data_8DIJ # _entry.id 8DIJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8DIJ pdb_00008dij 10.2210/pdb8dij/pdb WWPDB D_1000264744 ? ? BMRB 31031 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'X-ray crystal structure of the same protein' 4OZB unspecified BMRB 'NMR Structure of Streptococcal Protein GB1 Backbone Modified Variant: beta-ACPC24, beta-3-Lys28, beta-3-Lys31, beta-ACPC35' 31031 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8DIJ _pdbx_database_status.recvd_initial_deposition_date 2022-06-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rao, S.R.' 1 ? 'Reinert, Z.E.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Pept Sci (Hoboken)' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2475-8817 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 115 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Chemical Shifts of Artificial Monomers Used to Construct Heterogeneous-Backbone Protein Mimetics in Random Coil and Folded States.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pep2.24297 _citation.pdbx_database_id_PubMed 37397503 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rao, S.R.' 1 ? primary 'Harmon, T.W.' 2 ? primary 'Heath, S.L.' 3 ? primary 'Wolfe, J.A.' 4 ? primary 'Santhouse, J.R.' 5 ? primary ;O'Brien, G.L. ; 6 ? primary 'Distefano, A.N.' 7 ? primary 'Reinert, Z.E.' 8 ? primary 'Horne, W.S.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Immunoglobulin G-binding protein G' _entity.formula_weight 6246.825 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IgG-binding protein G' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'DTYKLILNGKTLKGETTTEAVDA(XCP)TAE(B3K)VF(B3K)QYA(XCP)DNGVDGEWTYDDATKTFTVTE(NH2)' _entity_poly.pdbx_seq_one_letter_code_can DTYKLILNGKTLKGETTTEAVDAXTAEKVFKQYAXDNGVDGEWTYDDATKTFTVTEX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 THR n 1 3 TYR n 1 4 LYS n 1 5 LEU n 1 6 ILE n 1 7 LEU n 1 8 ASN n 1 9 GLY n 1 10 LYS n 1 11 THR n 1 12 LEU n 1 13 LYS n 1 14 GLY n 1 15 GLU n 1 16 THR n 1 17 THR n 1 18 THR n 1 19 GLU n 1 20 ALA n 1 21 VAL n 1 22 ASP n 1 23 ALA n 1 24 XCP n 1 25 THR n 1 26 ALA n 1 27 GLU n 1 28 B3K n 1 29 VAL n 1 30 PHE n 1 31 B3K n 1 32 GLN n 1 33 TYR n 1 34 ALA n 1 35 XCP n 1 36 ASP n 1 37 ASN n 1 38 GLY n 1 39 VAL n 1 40 ASP n 1 41 GLY n 1 42 GLU n 1 43 TRP n 1 44 THR n 1 45 TYR n 1 46 ASP n 1 47 ASP n 1 48 ALA n 1 49 THR n 1 50 LYS n 1 51 THR n 1 52 PHE n 1 53 THR n 1 54 VAL n 1 55 THR n 1 56 GLU n 1 57 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 57 _pdbx_entity_src_syn.organism_scientific Streptococcus _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 1301 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPG2_STRSG _struct_ref.pdbx_db_accession P19909 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE _struct_ref.pdbx_align_begin 302 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8DIJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 56 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19909 _struct_ref_seq.db_align_beg 302 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 357 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 56 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8DIJ XCP A 24 ? UNP P19909 ALA 325 conflict 24 1 1 8DIJ XCP A 35 ? UNP P19909 ASN 336 conflict 35 2 1 8DIJ NH2 A 57 ? UNP P19909 ? ? amidation 57 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 B3K 'L-peptide linking' n '(3S)-3,7-DIAMINOHEPTANOIC ACID' ? 'C7 H16 N2 O2' 160.214 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XCP peptide-like . '(1S,2S)-2-aminocyclopentanecarboxylic acid' ? 'C6 H11 N O2' 129.157 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-1H COSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 40 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH* _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;0.65 mM Streptococcal Protein GB1 Backbone Modified Variant: beta-ACPC24, beta-3-Lys28, beta-3-Lys31, beta-ACPC35, 20 mM sodium phosphate, 0.1 mM DSS, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 8DIJ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # _pdbx_nmr_ensemble.entry_id 8DIJ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8DIJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin ? 'Bruker Biospin' 2 'data analysis' NMRFAM-SPARKY ? 'Lee, Tonelli, Markley' 3 refinement ARIA ? ;Linge, O'Donoghue and Nilges ; 4 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8DIJ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8DIJ _struct.title 'NMR Structure of Streptococcal Protein GB1 Backbone Modified Variant: beta-ACPC24, beta-3-Lys28, beta-3-Lys31, beta-ACPC35' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8DIJ _struct_keywords.text 'synthetic protein, unnatural backbone, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 22 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 37 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 22 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 37 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 23 C ? ? ? 1_555 A XCP 24 N ? ? A ALA 23 A XCP 24 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale2 covale both ? A XCP 24 C ? ? ? 1_555 A THR 25 N ? ? A XCP 24 A THR 25 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale3 covale both ? A GLU 27 C ? ? ? 1_555 A B3K 28 N ? ? A GLU 27 A B3K 28 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale4 covale both ? A B3K 28 C ? ? ? 1_555 A VAL 29 N ? ? A B3K 28 A VAL 29 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale5 covale both ? A PHE 30 C ? ? ? 1_555 A B3K 31 N ? ? A PHE 30 A B3K 31 1_555 ? ? ? ? ? ? ? 1.317 ? ? covale6 covale both ? A B3K 31 C ? ? ? 1_555 A GLN 32 N ? ? A B3K 31 A GLN 32 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale7 covale both ? A ALA 34 C ? ? ? 1_555 A XCP 35 N ? ? A ALA 34 A XCP 35 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale8 covale both ? A XCP 35 C ? ? ? 1_555 A ASP 36 N ? ? A XCP 35 A ASP 36 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale9 covale both ? A GLU 56 C ? ? ? 1_555 A NH2 57 N ? ? A GLU 56 A NH2 57 1_555 ? ? ? ? ? ? ? 1.321 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 13 ? GLU A 19 ? LYS A 13 GLU A 19 AA1 2 THR A 2 ? ASN A 8 ? THR A 2 ASN A 8 AA1 3 THR A 51 ? THR A 55 ? THR A 51 THR A 55 AA1 4 GLU A 42 ? ASP A 46 ? GLU A 42 ASP A 46 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 16 ? O THR A 16 N LEU A 5 ? N LEU A 5 AA1 2 3 N LYS A 4 ? N LYS A 4 O PHE A 52 ? O PHE A 52 AA1 3 4 O THR A 51 ? O THR A 51 N ASP A 46 ? N ASP A 46 # _atom_sites.entry_id 8DIJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 XCP 24 24 24 XCP ACP A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 B3K 28 28 28 B3K B3K A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 B3K 31 31 31 B3K B3K A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 XCP 35 35 35 XCP ACP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 NH2 57 57 57 NH2 NH2 A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email horne@pitt.edu _pdbx_contact_author.name_first William _pdbx_contact_author.name_last Horne _pdbx_contact_author.name_mi Seth _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2927-1739 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A B3K 28 A B3K 28 ? LYS 'modified residue' 2 A B3K 31 A B3K 31 ? LYS 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 120 ? 1 MORE 1 ? 1 'SSA (A^2)' 3710 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-23 2 'Structure model' 1 1 2023-07-19 3 'Structure model' 2 0 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' atom_site 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_validate_main_chain_plane 6 3 'Structure model' pdbx_validate_peptide_omega 7 3 'Structure model' pdbx_validate_torsion # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_atom_site.auth_atom_id' 9 3 'Structure model' '_atom_site.label_atom_id' # _pdbx_entry_details.entry_id 8DIJ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Streptococcal Protein GB1 Backbone Modified Variant: beta-ACPC24, beta-3-Lys28, beta-3-Lys31, beta-ACPC35' 0.65 ? mM 'natural abundance' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 DSS 0.1 ? mM 'natural abundance' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 8 _pdbx_validate_close_contact.auth_atom_id_1 HE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 3 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HH _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 TYR _pdbx_validate_close_contact.auth_seq_id_2 45 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.33 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 8 ? ? -115.73 63.90 2 2 ASN A 8 ? ? -113.83 65.18 3 3 ASN A 8 ? ? -103.62 64.76 4 4 ASN A 8 ? ? -106.80 63.99 5 5 ASN A 8 ? ? -109.66 61.72 6 6 ASN A 8 ? ? -116.68 58.04 7 7 ASN A 8 ? ? -118.28 71.66 8 8 ASN A 8 ? ? -117.33 62.21 9 9 ASN A 8 ? ? -109.64 56.18 10 9 THR A 11 ? ? -92.02 -60.43 11 10 ASN A 8 ? ? -116.24 62.55 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ALA A 23 ? ? XCP A 24 ? ? 143.39 2 1 B3K A 28 ? ? VAL A 29 ? ? 146.44 3 1 B3K A 31 ? ? GLN A 32 ? ? 148.65 4 1 ALA A 34 ? ? XCP A 35 ? ? 141.41 5 2 ALA A 23 ? ? XCP A 24 ? ? 143.93 6 2 B3K A 28 ? ? VAL A 29 ? ? 147.20 7 2 B3K A 31 ? ? GLN A 32 ? ? 149.84 8 2 ALA A 34 ? ? XCP A 35 ? ? 142.58 9 3 ALA A 23 ? ? XCP A 24 ? ? 142.55 10 3 B3K A 28 ? ? VAL A 29 ? ? 143.39 11 3 B3K A 31 ? ? GLN A 32 ? ? 147.03 12 3 ALA A 34 ? ? XCP A 35 ? ? 141.19 13 4 ALA A 23 ? ? XCP A 24 ? ? 141.06 14 4 B3K A 28 ? ? VAL A 29 ? ? 143.99 15 4 B3K A 31 ? ? GLN A 32 ? ? 148.97 16 4 ALA A 34 ? ? XCP A 35 ? ? 142.33 17 5 ALA A 23 ? ? XCP A 24 ? ? 141.81 18 5 B3K A 28 ? ? VAL A 29 ? ? 143.37 19 5 B3K A 31 ? ? GLN A 32 ? ? 145.44 20 5 ALA A 34 ? ? XCP A 35 ? ? 142.12 21 6 ALA A 23 ? ? XCP A 24 ? ? 142.68 22 6 B3K A 28 ? ? VAL A 29 ? ? 144.41 23 6 B3K A 31 ? ? GLN A 32 ? ? 146.48 24 6 ALA A 34 ? ? XCP A 35 ? ? 141.53 25 7 ALA A 23 ? ? XCP A 24 ? ? 142.22 26 7 B3K A 28 ? ? VAL A 29 ? ? 141.78 27 7 ALA A 34 ? ? XCP A 35 ? ? 141.76 28 8 ALA A 23 ? ? XCP A 24 ? ? 141.66 29 8 B3K A 28 ? ? VAL A 29 ? ? 145.99 30 8 B3K A 31 ? ? GLN A 32 ? ? 145.69 31 8 ALA A 34 ? ? XCP A 35 ? ? 140.94 32 9 ALA A 23 ? ? XCP A 24 ? ? 144.05 33 9 B3K A 28 ? ? VAL A 29 ? ? 144.56 34 9 B3K A 31 ? ? GLN A 32 ? ? 147.63 35 9 ALA A 34 ? ? XCP A 35 ? ? 141.44 36 10 ALA A 23 ? ? XCP A 24 ? ? 142.13 37 10 B3K A 28 ? ? VAL A 29 ? ? 145.03 38 10 B3K A 31 ? ? GLN A 32 ? ? 149.60 39 10 ALA A 34 ? ? XCP A 35 ? ? 141.78 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 B3K A 28 ? ? -18.16 2 1 B3K A 31 ? ? -18.79 3 2 B3K A 28 ? ? -17.98 4 2 B3K A 31 ? ? -18.48 5 3 B3K A 28 ? ? -17.84 6 3 B3K A 31 ? ? -18.85 7 4 B3K A 28 ? ? -18.08 8 4 B3K A 31 ? ? -18.84 9 5 B3K A 28 ? ? -18.15 10 5 B3K A 31 ? ? -19.24 11 6 B3K A 28 ? ? -18.21 12 6 B3K A 31 ? ? -19.05 13 7 B3K A 28 ? ? -18.02 14 7 B3K A 31 ? ? -18.82 15 8 B3K A 28 ? ? -18.32 16 8 B3K A 31 ? ? -19.32 17 9 B3K A 28 ? ? -18.01 18 9 B3K A 31 ? ? -18.58 19 10 B3K A 28 ? ? -18.40 20 10 B3K A 31 ? ? -18.63 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 B3K N N N N 47 B3K CA C N S 48 B3K CG C N N 49 B3K CD C N N 50 B3K CE C N N 51 B3K CF C N N 52 B3K NZ N N N 53 B3K CB C N N 54 B3K C C N N 55 B3K O O N N 56 B3K OXT O N N 57 B3K H H N N 58 B3K H2 H N N 59 B3K HA H N N 60 B3K HG2 H N N 61 B3K HG3 H N N 62 B3K HD2 H N N 63 B3K HD3 H N N 64 B3K HE2 H N N 65 B3K HE3 H N N 66 B3K HF1 H N N 67 B3K HF2 H N N 68 B3K HNZ1 H N N 69 B3K HNZ2 H N N 70 B3K HB1 H N N 71 B3K HB2 H N N 72 B3K HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 NH2 N N N N 192 NH2 HN1 H N N 193 NH2 HN2 H N N 194 PHE N N N N 195 PHE CA C N S 196 PHE C C N N 197 PHE O O N N 198 PHE CB C N N 199 PHE CG C Y N 200 PHE CD1 C Y N 201 PHE CD2 C Y N 202 PHE CE1 C Y N 203 PHE CE2 C Y N 204 PHE CZ C Y N 205 PHE OXT O N N 206 PHE H H N N 207 PHE H2 H N N 208 PHE HA H N N 209 PHE HB2 H N N 210 PHE HB3 H N N 211 PHE HD1 H N N 212 PHE HD2 H N N 213 PHE HE1 H N N 214 PHE HE2 H N N 215 PHE HZ H N N 216 PHE HXT H N N 217 THR N N N N 218 THR CA C N S 219 THR C C N N 220 THR O O N N 221 THR CB C N R 222 THR OG1 O N N 223 THR CG2 C N N 224 THR OXT O N N 225 THR H H N N 226 THR H2 H N N 227 THR HA H N N 228 THR HB H N N 229 THR HG1 H N N 230 THR HG21 H N N 231 THR HG22 H N N 232 THR HG23 H N N 233 THR HXT H N N 234 TRP N N N N 235 TRP CA C N S 236 TRP C C N N 237 TRP O O N N 238 TRP CB C N N 239 TRP CG C Y N 240 TRP CD1 C Y N 241 TRP CD2 C Y N 242 TRP NE1 N Y N 243 TRP CE2 C Y N 244 TRP CE3 C Y N 245 TRP CZ2 C Y N 246 TRP CZ3 C Y N 247 TRP CH2 C Y N 248 TRP OXT O N N 249 TRP H H N N 250 TRP H2 H N N 251 TRP HA H N N 252 TRP HB2 H N N 253 TRP HB3 H N N 254 TRP HD1 H N N 255 TRP HE1 H N N 256 TRP HE3 H N N 257 TRP HZ2 H N N 258 TRP HZ3 H N N 259 TRP HH2 H N N 260 TRP HXT H N N 261 TYR N N N N 262 TYR CA C N S 263 TYR C C N N 264 TYR O O N N 265 TYR CB C N N 266 TYR CG C Y N 267 TYR CD1 C Y N 268 TYR CD2 C Y N 269 TYR CE1 C Y N 270 TYR CE2 C Y N 271 TYR CZ C Y N 272 TYR OH O N N 273 TYR OXT O N N 274 TYR H H N N 275 TYR H2 H N N 276 TYR HA H N N 277 TYR HB2 H N N 278 TYR HB3 H N N 279 TYR HD1 H N N 280 TYR HD2 H N N 281 TYR HE1 H N N 282 TYR HE2 H N N 283 TYR HH H N N 284 TYR HXT H N N 285 VAL N N N N 286 VAL CA C N S 287 VAL C C N N 288 VAL O O N N 289 VAL CB C N N 290 VAL CG1 C N N 291 VAL CG2 C N N 292 VAL OXT O N N 293 VAL H H N N 294 VAL H2 H N N 295 VAL HA H N N 296 VAL HB H N N 297 VAL HG11 H N N 298 VAL HG12 H N N 299 VAL HG13 H N N 300 VAL HG21 H N N 301 VAL HG22 H N N 302 VAL HG23 H N N 303 VAL HXT H N N 304 XCP N N N N 305 XCP CB C N S 306 XCP CG C N N 307 XCP CD C N N 308 XCP CE C N N 309 XCP CA C N S 310 XCP C C N N 311 XCP O O N N 312 XCP H H N N 313 XCP HB H N N 314 XCP HG H N N 315 XCP HGA H N N 316 XCP HD H N N 317 XCP HDA H N N 318 XCP HE H N N 319 XCP HEA H N N 320 XCP HA H N N 321 XCP H2 H N N 322 XCP OXT O N N 323 XCP HXT H N N 324 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 B3K N CA sing N N 44 B3K N H sing N N 45 B3K N H2 sing N N 46 B3K CA CG sing N N 47 B3K CA CB sing N N 48 B3K CA HA sing N N 49 B3K CG CD sing N N 50 B3K CG HG2 sing N N 51 B3K CG HG3 sing N N 52 B3K CD CE sing N N 53 B3K CD HD2 sing N N 54 B3K CD HD3 sing N N 55 B3K CE CF sing N N 56 B3K CE HE2 sing N N 57 B3K CE HE3 sing N N 58 B3K CF NZ sing N N 59 B3K CF HF1 sing N N 60 B3K CF HF2 sing N N 61 B3K NZ HNZ1 sing N N 62 B3K NZ HNZ2 sing N N 63 B3K CB C sing N N 64 B3K CB HB1 sing N N 65 B3K CB HB2 sing N N 66 B3K C OXT sing N N 67 B3K C O doub N N 68 B3K OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 NH2 N HN1 sing N N 182 NH2 N HN2 sing N N 183 PHE N CA sing N N 184 PHE N H sing N N 185 PHE N H2 sing N N 186 PHE CA C sing N N 187 PHE CA CB sing N N 188 PHE CA HA sing N N 189 PHE C O doub N N 190 PHE C OXT sing N N 191 PHE CB CG sing N N 192 PHE CB HB2 sing N N 193 PHE CB HB3 sing N N 194 PHE CG CD1 doub Y N 195 PHE CG CD2 sing Y N 196 PHE CD1 CE1 sing Y N 197 PHE CD1 HD1 sing N N 198 PHE CD2 CE2 doub Y N 199 PHE CD2 HD2 sing N N 200 PHE CE1 CZ doub Y N 201 PHE CE1 HE1 sing N N 202 PHE CE2 CZ sing Y N 203 PHE CE2 HE2 sing N N 204 PHE CZ HZ sing N N 205 PHE OXT HXT sing N N 206 THR N CA sing N N 207 THR N H sing N N 208 THR N H2 sing N N 209 THR CA C sing N N 210 THR CA CB sing N N 211 THR CA HA sing N N 212 THR C O doub N N 213 THR C OXT sing N N 214 THR CB OG1 sing N N 215 THR CB CG2 sing N N 216 THR CB HB sing N N 217 THR OG1 HG1 sing N N 218 THR CG2 HG21 sing N N 219 THR CG2 HG22 sing N N 220 THR CG2 HG23 sing N N 221 THR OXT HXT sing N N 222 TRP N CA sing N N 223 TRP N H sing N N 224 TRP N H2 sing N N 225 TRP CA C sing N N 226 TRP CA CB sing N N 227 TRP CA HA sing N N 228 TRP C O doub N N 229 TRP C OXT sing N N 230 TRP CB CG sing N N 231 TRP CB HB2 sing N N 232 TRP CB HB3 sing N N 233 TRP CG CD1 doub Y N 234 TRP CG CD2 sing Y N 235 TRP CD1 NE1 sing Y N 236 TRP CD1 HD1 sing N N 237 TRP CD2 CE2 doub Y N 238 TRP CD2 CE3 sing Y N 239 TRP NE1 CE2 sing Y N 240 TRP NE1 HE1 sing N N 241 TRP CE2 CZ2 sing Y N 242 TRP CE3 CZ3 doub Y N 243 TRP CE3 HE3 sing N N 244 TRP CZ2 CH2 doub Y N 245 TRP CZ2 HZ2 sing N N 246 TRP CZ3 CH2 sing Y N 247 TRP CZ3 HZ3 sing N N 248 TRP CH2 HH2 sing N N 249 TRP OXT HXT sing N N 250 TYR N CA sing N N 251 TYR N H sing N N 252 TYR N H2 sing N N 253 TYR CA C sing N N 254 TYR CA CB sing N N 255 TYR CA HA sing N N 256 TYR C O doub N N 257 TYR C OXT sing N N 258 TYR CB CG sing N N 259 TYR CB HB2 sing N N 260 TYR CB HB3 sing N N 261 TYR CG CD1 doub Y N 262 TYR CG CD2 sing Y N 263 TYR CD1 CE1 sing Y N 264 TYR CD1 HD1 sing N N 265 TYR CD2 CE2 doub Y N 266 TYR CD2 HD2 sing N N 267 TYR CE1 CZ doub Y N 268 TYR CE1 HE1 sing N N 269 TYR CE2 CZ sing Y N 270 TYR CE2 HE2 sing N N 271 TYR CZ OH sing N N 272 TYR OH HH sing N N 273 TYR OXT HXT sing N N 274 VAL N CA sing N N 275 VAL N H sing N N 276 VAL N H2 sing N N 277 VAL CA C sing N N 278 VAL CA CB sing N N 279 VAL CA HA sing N N 280 VAL C O doub N N 281 VAL C OXT sing N N 282 VAL CB CG1 sing N N 283 VAL CB CG2 sing N N 284 VAL CB HB sing N N 285 VAL CG1 HG11 sing N N 286 VAL CG1 HG12 sing N N 287 VAL CG1 HG13 sing N N 288 VAL CG2 HG21 sing N N 289 VAL CG2 HG22 sing N N 290 VAL CG2 HG23 sing N N 291 VAL OXT HXT sing N N 292 XCP N H sing N N 293 XCP N H2 sing N N 294 XCP CB N sing N N 295 XCP CB CG sing N N 296 XCP CG HGA sing N N 297 XCP CD CG sing N N 298 XCP CD HD sing N N 299 XCP CE CD sing N N 300 XCP CE CA sing N N 301 XCP CE HE sing N N 302 XCP CA CB sing N N 303 XCP CA HA sing N N 304 XCP C CA sing N N 305 XCP C OXT sing N N 306 XCP O C doub N N 307 XCP HB CB sing N N 308 XCP HG CG sing N N 309 XCP HDA CD sing N N 310 XCP HEA CE sing N N 311 XCP OXT HXT sing N N 312 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 107161 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 XCP ? ? XCP ? ? 'SUBJECT OF INVESTIGATION' ? 2 B3K ? ? B3K ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #