data_8CT5 # _entry.id 8CT5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8CT5 pdb_00008ct5 10.2210/pdb8ct5/pdb WWPDB D_1000265399 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-02-15 2 'Structure model' 1 1 2023-03-15 3 'Structure model' 1 2 2023-10-25 4 'Structure model' 1 3 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8CT5 _pdbx_database_status.recvd_initial_deposition_date 2022-05-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email vanduyne@pennmedicine.upenn.edu _pdbx_contact_author.name_first Gregory _pdbx_contact_author.name_last 'Van Duyne' _pdbx_contact_author.name_mi D _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0247-1626 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gupta, K.' 1 0000-0002-7006-2667 'Van Duyne, G.D.' 2 0000-0003-0247-1626 'Eilers, G.' 3 0000-0001-9191-5932 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos Pathog.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1553-7374 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 19 _citation.language ? _citation.page_first e1011097 _citation.page_last e1011097 _citation.title 'Structure of a HIV-1 IN-Allosteric inhibitor complex at 2.93 angstrom resolution: Routes to inhibitor optimization.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1011097 _citation.pdbx_database_id_PubMed 36867659 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eilers, G.' 1 ? primary 'Gupta, K.' 2 0000-0002-7006-2667 primary 'Allen, A.' 3 ? primary 'Montermoso, S.' 4 ? primary 'Murali, H.' 5 ? primary 'Sharp, R.' 6 ? primary 'Hwang, Y.' 7 ? primary 'Bushman, F.D.' 8 ? primary 'Van Duyne, G.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Integrase 17894.152 1 ? F185K ? ? 2 non-polymer syn 'SULFATE ION' 96.063 4 ? ? ? ? 3 water nat water 18.015 33 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MHGQVDCSPGIWQLD(CAF)THLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTT VKAA(CAF)WWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIV DIIATDIQT ; _entity_poly.pdbx_seq_one_letter_code_can ;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ T ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 GLY n 1 4 GLN n 1 5 VAL n 1 6 ASP n 1 7 CYS n 1 8 SER n 1 9 PRO n 1 10 GLY n 1 11 ILE n 1 12 TRP n 1 13 GLN n 1 14 LEU n 1 15 ASP n 1 16 CAF n 1 17 THR n 1 18 HIS n 1 19 LEU n 1 20 GLU n 1 21 GLY n 1 22 LYS n 1 23 VAL n 1 24 ILE n 1 25 LEU n 1 26 VAL n 1 27 ALA n 1 28 VAL n 1 29 HIS n 1 30 VAL n 1 31 ALA n 1 32 SER n 1 33 GLY n 1 34 TYR n 1 35 ILE n 1 36 GLU n 1 37 ALA n 1 38 GLU n 1 39 VAL n 1 40 ILE n 1 41 PRO n 1 42 ALA n 1 43 GLU n 1 44 THR n 1 45 GLY n 1 46 GLN n 1 47 GLU n 1 48 THR n 1 49 ALA n 1 50 TYR n 1 51 PHE n 1 52 LEU n 1 53 LEU n 1 54 LYS n 1 55 LEU n 1 56 ALA n 1 57 GLY n 1 58 ARG n 1 59 TRP n 1 60 PRO n 1 61 VAL n 1 62 LYS n 1 63 THR n 1 64 VAL n 1 65 HIS n 1 66 THR n 1 67 ASP n 1 68 ASN n 1 69 GLY n 1 70 SER n 1 71 ASN n 1 72 PHE n 1 73 THR n 1 74 SER n 1 75 THR n 1 76 THR n 1 77 VAL n 1 78 LYS n 1 79 ALA n 1 80 ALA n 1 81 CAF n 1 82 TRP n 1 83 TRP n 1 84 ALA n 1 85 GLY n 1 86 ILE n 1 87 LYS n 1 88 GLN n 1 89 GLU n 1 90 PHE n 1 91 GLY n 1 92 ILE n 1 93 PRO n 1 94 TYR n 1 95 ASN n 1 96 PRO n 1 97 GLN n 1 98 SER n 1 99 GLN n 1 100 GLY n 1 101 VAL n 1 102 ILE n 1 103 GLU n 1 104 SER n 1 105 MET n 1 106 ASN n 1 107 LYS n 1 108 GLU n 1 109 LEU n 1 110 LYS n 1 111 LYS n 1 112 ILE n 1 113 ILE n 1 114 GLY n 1 115 GLN n 1 116 VAL n 1 117 ARG n 1 118 ASP n 1 119 GLN n 1 120 ALA n 1 121 GLU n 1 122 HIS n 1 123 LEU n 1 124 LYS n 1 125 THR n 1 126 ALA n 1 127 VAL n 1 128 GLN n 1 129 MET n 1 130 ALA n 1 131 VAL n 1 132 PHE n 1 133 ILE n 1 134 HIS n 1 135 ASN n 1 136 LYS n 1 137 LYS n 1 138 ARG n 1 139 LYS n 1 140 GLY n 1 141 GLY n 1 142 ILE n 1 143 GLY n 1 144 GLY n 1 145 TYR n 1 146 SER n 1 147 ALA n 1 148 GLY n 1 149 GLU n 1 150 ARG n 1 151 ILE n 1 152 VAL n 1 153 ASP n 1 154 ILE n 1 155 ILE n 1 156 ALA n 1 157 THR n 1 158 ASP n 1 159 ILE n 1 160 GLN n 1 161 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 161 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene pol _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant F185K _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET24 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CAF 'L-peptide linking' n S-DIMETHYLARSINOYL-CYSTEINE 'CYSTEIN-S-YL CACODYLATE' 'C5 H12 As N O3 S' 241.140 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 50 ? ? ? A . n A 1 2 HIS 2 51 ? ? ? A . n A 1 3 GLY 3 52 ? ? ? A . n A 1 4 GLN 4 53 ? ? ? A . n A 1 5 VAL 5 54 ? ? ? A . n A 1 6 ASP 6 55 55 ASP ASP A . n A 1 7 CYS 7 56 56 CYS CYS A . n A 1 8 SER 8 57 57 SER SER A . n A 1 9 PRO 9 58 58 PRO PRO A . n A 1 10 GLY 10 59 59 GLY GLY A . n A 1 11 ILE 11 60 60 ILE ILE A . n A 1 12 TRP 12 61 61 TRP TRP A . n A 1 13 GLN 13 62 62 GLN GLN A . n A 1 14 LEU 14 63 63 LEU LEU A . n A 1 15 ASP 15 64 64 ASP ASP A . n A 1 16 CAF 16 65 65 CAF CAF A . n A 1 17 THR 17 66 66 THR THR A . n A 1 18 HIS 18 67 67 HIS HIS A . n A 1 19 LEU 19 68 68 LEU LEU A . n A 1 20 GLU 20 69 69 GLU GLU A . n A 1 21 GLY 21 70 70 GLY GLY A . n A 1 22 LYS 22 71 71 LYS LYS A . n A 1 23 VAL 23 72 72 VAL VAL A . n A 1 24 ILE 24 73 73 ILE ILE A . n A 1 25 LEU 25 74 74 LEU LEU A . n A 1 26 VAL 26 75 75 VAL VAL A . n A 1 27 ALA 27 76 76 ALA ALA A . n A 1 28 VAL 28 77 77 VAL VAL A . n A 1 29 HIS 29 78 78 HIS HIS A . n A 1 30 VAL 30 79 79 VAL VAL A . n A 1 31 ALA 31 80 80 ALA ALA A . n A 1 32 SER 32 81 81 SER SER A . n A 1 33 GLY 33 82 82 GLY GLY A . n A 1 34 TYR 34 83 83 TYR TYR A . n A 1 35 ILE 35 84 84 ILE ILE A . n A 1 36 GLU 36 85 85 GLU GLU A . n A 1 37 ALA 37 86 86 ALA ALA A . n A 1 38 GLU 38 87 87 GLU GLU A . n A 1 39 VAL 39 88 88 VAL VAL A . n A 1 40 ILE 40 89 89 ILE ILE A . n A 1 41 PRO 41 90 90 PRO PRO A . n A 1 42 ALA 42 91 91 ALA ALA A . n A 1 43 GLU 43 92 92 GLU GLU A . n A 1 44 THR 44 93 93 THR THR A . n A 1 45 GLY 45 94 94 GLY GLY A . n A 1 46 GLN 46 95 95 GLN GLN A . n A 1 47 GLU 47 96 96 GLU GLU A . n A 1 48 THR 48 97 97 THR THR A . n A 1 49 ALA 49 98 98 ALA ALA A . n A 1 50 TYR 50 99 99 TYR TYR A . n A 1 51 PHE 51 100 100 PHE PHE A . n A 1 52 LEU 52 101 101 LEU LEU A . n A 1 53 LEU 53 102 102 LEU LEU A . n A 1 54 LYS 54 103 103 LYS LYS A . n A 1 55 LEU 55 104 104 LEU LEU A . n A 1 56 ALA 56 105 105 ALA ALA A . n A 1 57 GLY 57 106 106 GLY GLY A . n A 1 58 ARG 58 107 107 ARG ARG A . n A 1 59 TRP 59 108 108 TRP TRP A . n A 1 60 PRO 60 109 109 PRO PRO A . n A 1 61 VAL 61 110 110 VAL VAL A . n A 1 62 LYS 62 111 111 LYS LYS A . n A 1 63 THR 63 112 112 THR THR A . n A 1 64 VAL 64 113 113 VAL VAL A . n A 1 65 HIS 65 114 114 HIS HIS A . n A 1 66 THR 66 115 115 THR THR A . n A 1 67 ASP 67 116 116 ASP ASP A . n A 1 68 ASN 68 117 117 ASN ASN A . n A 1 69 GLY 69 118 118 GLY GLY A . n A 1 70 SER 70 119 119 SER SER A . n A 1 71 ASN 71 120 120 ASN ASN A . n A 1 72 PHE 72 121 121 PHE PHE A . n A 1 73 THR 73 122 122 THR THR A . n A 1 74 SER 74 123 123 SER SER A . n A 1 75 THR 75 124 124 THR THR A . n A 1 76 THR 76 125 125 THR THR A . n A 1 77 VAL 77 126 126 VAL VAL A . n A 1 78 LYS 78 127 127 LYS LYS A . n A 1 79 ALA 79 128 128 ALA ALA A . n A 1 80 ALA 80 129 129 ALA ALA A . n A 1 81 CAF 81 130 130 CAF CAF A . n A 1 82 TRP 82 131 131 TRP TRP A . n A 1 83 TRP 83 132 132 TRP TRP A . n A 1 84 ALA 84 133 133 ALA ALA A . n A 1 85 GLY 85 134 134 GLY GLY A . n A 1 86 ILE 86 135 135 ILE ILE A . n A 1 87 LYS 87 136 136 LYS LYS A . n A 1 88 GLN 88 137 137 GLN GLN A . n A 1 89 GLU 89 138 138 GLU GLU A . n A 1 90 PHE 90 139 139 PHE PHE A . n A 1 91 GLY 91 140 140 GLY GLY A . n A 1 92 ILE 92 141 141 ILE ILE A . n A 1 93 PRO 93 142 142 PRO PRO A . n A 1 94 TYR 94 143 ? ? ? A . n A 1 95 ASN 95 144 ? ? ? A . n A 1 96 PRO 96 145 ? ? ? A . n A 1 97 GLN 97 146 ? ? ? A . n A 1 98 SER 98 147 ? ? ? A . n A 1 99 GLN 99 148 ? ? ? A . n A 1 100 GLY 100 149 149 GLY GLY A . n A 1 101 VAL 101 150 150 VAL VAL A . n A 1 102 ILE 102 151 151 ILE ILE A . n A 1 103 GLU 103 152 152 GLU GLU A . n A 1 104 SER 104 153 153 SER SER A . n A 1 105 MET 105 154 154 MET MET A . n A 1 106 ASN 106 155 155 ASN ASN A . n A 1 107 LYS 107 156 156 LYS LYS A . n A 1 108 GLU 108 157 157 GLU GLU A . n A 1 109 LEU 109 158 158 LEU LEU A . n A 1 110 LYS 110 159 159 LYS LYS A . n A 1 111 LYS 111 160 160 LYS LYS A . n A 1 112 ILE 112 161 161 ILE ILE A . n A 1 113 ILE 113 162 162 ILE ILE A . n A 1 114 GLY 114 163 163 GLY GLY A . n A 1 115 GLN 115 164 164 GLN GLN A . n A 1 116 VAL 116 165 165 VAL VAL A . n A 1 117 ARG 117 166 166 ARG ARG A . n A 1 118 ASP 118 167 167 ASP ASP A . n A 1 119 GLN 119 168 168 GLN GLN A . n A 1 120 ALA 120 169 169 ALA ALA A . n A 1 121 GLU 121 170 170 GLU GLU A . n A 1 122 HIS 122 171 171 HIS HIS A . n A 1 123 LEU 123 172 172 LEU LEU A . n A 1 124 LYS 124 173 173 LYS LYS A . n A 1 125 THR 125 174 174 THR THR A . n A 1 126 ALA 126 175 175 ALA ALA A . n A 1 127 VAL 127 176 176 VAL VAL A . n A 1 128 GLN 128 177 177 GLN GLN A . n A 1 129 MET 129 178 178 MET MET A . n A 1 130 ALA 130 179 179 ALA ALA A . n A 1 131 VAL 131 180 180 VAL VAL A . n A 1 132 PHE 132 181 181 PHE PHE A . n A 1 133 ILE 133 182 182 ILE ILE A . n A 1 134 HIS 134 183 183 HIS HIS A . n A 1 135 ASN 135 184 184 ASN ASN A . n A 1 136 LYS 136 185 185 LYS LYS A . n A 1 137 LYS 137 186 186 LYS LYS A . n A 1 138 ARG 138 187 187 ARG ARG A . n A 1 139 LYS 139 188 ? ? ? A . n A 1 140 GLY 140 189 ? ? ? A . n A 1 141 GLY 141 190 ? ? ? A . n A 1 142 ILE 142 191 ? ? ? A . n A 1 143 GLY 143 192 ? ? ? A . n A 1 144 GLY 144 193 193 GLY GLY A . n A 1 145 TYR 145 194 194 TYR TYR A . n A 1 146 SER 146 195 195 SER SER A . n A 1 147 ALA 147 196 196 ALA ALA A . n A 1 148 GLY 148 197 197 GLY GLY A . n A 1 149 GLU 149 198 198 GLU GLU A . n A 1 150 ARG 150 199 199 ARG ARG A . n A 1 151 ILE 151 200 200 ILE ILE A . n A 1 152 VAL 152 201 201 VAL VAL A . n A 1 153 ASP 153 202 202 ASP ASP A . n A 1 154 ILE 154 203 203 ILE ILE A . n A 1 155 ILE 155 204 204 ILE ILE A . n A 1 156 ALA 156 205 205 ALA ALA A . n A 1 157 THR 157 206 206 THR THR A . n A 1 158 ASP 158 207 207 ASP ASP A . n A 1 159 ILE 159 208 208 ILE ILE A . n A 1 160 GLN 160 209 ? ? ? A . n A 1 161 THR 161 210 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 302 SO4 SO4 A . C 2 SO4 1 302 303 SO4 SO4 A . D 2 SO4 1 303 1 SO4 SO4 A . E 2 SO4 1 304 2 SO4 SO4 A . F 3 HOH 1 401 32 HOH HOH A . F 3 HOH 2 402 18 HOH HOH A . F 3 HOH 3 403 15 HOH HOH A . F 3 HOH 4 404 30 HOH HOH A . F 3 HOH 5 405 1 HOH HOH A . F 3 HOH 6 406 12 HOH HOH A . F 3 HOH 7 407 36 HOH HOH A . F 3 HOH 8 408 19 HOH HOH A . F 3 HOH 9 409 34 HOH HOH A . F 3 HOH 10 410 14 HOH HOH A . F 3 HOH 11 411 21 HOH HOH A . F 3 HOH 12 412 7 HOH HOH A . F 3 HOH 13 413 2 HOH HOH A . F 3 HOH 14 414 10 HOH HOH A . F 3 HOH 15 415 4 HOH HOH A . F 3 HOH 16 416 13 HOH HOH A . F 3 HOH 17 417 3 HOH HOH A . F 3 HOH 18 418 40 HOH HOH A . F 3 HOH 19 419 9 HOH HOH A . F 3 HOH 20 420 5 HOH HOH A . F 3 HOH 21 421 8 HOH HOH A . F 3 HOH 22 422 11 HOH HOH A . F 3 HOH 23 423 35 HOH HOH A . F 3 HOH 24 424 37 HOH HOH A . F 3 HOH 25 425 16 HOH HOH A . F 3 HOH 26 426 6 HOH HOH A . F 3 HOH 27 427 20 HOH HOH A . F 3 HOH 28 428 17 HOH HOH A . F 3 HOH 29 429 43 HOH HOH A . F 3 HOH 30 430 26 HOH HOH A . F 3 HOH 31 431 31 HOH HOH A . F 3 HOH 32 432 27 HOH HOH A . F 3 HOH 33 433 24 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A CAF 65 ? CE2 ? A CAF 16 CE2 2 1 Y 1 A CAF 130 ? CE2 ? A CAF 81 CE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.0 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 8CT5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 72.973 _cell.length_a_esd ? _cell.length_b 72.973 _cell.length_b_esd ? _cell.length_c 66.097 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8CT5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8CT5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.68 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;7% PEG 8000, 0.2 M ammonium sulfate, 0.1 M sodium cacodylate, pH 6.5, 5 mM manganese chloride, 5 mM magnesium chloride, and 5 mM DTT ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-10-13 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CHESS BEAMLINE A1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline A1 _diffrn_source.pdbx_synchrotron_site CHESS # _reflns.B_iso_Wilson_estimate 37.8 _reflns.entry_id 8CT5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.97 _reflns.d_resolution_low 29.30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14661 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.026 _reflns.pdbx_Rpim_I_all 0.018 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half .999 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.018 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.97 _reflns_shell.d_res_low 2.044 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1422 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.0 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.213 _reflns_shell.pdbx_Rpim_I_all 0.151 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.942 _reflns_shell.pdbx_CC_star 0.985 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.8 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.151 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.12 _refine.aniso_B[1][2] -0.06 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.12 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.40 _refine.B_iso_max ? _refine.B_iso_mean 50.797 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8CT5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.97 _refine.ls_d_res_low 29.30 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13200 _refine.ls_number_reflns_R_free 1460 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.80 _refine.ls_percent_reflns_R_free 10.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20435 _refine.ls_R_factor_R_free 0.23648 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20069 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3L3U _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.152 _refine.pdbx_overall_ESU_R_Free 0.144 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.454 _refine.overall_SU_ML 0.089 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.97 _refine_hist.d_res_low 29.30 _refine_hist.number_atoms_solvent 33 _refine_hist.number_atoms_total 1166 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1113 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _struct.entry_id 8CT5 _struct.title 'Catalytic Core Domain of HIV-1 Integrase (F185K)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8CT5 _struct_keywords.text 'VIRAL DNA INTEGRATION, DNA BINDING, LEDGF BINDING, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q72498_9HIV1 _struct_ref.pdbx_db_accession Q72498 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQ T ; _struct_ref.pdbx_align_begin 765 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8CT5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 161 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q72498 _struct_ref_seq.db_align_beg 765 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 925 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 50 _struct_ref_seq.pdbx_auth_seq_align_end 210 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8CT5 _struct_ref_seq_dif.mon_id LYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 136 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q72498 _struct_ref_seq_dif.db_mon_id PHE _struct_ref_seq_dif.pdbx_seq_db_seq_num 900 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 185 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4320 ? 1 MORE -128 ? 1 'SSA (A^2)' 13380 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'equilibrium centrifugation' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 44.0646666667 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 44 ? TRP A 59 ? THR A 93 TRP A 108 1 ? 16 HELX_P HELX_P2 AA2 ASN A 68 ? THR A 73 ? ASN A 117 THR A 122 5 ? 6 HELX_P HELX_P3 AA3 SER A 74 ? GLY A 85 ? SER A 123 GLY A 134 1 ? 12 HELX_P HELX_P4 AA4 ILE A 102 ? ARG A 117 ? ILE A 151 ARG A 166 1 ? 16 HELX_P HELX_P5 AA5 ASP A 118 ? ALA A 120 ? ASP A 167 ALA A 169 5 ? 3 HELX_P HELX_P6 AA6 HIS A 122 ? LYS A 137 ? HIS A 171 LYS A 186 1 ? 16 HELX_P HELX_P7 AA7 SER A 146 ? ASP A 158 ? SER A 195 ASP A 207 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 15 C ? ? ? 1_555 A CAF 16 N ? ? A ASP 64 A CAF 65 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale2 covale both ? A CAF 16 C ? ? ? 1_555 A THR 17 N ? ? A CAF 65 A THR 66 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale3 covale both ? A ALA 80 C ? ? ? 1_555 A CAF 81 N ? ? A ALA 129 A CAF 130 1_555 ? ? ? ? ? ? ? 1.350 ? ? covale4 covale both ? A CAF 81 C ? ? ? 1_555 A TRP 82 N ? ? A CAF 130 A TRP 131 1_555 ? ? ? ? ? ? ? 1.336 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CAF A 16 ? . . . . CAF A 65 ? 1_555 . . . . . . . CYS 1 CAF None 'Non-standard residue' 2 CAF A 81 ? . . . . CAF A 130 ? 1_555 . . . . . . . CYS 1 CAF None 'Non-standard residue' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 35 ? ILE A 40 ? ILE A 84 ILE A 89 AA1 2 LYS A 22 ? HIS A 29 ? LYS A 71 HIS A 78 AA1 3 ILE A 11 ? LEU A 19 ? ILE A 60 LEU A 68 AA1 4 THR A 63 ? HIS A 65 ? THR A 112 HIS A 114 AA1 5 LYS A 87 ? GLN A 88 ? LYS A 136 GLN A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 36 ? O GLU A 85 N ALA A 27 ? N ALA A 76 AA1 2 3 O ILE A 24 ? O ILE A 73 N THR A 17 ? N THR A 66 AA1 3 4 N LEU A 14 ? N LEU A 63 O HIS A 65 ? O HIS A 114 AA1 4 5 N VAL A 64 ? N VAL A 113 O LYS A 87 ? O LYS A 136 # _pdbx_entry_details.entry_id 8CT5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 107 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.140 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CAF 16 A CAF 65 ? CYS 'modified residue' 2 A CAF 81 A CAF 130 ? CYS 'modified residue' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+1/3 3 -x+y,-x,z+2/3 4 x-y,-y,-z+2/3 5 -x,-x+y,-z+1/3 6 y,x,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 50 ? A MET 1 2 1 Y 1 A HIS 51 ? A HIS 2 3 1 Y 1 A GLY 52 ? A GLY 3 4 1 Y 1 A GLN 53 ? A GLN 4 5 1 Y 1 A VAL 54 ? A VAL 5 6 1 Y 1 A TYR 143 ? A TYR 94 7 1 Y 1 A ASN 144 ? A ASN 95 8 1 Y 1 A PRO 145 ? A PRO 96 9 1 Y 1 A GLN 146 ? A GLN 97 10 1 Y 1 A SER 147 ? A SER 98 11 1 Y 1 A GLN 148 ? A GLN 99 12 1 Y 1 A LYS 188 ? A LYS 139 13 1 Y 1 A GLY 189 ? A GLY 140 14 1 Y 1 A GLY 190 ? A GLY 141 15 1 Y 1 A ILE 191 ? A ILE 142 16 1 Y 1 A GLY 192 ? A GLY 143 17 1 Y 1 A GLN 209 ? A GLN 160 18 1 Y 1 A THR 210 ? A THR 161 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CAF N N N N 74 CAF CA C N R 75 CAF CB C N N 76 CAF C C N N 77 CAF O O N N 78 CAF OXT O N N 79 CAF SG S N N 80 CAF AS AS N N 81 CAF CE1 C N N 82 CAF CE2 C N N 83 CAF O1 O N N 84 CAF H H N N 85 CAF H2 H N N 86 CAF HA H N N 87 CAF HB2 H N N 88 CAF HB3 H N N 89 CAF HXT H N N 90 CAF HE11 H N N 91 CAF HE12 H N N 92 CAF HE13 H N N 93 CAF HE21 H N N 94 CAF HE22 H N N 95 CAF HE23 H N N 96 CYS N N N N 97 CYS CA C N R 98 CYS C C N N 99 CYS O O N N 100 CYS CB C N N 101 CYS SG S N N 102 CYS OXT O N N 103 CYS H H N N 104 CYS H2 H N N 105 CYS HA H N N 106 CYS HB2 H N N 107 CYS HB3 H N N 108 CYS HG H N N 109 CYS HXT H N N 110 GLN N N N N 111 GLN CA C N S 112 GLN C C N N 113 GLN O O N N 114 GLN CB C N N 115 GLN CG C N N 116 GLN CD C N N 117 GLN OE1 O N N 118 GLN NE2 N N N 119 GLN OXT O N N 120 GLN H H N N 121 GLN H2 H N N 122 GLN HA H N N 123 GLN HB2 H N N 124 GLN HB3 H N N 125 GLN HG2 H N N 126 GLN HG3 H N N 127 GLN HE21 H N N 128 GLN HE22 H N N 129 GLN HXT H N N 130 GLU N N N N 131 GLU CA C N S 132 GLU C C N N 133 GLU O O N N 134 GLU CB C N N 135 GLU CG C N N 136 GLU CD C N N 137 GLU OE1 O N N 138 GLU OE2 O N N 139 GLU OXT O N N 140 GLU H H N N 141 GLU H2 H N N 142 GLU HA H N N 143 GLU HB2 H N N 144 GLU HB3 H N N 145 GLU HG2 H N N 146 GLU HG3 H N N 147 GLU HE2 H N N 148 GLU HXT H N N 149 GLY N N N N 150 GLY CA C N N 151 GLY C C N N 152 GLY O O N N 153 GLY OXT O N N 154 GLY H H N N 155 GLY H2 H N N 156 GLY HA2 H N N 157 GLY HA3 H N N 158 GLY HXT H N N 159 HIS N N N N 160 HIS CA C N S 161 HIS C C N N 162 HIS O O N N 163 HIS CB C N N 164 HIS CG C Y N 165 HIS ND1 N Y N 166 HIS CD2 C Y N 167 HIS CE1 C Y N 168 HIS NE2 N Y N 169 HIS OXT O N N 170 HIS H H N N 171 HIS H2 H N N 172 HIS HA H N N 173 HIS HB2 H N N 174 HIS HB3 H N N 175 HIS HD1 H N N 176 HIS HD2 H N N 177 HIS HE1 H N N 178 HIS HE2 H N N 179 HIS HXT H N N 180 HOH O O N N 181 HOH H1 H N N 182 HOH H2 H N N 183 ILE N N N N 184 ILE CA C N S 185 ILE C C N N 186 ILE O O N N 187 ILE CB C N S 188 ILE CG1 C N N 189 ILE CG2 C N N 190 ILE CD1 C N N 191 ILE OXT O N N 192 ILE H H N N 193 ILE H2 H N N 194 ILE HA H N N 195 ILE HB H N N 196 ILE HG12 H N N 197 ILE HG13 H N N 198 ILE HG21 H N N 199 ILE HG22 H N N 200 ILE HG23 H N N 201 ILE HD11 H N N 202 ILE HD12 H N N 203 ILE HD13 H N N 204 ILE HXT H N N 205 LEU N N N N 206 LEU CA C N S 207 LEU C C N N 208 LEU O O N N 209 LEU CB C N N 210 LEU CG C N N 211 LEU CD1 C N N 212 LEU CD2 C N N 213 LEU OXT O N N 214 LEU H H N N 215 LEU H2 H N N 216 LEU HA H N N 217 LEU HB2 H N N 218 LEU HB3 H N N 219 LEU HG H N N 220 LEU HD11 H N N 221 LEU HD12 H N N 222 LEU HD13 H N N 223 LEU HD21 H N N 224 LEU HD22 H N N 225 LEU HD23 H N N 226 LEU HXT H N N 227 LYS N N N N 228 LYS CA C N S 229 LYS C C N N 230 LYS O O N N 231 LYS CB C N N 232 LYS CG C N N 233 LYS CD C N N 234 LYS CE C N N 235 LYS NZ N N N 236 LYS OXT O N N 237 LYS H H N N 238 LYS H2 H N N 239 LYS HA H N N 240 LYS HB2 H N N 241 LYS HB3 H N N 242 LYS HG2 H N N 243 LYS HG3 H N N 244 LYS HD2 H N N 245 LYS HD3 H N N 246 LYS HE2 H N N 247 LYS HE3 H N N 248 LYS HZ1 H N N 249 LYS HZ2 H N N 250 LYS HZ3 H N N 251 LYS HXT H N N 252 MET N N N N 253 MET CA C N S 254 MET C C N N 255 MET O O N N 256 MET CB C N N 257 MET CG C N N 258 MET SD S N N 259 MET CE C N N 260 MET OXT O N N 261 MET H H N N 262 MET H2 H N N 263 MET HA H N N 264 MET HB2 H N N 265 MET HB3 H N N 266 MET HG2 H N N 267 MET HG3 H N N 268 MET HE1 H N N 269 MET HE2 H N N 270 MET HE3 H N N 271 MET HXT H N N 272 PHE N N N N 273 PHE CA C N S 274 PHE C C N N 275 PHE O O N N 276 PHE CB C N N 277 PHE CG C Y N 278 PHE CD1 C Y N 279 PHE CD2 C Y N 280 PHE CE1 C Y N 281 PHE CE2 C Y N 282 PHE CZ C Y N 283 PHE OXT O N N 284 PHE H H N N 285 PHE H2 H N N 286 PHE HA H N N 287 PHE HB2 H N N 288 PHE HB3 H N N 289 PHE HD1 H N N 290 PHE HD2 H N N 291 PHE HE1 H N N 292 PHE HE2 H N N 293 PHE HZ H N N 294 PHE HXT H N N 295 PRO N N N N 296 PRO CA C N S 297 PRO C C N N 298 PRO O O N N 299 PRO CB C N N 300 PRO CG C N N 301 PRO CD C N N 302 PRO OXT O N N 303 PRO H H N N 304 PRO HA H N N 305 PRO HB2 H N N 306 PRO HB3 H N N 307 PRO HG2 H N N 308 PRO HG3 H N N 309 PRO HD2 H N N 310 PRO HD3 H N N 311 PRO HXT H N N 312 SER N N N N 313 SER CA C N S 314 SER C C N N 315 SER O O N N 316 SER CB C N N 317 SER OG O N N 318 SER OXT O N N 319 SER H H N N 320 SER H2 H N N 321 SER HA H N N 322 SER HB2 H N N 323 SER HB3 H N N 324 SER HG H N N 325 SER HXT H N N 326 SO4 S S N N 327 SO4 O1 O N N 328 SO4 O2 O N N 329 SO4 O3 O N N 330 SO4 O4 O N N 331 THR N N N N 332 THR CA C N S 333 THR C C N N 334 THR O O N N 335 THR CB C N R 336 THR OG1 O N N 337 THR CG2 C N N 338 THR OXT O N N 339 THR H H N N 340 THR H2 H N N 341 THR HA H N N 342 THR HB H N N 343 THR HG1 H N N 344 THR HG21 H N N 345 THR HG22 H N N 346 THR HG23 H N N 347 THR HXT H N N 348 TRP N N N N 349 TRP CA C N S 350 TRP C C N N 351 TRP O O N N 352 TRP CB C N N 353 TRP CG C Y N 354 TRP CD1 C Y N 355 TRP CD2 C Y N 356 TRP NE1 N Y N 357 TRP CE2 C Y N 358 TRP CE3 C Y N 359 TRP CZ2 C Y N 360 TRP CZ3 C Y N 361 TRP CH2 C Y N 362 TRP OXT O N N 363 TRP H H N N 364 TRP H2 H N N 365 TRP HA H N N 366 TRP HB2 H N N 367 TRP HB3 H N N 368 TRP HD1 H N N 369 TRP HE1 H N N 370 TRP HE3 H N N 371 TRP HZ2 H N N 372 TRP HZ3 H N N 373 TRP HH2 H N N 374 TRP HXT H N N 375 TYR N N N N 376 TYR CA C N S 377 TYR C C N N 378 TYR O O N N 379 TYR CB C N N 380 TYR CG C Y N 381 TYR CD1 C Y N 382 TYR CD2 C Y N 383 TYR CE1 C Y N 384 TYR CE2 C Y N 385 TYR CZ C Y N 386 TYR OH O N N 387 TYR OXT O N N 388 TYR H H N N 389 TYR H2 H N N 390 TYR HA H N N 391 TYR HB2 H N N 392 TYR HB3 H N N 393 TYR HD1 H N N 394 TYR HD2 H N N 395 TYR HE1 H N N 396 TYR HE2 H N N 397 TYR HH H N N 398 TYR HXT H N N 399 VAL N N N N 400 VAL CA C N S 401 VAL C C N N 402 VAL O O N N 403 VAL CB C N N 404 VAL CG1 C N N 405 VAL CG2 C N N 406 VAL OXT O N N 407 VAL H H N N 408 VAL H2 H N N 409 VAL HA H N N 410 VAL HB H N N 411 VAL HG11 H N N 412 VAL HG12 H N N 413 VAL HG13 H N N 414 VAL HG21 H N N 415 VAL HG22 H N N 416 VAL HG23 H N N 417 VAL HXT H N N 418 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CAF N CA sing N N 70 CAF N H sing N N 71 CAF N H2 sing N N 72 CAF CA CB sing N N 73 CAF CA C sing N N 74 CAF CA HA sing N N 75 CAF CB SG sing N N 76 CAF CB HB2 sing N N 77 CAF CB HB3 sing N N 78 CAF C O doub N N 79 CAF C OXT sing N N 80 CAF OXT HXT sing N N 81 CAF SG AS sing N N 82 CAF AS CE1 sing N N 83 CAF AS CE2 sing N N 84 CAF AS O1 doub N N 85 CAF CE1 HE11 sing N N 86 CAF CE1 HE12 sing N N 87 CAF CE1 HE13 sing N N 88 CAF CE2 HE21 sing N N 89 CAF CE2 HE22 sing N N 90 CAF CE2 HE23 sing N N 91 CYS N CA sing N N 92 CYS N H sing N N 93 CYS N H2 sing N N 94 CYS CA C sing N N 95 CYS CA CB sing N N 96 CYS CA HA sing N N 97 CYS C O doub N N 98 CYS C OXT sing N N 99 CYS CB SG sing N N 100 CYS CB HB2 sing N N 101 CYS CB HB3 sing N N 102 CYS SG HG sing N N 103 CYS OXT HXT sing N N 104 GLN N CA sing N N 105 GLN N H sing N N 106 GLN N H2 sing N N 107 GLN CA C sing N N 108 GLN CA CB sing N N 109 GLN CA HA sing N N 110 GLN C O doub N N 111 GLN C OXT sing N N 112 GLN CB CG sing N N 113 GLN CB HB2 sing N N 114 GLN CB HB3 sing N N 115 GLN CG CD sing N N 116 GLN CG HG2 sing N N 117 GLN CG HG3 sing N N 118 GLN CD OE1 doub N N 119 GLN CD NE2 sing N N 120 GLN NE2 HE21 sing N N 121 GLN NE2 HE22 sing N N 122 GLN OXT HXT sing N N 123 GLU N CA sing N N 124 GLU N H sing N N 125 GLU N H2 sing N N 126 GLU CA C sing N N 127 GLU CA CB sing N N 128 GLU CA HA sing N N 129 GLU C O doub N N 130 GLU C OXT sing N N 131 GLU CB CG sing N N 132 GLU CB HB2 sing N N 133 GLU CB HB3 sing N N 134 GLU CG CD sing N N 135 GLU CG HG2 sing N N 136 GLU CG HG3 sing N N 137 GLU CD OE1 doub N N 138 GLU CD OE2 sing N N 139 GLU OE2 HE2 sing N N 140 GLU OXT HXT sing N N 141 GLY N CA sing N N 142 GLY N H sing N N 143 GLY N H2 sing N N 144 GLY CA C sing N N 145 GLY CA HA2 sing N N 146 GLY CA HA3 sing N N 147 GLY C O doub N N 148 GLY C OXT sing N N 149 GLY OXT HXT sing N N 150 HIS N CA sing N N 151 HIS N H sing N N 152 HIS N H2 sing N N 153 HIS CA C sing N N 154 HIS CA CB sing N N 155 HIS CA HA sing N N 156 HIS C O doub N N 157 HIS C OXT sing N N 158 HIS CB CG sing N N 159 HIS CB HB2 sing N N 160 HIS CB HB3 sing N N 161 HIS CG ND1 sing Y N 162 HIS CG CD2 doub Y N 163 HIS ND1 CE1 doub Y N 164 HIS ND1 HD1 sing N N 165 HIS CD2 NE2 sing Y N 166 HIS CD2 HD2 sing N N 167 HIS CE1 NE2 sing Y N 168 HIS CE1 HE1 sing N N 169 HIS NE2 HE2 sing N N 170 HIS OXT HXT sing N N 171 HOH O H1 sing N N 172 HOH O H2 sing N N 173 ILE N CA sing N N 174 ILE N H sing N N 175 ILE N H2 sing N N 176 ILE CA C sing N N 177 ILE CA CB sing N N 178 ILE CA HA sing N N 179 ILE C O doub N N 180 ILE C OXT sing N N 181 ILE CB CG1 sing N N 182 ILE CB CG2 sing N N 183 ILE CB HB sing N N 184 ILE CG1 CD1 sing N N 185 ILE CG1 HG12 sing N N 186 ILE CG1 HG13 sing N N 187 ILE CG2 HG21 sing N N 188 ILE CG2 HG22 sing N N 189 ILE CG2 HG23 sing N N 190 ILE CD1 HD11 sing N N 191 ILE CD1 HD12 sing N N 192 ILE CD1 HD13 sing N N 193 ILE OXT HXT sing N N 194 LEU N CA sing N N 195 LEU N H sing N N 196 LEU N H2 sing N N 197 LEU CA C sing N N 198 LEU CA CB sing N N 199 LEU CA HA sing N N 200 LEU C O doub N N 201 LEU C OXT sing N N 202 LEU CB CG sing N N 203 LEU CB HB2 sing N N 204 LEU CB HB3 sing N N 205 LEU CG CD1 sing N N 206 LEU CG CD2 sing N N 207 LEU CG HG sing N N 208 LEU CD1 HD11 sing N N 209 LEU CD1 HD12 sing N N 210 LEU CD1 HD13 sing N N 211 LEU CD2 HD21 sing N N 212 LEU CD2 HD22 sing N N 213 LEU CD2 HD23 sing N N 214 LEU OXT HXT sing N N 215 LYS N CA sing N N 216 LYS N H sing N N 217 LYS N H2 sing N N 218 LYS CA C sing N N 219 LYS CA CB sing N N 220 LYS CA HA sing N N 221 LYS C O doub N N 222 LYS C OXT sing N N 223 LYS CB CG sing N N 224 LYS CB HB2 sing N N 225 LYS CB HB3 sing N N 226 LYS CG CD sing N N 227 LYS CG HG2 sing N N 228 LYS CG HG3 sing N N 229 LYS CD CE sing N N 230 LYS CD HD2 sing N N 231 LYS CD HD3 sing N N 232 LYS CE NZ sing N N 233 LYS CE HE2 sing N N 234 LYS CE HE3 sing N N 235 LYS NZ HZ1 sing N N 236 LYS NZ HZ2 sing N N 237 LYS NZ HZ3 sing N N 238 LYS OXT HXT sing N N 239 MET N CA sing N N 240 MET N H sing N N 241 MET N H2 sing N N 242 MET CA C sing N N 243 MET CA CB sing N N 244 MET CA HA sing N N 245 MET C O doub N N 246 MET C OXT sing N N 247 MET CB CG sing N N 248 MET CB HB2 sing N N 249 MET CB HB3 sing N N 250 MET CG SD sing N N 251 MET CG HG2 sing N N 252 MET CG HG3 sing N N 253 MET SD CE sing N N 254 MET CE HE1 sing N N 255 MET CE HE2 sing N N 256 MET CE HE3 sing N N 257 MET OXT HXT sing N N 258 PHE N CA sing N N 259 PHE N H sing N N 260 PHE N H2 sing N N 261 PHE CA C sing N N 262 PHE CA CB sing N N 263 PHE CA HA sing N N 264 PHE C O doub N N 265 PHE C OXT sing N N 266 PHE CB CG sing N N 267 PHE CB HB2 sing N N 268 PHE CB HB3 sing N N 269 PHE CG CD1 doub Y N 270 PHE CG CD2 sing Y N 271 PHE CD1 CE1 sing Y N 272 PHE CD1 HD1 sing N N 273 PHE CD2 CE2 doub Y N 274 PHE CD2 HD2 sing N N 275 PHE CE1 CZ doub Y N 276 PHE CE1 HE1 sing N N 277 PHE CE2 CZ sing Y N 278 PHE CE2 HE2 sing N N 279 PHE CZ HZ sing N N 280 PHE OXT HXT sing N N 281 PRO N CA sing N N 282 PRO N CD sing N N 283 PRO N H sing N N 284 PRO CA C sing N N 285 PRO CA CB sing N N 286 PRO CA HA sing N N 287 PRO C O doub N N 288 PRO C OXT sing N N 289 PRO CB CG sing N N 290 PRO CB HB2 sing N N 291 PRO CB HB3 sing N N 292 PRO CG CD sing N N 293 PRO CG HG2 sing N N 294 PRO CG HG3 sing N N 295 PRO CD HD2 sing N N 296 PRO CD HD3 sing N N 297 PRO OXT HXT sing N N 298 SER N CA sing N N 299 SER N H sing N N 300 SER N H2 sing N N 301 SER CA C sing N N 302 SER CA CB sing N N 303 SER CA HA sing N N 304 SER C O doub N N 305 SER C OXT sing N N 306 SER CB OG sing N N 307 SER CB HB2 sing N N 308 SER CB HB3 sing N N 309 SER OG HG sing N N 310 SER OXT HXT sing N N 311 SO4 S O1 doub N N 312 SO4 S O2 doub N N 313 SO4 S O3 sing N N 314 SO4 S O4 sing N N 315 THR N CA sing N N 316 THR N H sing N N 317 THR N H2 sing N N 318 THR CA C sing N N 319 THR CA CB sing N N 320 THR CA HA sing N N 321 THR C O doub N N 322 THR C OXT sing N N 323 THR CB OG1 sing N N 324 THR CB CG2 sing N N 325 THR CB HB sing N N 326 THR OG1 HG1 sing N N 327 THR CG2 HG21 sing N N 328 THR CG2 HG22 sing N N 329 THR CG2 HG23 sing N N 330 THR OXT HXT sing N N 331 TRP N CA sing N N 332 TRP N H sing N N 333 TRP N H2 sing N N 334 TRP CA C sing N N 335 TRP CA CB sing N N 336 TRP CA HA sing N N 337 TRP C O doub N N 338 TRP C OXT sing N N 339 TRP CB CG sing N N 340 TRP CB HB2 sing N N 341 TRP CB HB3 sing N N 342 TRP CG CD1 doub Y N 343 TRP CG CD2 sing Y N 344 TRP CD1 NE1 sing Y N 345 TRP CD1 HD1 sing N N 346 TRP CD2 CE2 doub Y N 347 TRP CD2 CE3 sing Y N 348 TRP NE1 CE2 sing Y N 349 TRP NE1 HE1 sing N N 350 TRP CE2 CZ2 sing Y N 351 TRP CE3 CZ3 doub Y N 352 TRP CE3 HE3 sing N N 353 TRP CZ2 CH2 doub Y N 354 TRP CZ2 HZ2 sing N N 355 TRP CZ3 CH2 sing Y N 356 TRP CZ3 HZ3 sing N N 357 TRP CH2 HH2 sing N N 358 TRP OXT HXT sing N N 359 TYR N CA sing N N 360 TYR N H sing N N 361 TYR N H2 sing N N 362 TYR CA C sing N N 363 TYR CA CB sing N N 364 TYR CA HA sing N N 365 TYR C O doub N N 366 TYR C OXT sing N N 367 TYR CB CG sing N N 368 TYR CB HB2 sing N N 369 TYR CB HB3 sing N N 370 TYR CG CD1 doub Y N 371 TYR CG CD2 sing Y N 372 TYR CD1 CE1 sing Y N 373 TYR CD1 HD1 sing N N 374 TYR CD2 CE2 doub Y N 375 TYR CD2 HD2 sing N N 376 TYR CE1 CZ doub Y N 377 TYR CE1 HE1 sing N N 378 TYR CE2 CZ sing Y N 379 TYR CE2 HE2 sing N N 380 TYR CZ OH sing N N 381 TYR OH HH sing N N 382 TYR OXT HXT sing N N 383 VAL N CA sing N N 384 VAL N H sing N N 385 VAL N H2 sing N N 386 VAL CA C sing N N 387 VAL CA CB sing N N 388 VAL CA HA sing N N 389 VAL C O doub N N 390 VAL C OXT sing N N 391 VAL CB CG1 sing N N 392 VAL CB CG2 sing N N 393 VAL CB HB sing N N 394 VAL CG1 HG11 sing N N 395 VAL CG1 HG12 sing N N 396 VAL CG1 HG13 sing N N 397 VAL CG2 HG21 sing N N 398 VAL CG2 HG22 sing N N 399 VAL CG2 HG23 sing N N 400 VAL OXT HXT sing N N 401 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R01 AI 052845' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 3LPU ? 2 ? 'experimental model' PDB 3L3U ? # _space_group.crystal_system trigonal _space_group.name_H-M_alt 'P 31 2 1' _space_group.IT_number 152 _space_group.name_Hall ;P 31 2" ; _space_group.id 1 # _atom_sites.entry_id 8CT5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013704 _atom_sites.fract_transf_matrix[1][2] 0.007912 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015824 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015129 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol AS C H N O S # loop_