data_8DJ4 # _entry.id 8DJ4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8DJ4 pdb_00008dj4 10.2210/pdb8dj4/pdb WWPDB D_1000266560 ? ? BMRB 31032 ? 10.13018/BMR31032 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-24 2 'Structure model' 1 1 2022-09-07 3 'Structure model' 1 2 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_entry_details 6 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8DJ4 _pdbx_database_status.recvd_initial_deposition_date 2022-06-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB 'Chemical shift data for Ac-hGal(17-30)NH2, a C-terminal Galanin fragment' 31029 unspecified PDB 'NMR solution structure for Ac-hGal(17-30)NH2, a C-terminal Galanin fragment' 8DHZ unspecified BMRB 'Chemical shift data for hGal(2-12)KK, a galanin N-terminal fragment' 30946 unspecified PDB 'NMR solution structure for hGal(2-12)KK, a galanin N-terminal fragment' 7S3O unspecified BMRB 'Chemical shift data for hGal(1-12)KK, a galanin N-terminal fragment' 30947 unspecified PDB 'NMR solution structure for hGal(1-12)KK, a galanin N-terminal fragment' 7S3Q unspecified BMRB 'Chemical shift data for hGal(1-17)KK, a galanin N-terminal fragment' 30948 unspecified PDB 'NMR solution structure for hGal(1-12)KK, a galanin N-terminal fragment' 7S3R unspecified BMRB 'NMR Solution Structure of C-terminally amidated, Full-length Human Galanin' 31032 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email giulianomw@cofc.edu _pdbx_contact_author.name_first Michael _pdbx_contact_author.name_last Giuliano _pdbx_contact_author.name_mi W _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0137-7769 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wilkinson, R.E.' 1 ? 'Kraichely, K.N.' 2 0000-0002-9674-3583 'Buchanan, L.E.' 3 0000-0001-8486-0371 'Parnham, S.' 4 0000-0002-8205-5827 'Giuliano, M.W.' 5 0000-0003-0137-7769 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 626 _citation.language ? _citation.page_first 121 _citation.page_last 128 _citation.title 'The neuropeptide galanin adopts an irregular secondary structure.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2022.08.032 _citation.pdbx_database_id_PubMed 35994823 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wilkinson, R.E.' 1 ? primary 'Kraichely, K.N.' 2 ? primary 'Hendy, C.M.' 3 ? primary 'Buchanan, L.E.' 4 ? primary 'Parnham, S.' 5 ? primary 'Giuliano, M.W.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Galanin _entity.formula_weight 3159.454 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS(NH2)' _entity_poly.pdbx_seq_one_letter_code_can GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 TRP n 1 3 THR n 1 4 LEU n 1 5 ASN n 1 6 SER n 1 7 ALA n 1 8 GLY n 1 9 TYR n 1 10 LEU n 1 11 LEU n 1 12 GLY n 1 13 PRO n 1 14 HIS n 1 15 ALA n 1 16 VAL n 1 17 GLY n 1 18 ASN n 1 19 HIS n 1 20 ARG n 1 21 SER n 1 22 PHE n 1 23 SER n 1 24 ASP n 1 25 LYS n 1 26 ASN n 1 27 GLY n 1 28 LEU n 1 29 THR n 1 30 SER n 1 31 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 31 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 TRP 2 2 2 TRP TRP A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 NH2 31 31 31 NH2 NH2 A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8DJ4 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8DJ4 _struct.title 'NMR Solution Structure of C-terminally amidated, Full-length Human Galanin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8DJ4 _struct_keywords.text 'synthetic, neuropeptide' _struct_keywords.pdbx_keywords NEUROPEPTIDE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GALA_HUMAN _struct_ref.pdbx_db_accession P22466 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS _struct_ref.pdbx_align_begin 33 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8DJ4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22466 _struct_ref_seq.db_align_beg 33 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 62 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8DJ4 _struct_ref_seq_dif.mon_id NH2 _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 31 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P22466 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details amidation _struct_ref_seq_dif.pdbx_auth_seq_num 31 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details ;Peptide concentration was assessed over a fifty-fold range of concentrations in 1D 1H NMR spectra from 0.1 mM up to 5.0 mM. While all concentrations below and inclusive of 1.0 mM peptide were acceptable - free of dispersion and broadening effects across multiple weeks in solution - 0.5 mM was selected as the optimal choice for further analysis with optimal resolution. ; # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 30 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 31 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 30 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 31 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.332 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id NH2 _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 31 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id SER _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 30 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id NH2 _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 31 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id SER _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 30 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id SER _pdbx_modification_feature.ref_pcm_id 6 _pdbx_modification_feature.ref_comp_id NH2 _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Terminal amidation' # _pdbx_entry_details.entry_id 8DJ4 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A THR 3 ? ? H A GLY 8 ? ? 1.56 2 2 O A THR 3 ? ? H A GLY 8 ? ? 1.57 3 3 O A THR 3 ? ? H A GLY 8 ? ? 1.57 4 4 O A THR 3 ? ? H A GLY 8 ? ? 1.57 5 5 O A THR 3 ? ? H A GLY 8 ? ? 1.59 6 6 O A THR 3 ? ? H A GLY 8 ? ? 1.57 7 7 O A THR 3 ? ? H A GLY 8 ? ? 1.57 8 8 O A THR 3 ? ? H A GLY 8 ? ? 1.57 9 9 O A THR 3 ? ? H A GLY 8 ? ? 1.56 10 10 O A THR 3 ? ? H A GLY 8 ? ? 1.58 11 11 O A THR 3 ? ? H A GLY 8 ? ? 1.57 12 12 O A THR 3 ? ? H A GLY 8 ? ? 1.52 13 13 O A THR 3 ? ? H A GLY 8 ? ? 1.59 14 14 O A THR 3 ? ? H A GLY 8 ? ? 1.57 15 15 O A THR 3 ? ? H A GLY 8 ? ? 1.59 16 16 O A THR 3 ? ? H A GLY 8 ? ? 1.58 17 17 O A THR 3 ? ? H A GLY 8 ? ? 1.57 18 18 HG A SER 6 ? ? H A ALA 7 ? ? 1.33 19 18 O A THR 3 ? ? H A GLY 8 ? ? 1.58 20 19 O A THR 3 ? ? H A GLY 8 ? ? 1.56 21 20 O A THR 3 ? ? H A GLY 8 ? ? 1.57 22 21 O A THR 3 ? ? H A GLY 8 ? ? 1.54 23 22 O A THR 3 ? ? H A GLY 8 ? ? 1.56 24 23 O A THR 3 ? ? H A GLY 8 ? ? 1.52 25 24 O A THR 3 ? ? H A GLY 8 ? ? 1.56 26 25 O A THR 3 ? ? H A GLY 8 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 3 ? ? -158.58 -37.05 2 1 LEU A 4 ? ? -14.67 -57.95 3 1 SER A 6 ? ? -56.41 -77.93 4 1 ASP A 24 ? ? -140.19 -15.94 5 2 THR A 3 ? ? -158.84 -37.77 6 2 LEU A 4 ? ? -14.59 -58.04 7 2 SER A 6 ? ? -59.10 -76.09 8 2 SER A 21 ? ? -131.87 -33.32 9 2 ASP A 24 ? ? -141.05 -21.47 10 3 THR A 3 ? ? -158.73 -37.57 11 3 LEU A 4 ? ? -14.89 -57.35 12 3 SER A 6 ? ? -56.13 -77.51 13 3 ASP A 24 ? ? -144.28 -27.58 14 3 THR A 29 ? ? 52.34 107.54 15 4 THR A 3 ? ? -159.14 -37.36 16 4 LEU A 4 ? ? -14.76 -58.15 17 4 SER A 6 ? ? -59.31 -76.32 18 4 PHE A 22 ? ? -95.92 -68.19 19 5 THR A 3 ? ? -159.45 -37.70 20 5 LEU A 4 ? ? -14.99 -57.69 21 5 SER A 6 ? ? -59.30 -76.52 22 5 ASN A 18 ? ? -138.50 -41.80 23 5 PHE A 22 ? ? -100.11 -68.44 24 6 THR A 3 ? ? -159.17 -37.33 25 6 LEU A 4 ? ? -14.82 -58.19 26 6 SER A 6 ? ? -59.26 -76.39 27 6 PHE A 22 ? ? -92.05 -71.76 28 6 THR A 29 ? ? -138.01 -46.05 29 7 THR A 3 ? ? -158.81 -36.92 30 7 LEU A 4 ? ? -14.80 -57.93 31 7 SER A 6 ? ? -57.45 -77.61 32 7 PHE A 22 ? ? -99.71 -68.36 33 8 THR A 3 ? ? -158.76 -37.54 34 8 LEU A 4 ? ? -15.05 -57.25 35 8 SER A 6 ? ? -56.09 -77.64 36 8 ASP A 24 ? ? -142.26 -26.18 37 8 LYS A 25 ? ? -134.05 -43.00 38 8 THR A 29 ? ? 52.37 107.62 39 9 THR A 3 ? ? -158.39 -36.99 40 9 LEU A 4 ? ? -14.84 -57.81 41 9 SER A 6 ? ? -56.52 -77.73 42 9 HIS A 14 ? ? 62.84 125.76 43 9 ASP A 24 ? ? -139.89 -37.41 44 9 THR A 29 ? ? -137.89 -46.00 45 10 THR A 3 ? ? -159.12 -37.40 46 10 LEU A 4 ? ? -14.72 -58.16 47 10 SER A 6 ? ? -59.27 -76.51 48 10 ASP A 24 ? ? -142.26 -25.88 49 11 THR A 3 ? ? -158.66 -37.45 50 11 LEU A 4 ? ? -14.94 -57.28 51 11 SER A 6 ? ? -56.40 -77.52 52 11 ASP A 24 ? ? -140.79 -16.59 53 12 THR A 3 ? ? -156.59 -34.46 54 12 LEU A 4 ? ? -15.97 -56.56 55 12 SER A 6 ? ? -52.80 -79.53 56 12 LEU A 10 ? ? -140.01 -27.54 57 12 HIS A 19 ? ? -130.63 -42.93 58 12 PHE A 22 ? ? -95.97 -68.26 59 13 THR A 3 ? ? -159.86 -37.83 60 13 LEU A 4 ? ? -14.97 -57.81 61 13 SER A 6 ? ? -59.02 -76.32 62 13 ASP A 24 ? ? -141.62 -25.45 63 14 THR A 3 ? ? -158.49 -37.45 64 14 LEU A 4 ? ? -14.93 -57.29 65 14 SER A 6 ? ? -56.55 -77.51 66 14 ASP A 24 ? ? 56.96 73.57 67 15 THR A 3 ? ? -159.34 -37.76 68 15 LEU A 4 ? ? -14.98 -57.72 69 15 SER A 6 ? ? -59.43 -76.19 70 15 HIS A 14 ? ? -133.87 -48.03 71 15 ASP A 24 ? ? -144.18 -27.25 72 16 THR A 3 ? ? -159.26 -37.89 73 16 LEU A 4 ? ? -14.94 -57.69 74 16 SER A 6 ? ? -59.08 -76.37 75 16 ASP A 24 ? ? -143.65 -27.16 76 17 THR A 3 ? ? -158.60 -37.39 77 17 LEU A 4 ? ? -14.89 -57.41 78 17 SER A 6 ? ? -56.45 -77.43 79 17 SER A 21 ? ? 56.35 164.76 80 17 ASP A 24 ? ? -142.74 -27.14 81 18 THR A 3 ? ? -159.27 -37.72 82 18 LEU A 4 ? ? -14.83 -57.92 83 18 SER A 6 ? ? -59.31 -76.25 84 18 HIS A 19 ? ? -140.79 -46.10 85 18 ASP A 24 ? ? -140.75 -25.05 86 19 THR A 3 ? ? -158.79 -36.90 87 19 LEU A 4 ? ? -14.88 -57.93 88 19 SER A 6 ? ? -57.90 -77.47 89 19 ASP A 24 ? ? -143.01 -40.76 90 20 THR A 3 ? ? -158.73 -36.84 91 20 LEU A 4 ? ? -14.75 -58.02 92 20 SER A 6 ? ? -58.30 -77.31 93 20 PHE A 22 ? ? -106.09 -70.21 94 21 THR A 3 ? ? -156.19 -34.74 95 21 LEU A 4 ? ? -15.73 -56.94 96 21 SER A 6 ? ? -54.44 -78.39 97 21 SER A 23 ? ? -97.00 55.70 98 21 LYS A 25 ? ? 62.29 124.24 99 21 THR A 29 ? ? -137.12 -46.05 100 22 THR A 3 ? ? -158.53 -36.97 101 22 LEU A 4 ? ? -14.64 -57.99 102 22 SER A 6 ? ? -56.38 -77.93 103 22 ALA A 15 ? ? -131.95 -39.78 104 22 PHE A 22 ? ? -94.13 -71.81 105 22 LYS A 25 ? ? -133.22 -42.61 106 23 THR A 3 ? ? -156.65 -34.43 107 23 LEU A 4 ? ? -16.04 -56.61 108 23 SER A 6 ? ? -52.86 -79.64 109 23 LEU A 10 ? ? -140.18 -27.58 110 23 ASP A 24 ? ? -142.48 -26.11 111 24 THR A 3 ? ? -158.48 -36.99 112 24 LEU A 4 ? ? -14.68 -57.92 113 24 SER A 6 ? ? -57.29 -77.45 114 24 ALA A 15 ? ? -138.93 -42.75 115 24 PHE A 22 ? ? -99.70 -68.71 116 25 THR A 3 ? ? -159.23 -37.40 117 25 LEU A 4 ? ? -14.61 -58.34 118 25 SER A 6 ? ? -59.27 -76.48 119 25 PHE A 22 ? ? -105.22 -69.99 120 25 THR A 29 ? ? -137.75 -46.00 # _pdbx_nmr_ensemble.entry_id 8DJ4 _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8DJ4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM hGal(1-30)NH2, 4.14 mM [U-2H] sodium acetate, 5.86 mM [U-2H] acetic acid, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 1 _pdbx_nmr_sample_details.type 'lyophilized powder' _pdbx_nmr_sample_details.details ;peptide was suspended and dissolved into deuterated acetate buffer, which had been prepared in 95:5 H2O:D2O to within 0.02 units of pH 4.6 ; # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'hGal(1-30)NH2' 0.5 ? mM 'natural abundance' 1 'sodium acetate' 4.14 ? mM '[U-2H]' 1 'acetic acid' 5.86 ? mM '[U-2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'sample was dissolved in 10 mM sodium acetate-d3/acetic acid-d4 buffer at pH 4.6; no additional additives were present.' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.02 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '1H 1D NMR Spectrum' 1 isotropic 2 1 1 '2D 1H-1H COSY' 1 isotropic 3 1 1 '2D 1H-1H TOCSY' 1 isotropic 4 1 1 '2D 1H-1H ROESY' 1 isotropic # _pdbx_nmr_details.entry_id 8DJ4 _pdbx_nmr_details.text ;The authors state the following regarding the geometric deviations with this ensemble: With most of the hydrogen bonds in the N-terminus of the peptide bifurcated, or even more, they are confident that the ensemble represents the time-averaged structure of a peptide that is rapidly interconverting turns of alpha, 310-, and pi-helix. Their shift assignments were largely unambiguous and can be found in BMRB entry 31032. The "irregular helix restraints" used (and described in the manuscript and its references) were employed to allow the ensemble to sample multiple arrangements during simulated annealing. By definition, this ensemble existing as an average will display a significant degree of geometric irregularity, particularly with regard the backbone and sidechain outliers as compared to statistical norms. Further, the clashscore level is quite high. This appears to be a consequence of the very high density of ROE-derived distance restraints in the N-terminus of the peptide, which were maximally relaxed to account for any uncertainty in their measurement throughout several rounds of validation and re-calculation. Tight sidechain packing and compression seems to be the dictated outcome of our data. Much of their study is concerned with compact hydrophobic packing in this sequence - this full-length peptide is indeed much more rigid across the stretch of residues it shares with fragment peptides described in entries 7S3O, 7S3Q, and 7S3R. Together with the compactness of the region of the sequence, the clashes appear to be a consequence of several averaged, coiling, helical conformers all existing on the NMR timescale. This is discussed at further length in the citation affiliated with this deposition ; # _pdbx_nmr_refine.entry_id 8DJ4 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 'chemical shift assignment' 'MestreLab (Mnova / MestReNova / MestReC)' ? MestreLab 4 'peak picking' 'MestreLab (Mnova / MestReNova / MestReC)' ? MestreLab # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLY N N N N 74 GLY CA C N N 75 GLY C C N N 76 GLY O O N N 77 GLY OXT O N N 78 GLY H H N N 79 GLY H2 H N N 80 GLY HA2 H N N 81 GLY HA3 H N N 82 GLY HXT H N N 83 HIS N N N N 84 HIS CA C N S 85 HIS C C N N 86 HIS O O N N 87 HIS CB C N N 88 HIS CG C Y N 89 HIS ND1 N Y N 90 HIS CD2 C Y N 91 HIS CE1 C Y N 92 HIS NE2 N Y N 93 HIS OXT O N N 94 HIS H H N N 95 HIS H2 H N N 96 HIS HA H N N 97 HIS HB2 H N N 98 HIS HB3 H N N 99 HIS HD1 H N N 100 HIS HD2 H N N 101 HIS HE1 H N N 102 HIS HE2 H N N 103 HIS HXT H N N 104 LEU N N N N 105 LEU CA C N S 106 LEU C C N N 107 LEU O O N N 108 LEU CB C N N 109 LEU CG C N N 110 LEU CD1 C N N 111 LEU CD2 C N N 112 LEU OXT O N N 113 LEU H H N N 114 LEU H2 H N N 115 LEU HA H N N 116 LEU HB2 H N N 117 LEU HB3 H N N 118 LEU HG H N N 119 LEU HD11 H N N 120 LEU HD12 H N N 121 LEU HD13 H N N 122 LEU HD21 H N N 123 LEU HD22 H N N 124 LEU HD23 H N N 125 LEU HXT H N N 126 LYS N N N N 127 LYS CA C N S 128 LYS C C N N 129 LYS O O N N 130 LYS CB C N N 131 LYS CG C N N 132 LYS CD C N N 133 LYS CE C N N 134 LYS NZ N N N 135 LYS OXT O N N 136 LYS H H N N 137 LYS H2 H N N 138 LYS HA H N N 139 LYS HB2 H N N 140 LYS HB3 H N N 141 LYS HG2 H N N 142 LYS HG3 H N N 143 LYS HD2 H N N 144 LYS HD3 H N N 145 LYS HE2 H N N 146 LYS HE3 H N N 147 LYS HZ1 H N N 148 LYS HZ2 H N N 149 LYS HZ3 H N N 150 LYS HXT H N N 151 NH2 N N N N 152 NH2 HN1 H N N 153 NH2 HN2 H N N 154 PHE N N N N 155 PHE CA C N S 156 PHE C C N N 157 PHE O O N N 158 PHE CB C N N 159 PHE CG C Y N 160 PHE CD1 C Y N 161 PHE CD2 C Y N 162 PHE CE1 C Y N 163 PHE CE2 C Y N 164 PHE CZ C Y N 165 PHE OXT O N N 166 PHE H H N N 167 PHE H2 H N N 168 PHE HA H N N 169 PHE HB2 H N N 170 PHE HB3 H N N 171 PHE HD1 H N N 172 PHE HD2 H N N 173 PHE HE1 H N N 174 PHE HE2 H N N 175 PHE HZ H N N 176 PHE HXT H N N 177 PRO N N N N 178 PRO CA C N S 179 PRO C C N N 180 PRO O O N N 181 PRO CB C N N 182 PRO CG C N N 183 PRO CD C N N 184 PRO OXT O N N 185 PRO H H N N 186 PRO HA H N N 187 PRO HB2 H N N 188 PRO HB3 H N N 189 PRO HG2 H N N 190 PRO HG3 H N N 191 PRO HD2 H N N 192 PRO HD3 H N N 193 PRO HXT H N N 194 SER N N N N 195 SER CA C N S 196 SER C C N N 197 SER O O N N 198 SER CB C N N 199 SER OG O N N 200 SER OXT O N N 201 SER H H N N 202 SER H2 H N N 203 SER HA H N N 204 SER HB2 H N N 205 SER HB3 H N N 206 SER HG H N N 207 SER HXT H N N 208 THR N N N N 209 THR CA C N S 210 THR C C N N 211 THR O O N N 212 THR CB C N R 213 THR OG1 O N N 214 THR CG2 C N N 215 THR OXT O N N 216 THR H H N N 217 THR H2 H N N 218 THR HA H N N 219 THR HB H N N 220 THR HG1 H N N 221 THR HG21 H N N 222 THR HG22 H N N 223 THR HG23 H N N 224 THR HXT H N N 225 TRP N N N N 226 TRP CA C N S 227 TRP C C N N 228 TRP O O N N 229 TRP CB C N N 230 TRP CG C Y N 231 TRP CD1 C Y N 232 TRP CD2 C Y N 233 TRP NE1 N Y N 234 TRP CE2 C Y N 235 TRP CE3 C Y N 236 TRP CZ2 C Y N 237 TRP CZ3 C Y N 238 TRP CH2 C Y N 239 TRP OXT O N N 240 TRP H H N N 241 TRP H2 H N N 242 TRP HA H N N 243 TRP HB2 H N N 244 TRP HB3 H N N 245 TRP HD1 H N N 246 TRP HE1 H N N 247 TRP HE3 H N N 248 TRP HZ2 H N N 249 TRP HZ3 H N N 250 TRP HH2 H N N 251 TRP HXT H N N 252 TYR N N N N 253 TYR CA C N S 254 TYR C C N N 255 TYR O O N N 256 TYR CB C N N 257 TYR CG C Y N 258 TYR CD1 C Y N 259 TYR CD2 C Y N 260 TYR CE1 C Y N 261 TYR CE2 C Y N 262 TYR CZ C Y N 263 TYR OH O N N 264 TYR OXT O N N 265 TYR H H N N 266 TYR H2 H N N 267 TYR HA H N N 268 TYR HB2 H N N 269 TYR HB3 H N N 270 TYR HD1 H N N 271 TYR HD2 H N N 272 TYR HE1 H N N 273 TYR HE2 H N N 274 TYR HH H N N 275 TYR HXT H N N 276 VAL N N N N 277 VAL CA C N S 278 VAL C C N N 279 VAL O O N N 280 VAL CB C N N 281 VAL CG1 C N N 282 VAL CG2 C N N 283 VAL OXT O N N 284 VAL H H N N 285 VAL H2 H N N 286 VAL HA H N N 287 VAL HB H N N 288 VAL HG11 H N N 289 VAL HG12 H N N 290 VAL HG13 H N N 291 VAL HG21 H N N 292 VAL HG22 H N N 293 VAL HG23 H N N 294 VAL HXT H N N 295 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLY N CA sing N N 70 GLY N H sing N N 71 GLY N H2 sing N N 72 GLY CA C sing N N 73 GLY CA HA2 sing N N 74 GLY CA HA3 sing N N 75 GLY C O doub N N 76 GLY C OXT sing N N 77 GLY OXT HXT sing N N 78 HIS N CA sing N N 79 HIS N H sing N N 80 HIS N H2 sing N N 81 HIS CA C sing N N 82 HIS CA CB sing N N 83 HIS CA HA sing N N 84 HIS C O doub N N 85 HIS C OXT sing N N 86 HIS CB CG sing N N 87 HIS CB HB2 sing N N 88 HIS CB HB3 sing N N 89 HIS CG ND1 sing Y N 90 HIS CG CD2 doub Y N 91 HIS ND1 CE1 doub Y N 92 HIS ND1 HD1 sing N N 93 HIS CD2 NE2 sing Y N 94 HIS CD2 HD2 sing N N 95 HIS CE1 NE2 sing Y N 96 HIS CE1 HE1 sing N N 97 HIS NE2 HE2 sing N N 98 HIS OXT HXT sing N N 99 LEU N CA sing N N 100 LEU N H sing N N 101 LEU N H2 sing N N 102 LEU CA C sing N N 103 LEU CA CB sing N N 104 LEU CA HA sing N N 105 LEU C O doub N N 106 LEU C OXT sing N N 107 LEU CB CG sing N N 108 LEU CB HB2 sing N N 109 LEU CB HB3 sing N N 110 LEU CG CD1 sing N N 111 LEU CG CD2 sing N N 112 LEU CG HG sing N N 113 LEU CD1 HD11 sing N N 114 LEU CD1 HD12 sing N N 115 LEU CD1 HD13 sing N N 116 LEU CD2 HD21 sing N N 117 LEU CD2 HD22 sing N N 118 LEU CD2 HD23 sing N N 119 LEU OXT HXT sing N N 120 LYS N CA sing N N 121 LYS N H sing N N 122 LYS N H2 sing N N 123 LYS CA C sing N N 124 LYS CA CB sing N N 125 LYS CA HA sing N N 126 LYS C O doub N N 127 LYS C OXT sing N N 128 LYS CB CG sing N N 129 LYS CB HB2 sing N N 130 LYS CB HB3 sing N N 131 LYS CG CD sing N N 132 LYS CG HG2 sing N N 133 LYS CG HG3 sing N N 134 LYS CD CE sing N N 135 LYS CD HD2 sing N N 136 LYS CD HD3 sing N N 137 LYS CE NZ sing N N 138 LYS CE HE2 sing N N 139 LYS CE HE3 sing N N 140 LYS NZ HZ1 sing N N 141 LYS NZ HZ2 sing N N 142 LYS NZ HZ3 sing N N 143 LYS OXT HXT sing N N 144 NH2 N HN1 sing N N 145 NH2 N HN2 sing N N 146 PHE N CA sing N N 147 PHE N H sing N N 148 PHE N H2 sing N N 149 PHE CA C sing N N 150 PHE CA CB sing N N 151 PHE CA HA sing N N 152 PHE C O doub N N 153 PHE C OXT sing N N 154 PHE CB CG sing N N 155 PHE CB HB2 sing N N 156 PHE CB HB3 sing N N 157 PHE CG CD1 doub Y N 158 PHE CG CD2 sing Y N 159 PHE CD1 CE1 sing Y N 160 PHE CD1 HD1 sing N N 161 PHE CD2 CE2 doub Y N 162 PHE CD2 HD2 sing N N 163 PHE CE1 CZ doub Y N 164 PHE CE1 HE1 sing N N 165 PHE CE2 CZ sing Y N 166 PHE CE2 HE2 sing N N 167 PHE CZ HZ sing N N 168 PHE OXT HXT sing N N 169 PRO N CA sing N N 170 PRO N CD sing N N 171 PRO N H sing N N 172 PRO CA C sing N N 173 PRO CA CB sing N N 174 PRO CA HA sing N N 175 PRO C O doub N N 176 PRO C OXT sing N N 177 PRO CB CG sing N N 178 PRO CB HB2 sing N N 179 PRO CB HB3 sing N N 180 PRO CG CD sing N N 181 PRO CG HG2 sing N N 182 PRO CG HG3 sing N N 183 PRO CD HD2 sing N N 184 PRO CD HD3 sing N N 185 PRO OXT HXT sing N N 186 SER N CA sing N N 187 SER N H sing N N 188 SER N H2 sing N N 189 SER CA C sing N N 190 SER CA CB sing N N 191 SER CA HA sing N N 192 SER C O doub N N 193 SER C OXT sing N N 194 SER CB OG sing N N 195 SER CB HB2 sing N N 196 SER CB HB3 sing N N 197 SER OG HG sing N N 198 SER OXT HXT sing N N 199 THR N CA sing N N 200 THR N H sing N N 201 THR N H2 sing N N 202 THR CA C sing N N 203 THR CA CB sing N N 204 THR CA HA sing N N 205 THR C O doub N N 206 THR C OXT sing N N 207 THR CB OG1 sing N N 208 THR CB CG2 sing N N 209 THR CB HB sing N N 210 THR OG1 HG1 sing N N 211 THR CG2 HG21 sing N N 212 THR CG2 HG22 sing N N 213 THR CG2 HG23 sing N N 214 THR OXT HXT sing N N 215 TRP N CA sing N N 216 TRP N H sing N N 217 TRP N H2 sing N N 218 TRP CA C sing N N 219 TRP CA CB sing N N 220 TRP CA HA sing N N 221 TRP C O doub N N 222 TRP C OXT sing N N 223 TRP CB CG sing N N 224 TRP CB HB2 sing N N 225 TRP CB HB3 sing N N 226 TRP CG CD1 doub Y N 227 TRP CG CD2 sing Y N 228 TRP CD1 NE1 sing Y N 229 TRP CD1 HD1 sing N N 230 TRP CD2 CE2 doub Y N 231 TRP CD2 CE3 sing Y N 232 TRP NE1 CE2 sing Y N 233 TRP NE1 HE1 sing N N 234 TRP CE2 CZ2 sing Y N 235 TRP CE3 CZ3 doub Y N 236 TRP CE3 HE3 sing N N 237 TRP CZ2 CH2 doub Y N 238 TRP CZ2 HZ2 sing N N 239 TRP CZ3 CH2 sing Y N 240 TRP CZ3 HZ3 sing N N 241 TRP CH2 HH2 sing N N 242 TRP OXT HXT sing N N 243 TYR N CA sing N N 244 TYR N H sing N N 245 TYR N H2 sing N N 246 TYR CA C sing N N 247 TYR CA CB sing N N 248 TYR CA HA sing N N 249 TYR C O doub N N 250 TYR C OXT sing N N 251 TYR CB CG sing N N 252 TYR CB HB2 sing N N 253 TYR CB HB3 sing N N 254 TYR CG CD1 doub Y N 255 TYR CG CD2 sing Y N 256 TYR CD1 CE1 sing Y N 257 TYR CD1 HD1 sing N N 258 TYR CD2 CE2 doub Y N 259 TYR CD2 HD2 sing N N 260 TYR CE1 CZ doub Y N 261 TYR CE1 HE1 sing N N 262 TYR CE2 CZ sing Y N 263 TYR CE2 HE2 sing N N 264 TYR CZ OH sing N N 265 TYR OH HH sing N N 266 TYR OXT HXT sing N N 267 VAL N CA sing N N 268 VAL N H sing N N 269 VAL N H2 sing N N 270 VAL CA C sing N N 271 VAL CA CB sing N N 272 VAL CA HA sing N N 273 VAL C O doub N N 274 VAL C OXT sing N N 275 VAL CB CG1 sing N N 276 VAL CB CG2 sing N N 277 VAL CB HB sing N N 278 VAL CG1 HG11 sing N N 279 VAL CG1 HG12 sing N N 280 VAL CG1 HG13 sing N N 281 VAL CG2 HG21 sing N N 282 VAL CG2 HG22 sing N N 283 VAL CG2 HG23 sing N N 284 VAL OXT HXT sing N N 285 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number P20GM103499-20 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details 'TCI H-C/N-D Cryoprobe' # _atom_sites.entry_id 8DJ4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_ #