856515216616 ? 0.0398668525555 ? -0.00767801620446 ? 0.973035125384 ? 0.0592031221257 ? 0.83295914983 ? 1.77200022522 ? -0.0776056096257 ? 0.852134797039 ? 3.60303262003 ? 1.44742566351 ? 3.32089412412 ? 0.349710371017 ? 0.176507004406 ? -0.220179917631 ? -0.226462187731 ? -0.117918079165 ? 0.292317353001 ? 0.257860375186 ? -0.17980267716 ? -0.177267399907 ? 2 'X-RAY DIFFRACTION' ? refined 7.05356034541 14.2129488823 -11.8855911941 1.07724937596 ? 0.114721556596 ? -0.147970229448 ? 1.0148056592 ? -0.259969000977 ? 0.717761858251 ? 6.61559867107 ? -2.63930880258 ? 0.691422827788 ? 5.95802540727 ? -0.678396785686 ? 2.76389815174 ? 0.363996938467 ? 0.567020175354 ? -0.222250152781 ? -0.508836400862 ? 0.0507229194989 ? -0.388165323217 ? 0.0748018760513 ? 0.349214749941 ? -0.389479784721 ? 3 'X-RAY DIFFRACTION' ? refined 3.66556545953 31.9099099722 -11.4560745025 1.47592923511 ? 0.240505986921 ? -0.00716134673445 ? 0.959296432954 ? 0.0990026849392 ? 0.905547598847 ? 4.2541663178 ? -0.503561289036 ? 0.212530211715 ? 3.68192089165 ? 1.5885164789 ? 7.62313565132 ? 0.511596974554 ? 0.894365972454 ? 0.557833158793 ? -1.32324139776 ? -0.0937138239767 ? -0.692005327461 ? -0.623122599932 ? 0.265425239217 ? -0.397886997179 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 7 ? A 105 A 111 ? ? ;chain 'A' and (resid 7 through 111 ) ; 2 'X-RAY DIFFRACTION' 2 A 106 A 112 ? A 219 A 225 ? ? ;chain 'A' and (resid 112 through 225 ) ; 3 'X-RAY DIFFRACTION' 3 A 220 A 226 ? A 299 A 305 ? ? ;chain 'A' and (resid 226 through 305 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0352 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 16 ? ? -160.67 35.79 2 1 ASP A 18 ? ? 57.96 -159.57 3 1 ASP A 22 ? ? -103.34 -169.11 4 1 SER A 34 ? ? -97.36 34.21 5 1 LYS A 43 ? ? -87.78 31.36 6 1 VAL A 98 ? ? -132.09 -55.29 7 1 LYS A 216 ? ? 57.13 -77.57 8 1 ASN A 234 ? ? -72.39 -73.81 9 1 ALA A 235 ? ? -139.64 -132.76 10 1 SER A 240 ? ? -122.51 -163.38 11 1 ALA A 251 ? ? -150.89 -158.50 12 1 GLU A 264 ? ? 65.53 -41.39 13 1 ASP A 286 ? ? -150.68 -141.18 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -4 ? A GLY 1 2 1 Y 1 A PRO -3 ? A PRO 2 3 1 Y 1 A LEU -2 ? A LEU 3 4 1 Y 1 A GLY -1 ? A GLY 4 5 1 Y 1 A SER 0 ? A SER 5 6 1 Y 1 A MET 1 ? A MET 6 7 1 Y 1 A ALA 2 ? A ALA 7 8 1 Y 1 A SER 3 ? A SER 8 9 1 Y 1 A GLU 4 ? A GLU 9 10 1 Y 1 A GLU 5 ? A GLU 10 11 1 Y 1 A ARG 6 ? A ARG 11 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Research Council of Norway' _pdbx_audit_support.country Norway _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code Q01C52 _pdbx_initial_refinement_model.details 'Removing the first 10 N-terminal residues' # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference 10.15151/ESRF-ES-874802477 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 21 3' _space_group.name_Hall 'P 2ac 2ab 3' _space_group.IT_number 198 _space_group.crystal_system cubic _space_group.id 1 #