data_8DW5 # _entry.id 8DW5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8DW5 pdb_00008dw5 10.2210/pdb8dw5/pdb WWPDB D_1000267462 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8DW5 _pdbx_database_status.recvd_initial_deposition_date 2022-07-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Truong, J.Q.' 1 0000-0002-7328-189X 'Holdsworth, B.' 2 0000-0002-4394-252X 'Holien, J.K.' 3 0000-0002-8735-2871 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Molecules _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1420-3049 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structural Analysis of the Complex of Human Transthyretin with 3',5'-Dichlorophenylanthranilic Acid at 1.5 angstrom Resolution. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/molecules27217206 _citation.pdbx_database_id_PubMed 36364032 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cody, V.' 1 ? primary 'Truong, J.Q.' 2 ? primary 'Holdsworth, B.A.' 3 ? primary 'Holien, J.K.' 4 ? primary 'Richardson, S.J.' 5 0000-0002-1708-9430 primary 'Chalmers, D.K.' 6 0000-0003-2366-569X primary 'Craik, D.J.' 7 0000-0003-0007-6796 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8DW5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.198 _cell.length_a_esd ? _cell.length_b 64.079 _cell.length_b_esd ? _cell.length_c 84.529 _cell.length_c_esd ? _cell.volume 223150.359 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8DW5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall 'I 2 2' _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Transthyretin 15516.362 1 ? ? ? ? 2 non-polymer syn '2-[(3,5-dichlorophenyl)amino]benzoic acid' 282.122 1 ? ? ? ? 3 water nat water 18.015 37 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ATTR,Prealbumin,TBPA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRGSHHHHHHGMASMGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFV EGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSHHHHHHGMASMGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFV EGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 MET n 1 13 ALA n 1 14 SER n 1 15 MET n 1 16 GLY n 1 17 PRO n 1 18 THR n 1 19 GLY n 1 20 THR n 1 21 GLY n 1 22 GLU n 1 23 SER n 1 24 LYS n 1 25 CYS n 1 26 PRO n 1 27 LEU n 1 28 MET n 1 29 VAL n 1 30 LYS n 1 31 VAL n 1 32 LEU n 1 33 ASP n 1 34 ALA n 1 35 VAL n 1 36 ARG n 1 37 GLY n 1 38 SER n 1 39 PRO n 1 40 ALA n 1 41 ILE n 1 42 ASN n 1 43 VAL n 1 44 ALA n 1 45 VAL n 1 46 HIS n 1 47 VAL n 1 48 PHE n 1 49 ARG n 1 50 LYS n 1 51 ALA n 1 52 ALA n 1 53 ASP n 1 54 ASP n 1 55 THR n 1 56 TRP n 1 57 GLU n 1 58 PRO n 1 59 PHE n 1 60 ALA n 1 61 SER n 1 62 GLY n 1 63 LYS n 1 64 THR n 1 65 SER n 1 66 GLU n 1 67 SER n 1 68 GLY n 1 69 GLU n 1 70 LEU n 1 71 HIS n 1 72 GLY n 1 73 LEU n 1 74 THR n 1 75 THR n 1 76 GLU n 1 77 GLU n 1 78 GLU n 1 79 PHE n 1 80 VAL n 1 81 GLU n 1 82 GLY n 1 83 ILE n 1 84 TYR n 1 85 LYS n 1 86 VAL n 1 87 GLU n 1 88 ILE n 1 89 ASP n 1 90 THR n 1 91 LYS n 1 92 SER n 1 93 TYR n 1 94 TRP n 1 95 LYS n 1 96 ALA n 1 97 LEU n 1 98 GLY n 1 99 ILE n 1 100 SER n 1 101 PRO n 1 102 PHE n 1 103 HIS n 1 104 GLU n 1 105 HIS n 1 106 ALA n 1 107 GLU n 1 108 VAL n 1 109 VAL n 1 110 PHE n 1 111 THR n 1 112 ALA n 1 113 ASN n 1 114 ASP n 1 115 SER n 1 116 GLY n 1 117 PRO n 1 118 ARG n 1 119 ARG n 1 120 TYR n 1 121 THR n 1 122 ILE n 1 123 ALA n 1 124 ALA n 1 125 LEU n 1 126 LEU n 1 127 SER n 1 128 PRO n 1 129 TYR n 1 130 SER n 1 131 TYR n 1 132 SER n 1 133 THR n 1 134 THR n 1 135 ALA n 1 136 VAL n 1 137 VAL n 1 138 THR n 1 139 ASN n 1 140 PRO n 1 141 LYS n 1 142 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 142 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TTR, PALB' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TTHY_HUMAN _struct_ref.pdbx_db_accession P02766 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWK ALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE ; _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8DW5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 16 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 142 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02766 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 127 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8DW5 MET A 1 ? UNP P02766 ? ? 'initiating methionine' -14 1 1 8DW5 ARG A 2 ? UNP P02766 ? ? 'expression tag' -13 2 1 8DW5 GLY A 3 ? UNP P02766 ? ? 'expression tag' -12 3 1 8DW5 SER A 4 ? UNP P02766 ? ? 'expression tag' -11 4 1 8DW5 HIS A 5 ? UNP P02766 ? ? 'expression tag' -10 5 1 8DW5 HIS A 6 ? UNP P02766 ? ? 'expression tag' -9 6 1 8DW5 HIS A 7 ? UNP P02766 ? ? 'expression tag' -8 7 1 8DW5 HIS A 8 ? UNP P02766 ? ? 'expression tag' -7 8 1 8DW5 HIS A 9 ? UNP P02766 ? ? 'expression tag' -6 9 1 8DW5 HIS A 10 ? UNP P02766 ? ? 'expression tag' -5 10 1 8DW5 GLY A 11 ? UNP P02766 ? ? 'expression tag' -4 11 1 8DW5 MET A 12 ? UNP P02766 ? ? 'expression tag' -3 12 1 8DW5 ALA A 13 ? UNP P02766 ? ? 'expression tag' -2 13 1 8DW5 SER A 14 ? UNP P02766 ? ? 'expression tag' -1 14 1 8DW5 MET A 15 ? UNP P02766 ? ? 'expression tag' 0 15 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FQ7 non-polymer . '2-[(3,5-dichlorophenyl)amino]benzoic acid' ? 'C13 H9 Cl2 N O2' 282.122 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8DW5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.81 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 31.90 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.71 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details 'room temperature' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.3 M sodium citrate pH 5.71, 3% glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-07-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95372 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95372 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate 22.79 _reflns.entry_id 8DW5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.52 _reflns.d_resolution_low 51.06 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17632 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.6 _reflns.pdbx_Rmerge_I_obs 0.119 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.94 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.124 _reflns.pdbx_Rpim_I_all 0.035 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 8.33 51.06 ? 29.8 ? ? ? ? 132 99.2 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 10.3 ? 1.11 ? ? 0.058 0.018 ? 1 1 0.998 ? ? ? ? ? ? ? ? ? ? 1.52 1.55 ? 1.0 ? ? ? ? 859 100 ? ? ? ? 3.931 ? ? ? ? ? ? ? ? 13.0 ? 0.88 ? ? 3.931 1.070 ? 2 1 0.309 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 30.57 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8DW5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.52 _refine.ls_d_res_low 42.26 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17624 _refine.ls_number_reflns_R_free 1763 _refine.ls_number_reflns_R_work 15861 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.94 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2008 _refine.ls_R_factor_R_free 0.2353 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1971 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1THA _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.3662 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2335 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.52 _refine_hist.d_res_low 42.26 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 947 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 892 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0136 ? 949 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.6582 ? 1301 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.1066 ? 146 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0144 ? 166 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.2773 ? 329 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.52 1.56 . . 133 1192 99.85 . . . 0.3677 . 0.3374 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.56 1.61 . . 133 1198 100.00 . . . 0.3121 . 0.3275 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.61 1.66 . . 135 1216 100.00 . . . 0.3777 . 0.3280 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.66 1.72 . . 133 1201 100.00 . . . 0.4015 . 0.3088 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.72 1.79 . . 134 1209 99.93 . . . 0.2974 . 0.2475 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.79 1.87 . . 133 1193 100.00 . . . 0.2542 . 0.2131 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.87 1.97 . . 136 1226 100.00 . . . 0.2522 . 0.1975 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.97 2.09 . . 133 1192 100.00 . . . 0.2139 . 0.1957 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.09 2.25 . . 134 1210 99.85 . . . 0.2132 . 0.1655 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.25 2.48 . . 138 1237 99.93 . . . 0.2189 . 0.1880 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.48 2.84 . . 137 1230 100.00 . . . 0.2416 . 0.1886 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.84 3.57 . . 138 1248 100.00 . . . 0.2072 . 0.1790 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.58 42.26 . . 146 1309 99.79 . . . 0.2197 . 0.1823 . . . . . . . . . . . # _struct.entry_id 8DW5 _struct.title ;Complex of Human Transthyretin with 3',5'-Dichlorophenylanthranilic Acid ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8DW5 _struct_keywords.text 'thyroid hormone distributor protein, amyloidogenic protein, PROTEIN TRANSPORT' _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 89 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 97 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 74 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 82 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 38 ? PRO A 39 ? SER A 23 PRO A 24 AA1 2 LEU A 27 ? ASP A 33 ? LEU A 12 ASP A 18 AA1 3 GLU A 69 ? LEU A 70 ? GLU A 54 LEU A 55 AA2 1 SER A 38 ? PRO A 39 ? SER A 23 PRO A 24 AA2 2 LEU A 27 ? ASP A 33 ? LEU A 12 ASP A 18 AA2 3 ARG A 119 ? SER A 127 ? ARG A 104 SER A 112 AA2 4 SER A 130 ? THR A 138 ? SER A 115 THR A 123 AA3 1 TRP A 56 ? LYS A 63 ? TRP A 41 LYS A 48 AA3 2 ALA A 44 ? LYS A 50 ? ALA A 29 LYS A 35 AA3 3 GLY A 82 ? ILE A 88 ? GLY A 67 ILE A 73 AA3 4 ALA A 106 ? ALA A 112 ? ALA A 91 ALA A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O SER A 38 ? O SER A 23 N ASP A 33 ? N ASP A 18 AA1 2 3 N VAL A 29 ? N VAL A 14 O LEU A 70 ? O LEU A 55 AA2 1 2 O SER A 38 ? O SER A 23 N ASP A 33 ? N ASP A 18 AA2 2 3 N MET A 28 ? N MET A 13 O ILE A 122 ? O ILE A 107 AA2 3 4 N LEU A 125 ? N LEU A 110 O SER A 132 ? O SER A 117 AA3 1 2 O ALA A 60 ? O ALA A 45 N VAL A 47 ? N VAL A 32 AA3 2 3 N HIS A 46 ? N HIS A 31 O GLU A 87 ? O GLU A 72 AA3 3 4 N ILE A 88 ? N ILE A 73 O ALA A 106 ? O ALA A 91 # _atom_sites.entry_id 8DW5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.024273 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015606 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011830 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -14 ? ? ? A . n A 1 2 ARG 2 -13 ? ? ? A . n A 1 3 GLY 3 -12 ? ? ? A . n A 1 4 SER 4 -11 ? ? ? A . n A 1 5 HIS 5 -10 ? ? ? A . n A 1 6 HIS 6 -9 ? ? ? A . n A 1 7 HIS 7 -8 ? ? ? A . n A 1 8 HIS 8 -7 ? ? ? A . n A 1 9 HIS 9 -6 ? ? ? A . n A 1 10 HIS 10 -5 ? ? ? A . n A 1 11 GLY 11 -4 ? ? ? A . n A 1 12 MET 12 -3 ? ? ? A . n A 1 13 ALA 13 -2 ? ? ? A . n A 1 14 SER 14 -1 ? ? ? A . n A 1 15 MET 15 0 ? ? ? A . n A 1 16 GLY 16 1 ? ? ? A . n A 1 17 PRO 17 2 ? ? ? A . n A 1 18 THR 18 3 ? ? ? A . n A 1 19 GLY 19 4 ? ? ? A . n A 1 20 THR 20 5 ? ? ? A . n A 1 21 GLY 21 6 ? ? ? A . n A 1 22 GLU 22 7 ? ? ? A . n A 1 23 SER 23 8 ? ? ? A . n A 1 24 LYS 24 9 ? ? ? A . n A 1 25 CYS 25 10 10 CYS CYS A . n A 1 26 PRO 26 11 11 PRO PRO A . n A 1 27 LEU 27 12 12 LEU LEU A . n A 1 28 MET 28 13 13 MET MET A . n A 1 29 VAL 29 14 14 VAL VAL A . n A 1 30 LYS 30 15 15 LYS LYS A . n A 1 31 VAL 31 16 16 VAL VAL A . n A 1 32 LEU 32 17 17 LEU LEU A . n A 1 33 ASP 33 18 18 ASP ASP A . n A 1 34 ALA 34 19 19 ALA ALA A . n A 1 35 VAL 35 20 20 VAL VAL A . n A 1 36 ARG 36 21 21 ARG ARG A . n A 1 37 GLY 37 22 22 GLY GLY A . n A 1 38 SER 38 23 23 SER SER A . n A 1 39 PRO 39 24 24 PRO PRO A . n A 1 40 ALA 40 25 25 ALA ALA A . n A 1 41 ILE 41 26 26 ILE ILE A . n A 1 42 ASN 42 27 27 ASN ASN A . n A 1 43 VAL 43 28 28 VAL VAL A . n A 1 44 ALA 44 29 29 ALA ALA A . n A 1 45 VAL 45 30 30 VAL VAL A . n A 1 46 HIS 46 31 31 HIS HIS A . n A 1 47 VAL 47 32 32 VAL VAL A . n A 1 48 PHE 48 33 33 PHE PHE A . n A 1 49 ARG 49 34 34 ARG ARG A . n A 1 50 LYS 50 35 35 LYS LYS A . n A 1 51 ALA 51 36 36 ALA ALA A . n A 1 52 ALA 52 37 37 ALA ALA A . n A 1 53 ASP 53 38 38 ASP ASP A . n A 1 54 ASP 54 39 39 ASP ASP A . n A 1 55 THR 55 40 40 THR THR A . n A 1 56 TRP 56 41 41 TRP TRP A . n A 1 57 GLU 57 42 42 GLU GLU A . n A 1 58 PRO 58 43 43 PRO PRO A . n A 1 59 PHE 59 44 44 PHE PHE A . n A 1 60 ALA 60 45 45 ALA ALA A . n A 1 61 SER 61 46 46 SER SER A . n A 1 62 GLY 62 47 47 GLY GLY A . n A 1 63 LYS 63 48 48 LYS LYS A . n A 1 64 THR 64 49 49 THR THR A . n A 1 65 SER 65 50 50 SER SER A . n A 1 66 GLU 66 51 51 GLU GLU A . n A 1 67 SER 67 52 52 SER SER A . n A 1 68 GLY 68 53 53 GLY GLY A . n A 1 69 GLU 69 54 54 GLU GLU A . n A 1 70 LEU 70 55 55 LEU LEU A . n A 1 71 HIS 71 56 56 HIS HIS A . n A 1 72 GLY 72 57 57 GLY GLY A . n A 1 73 LEU 73 58 58 LEU LEU A . n A 1 74 THR 74 59 59 THR THR A . n A 1 75 THR 75 60 60 THR THR A . n A 1 76 GLU 76 61 61 GLU GLU A . n A 1 77 GLU 77 62 62 GLU GLU A . n A 1 78 GLU 78 63 63 GLU GLU A . n A 1 79 PHE 79 64 64 PHE PHE A . n A 1 80 VAL 80 65 65 VAL VAL A . n A 1 81 GLU 81 66 66 GLU GLU A . n A 1 82 GLY 82 67 67 GLY GLY A . n A 1 83 ILE 83 68 68 ILE ILE A . n A 1 84 TYR 84 69 69 TYR TYR A . n A 1 85 LYS 85 70 70 LYS LYS A . n A 1 86 VAL 86 71 71 VAL VAL A . n A 1 87 GLU 87 72 72 GLU GLU A . n A 1 88 ILE 88 73 73 ILE ILE A . n A 1 89 ASP 89 74 74 ASP ASP A . n A 1 90 THR 90 75 75 THR THR A . n A 1 91 LYS 91 76 76 LYS LYS A . n A 1 92 SER 92 77 77 SER SER A . n A 1 93 TYR 93 78 78 TYR TYR A . n A 1 94 TRP 94 79 79 TRP TRP A . n A 1 95 LYS 95 80 80 LYS LYS A . n A 1 96 ALA 96 81 81 ALA ALA A . n A 1 97 LEU 97 82 82 LEU LEU A . n A 1 98 GLY 98 83 83 GLY GLY A . n A 1 99 ILE 99 84 84 ILE ILE A . n A 1 100 SER 100 85 85 SER SER A . n A 1 101 PRO 101 86 86 PRO PRO A . n A 1 102 PHE 102 87 87 PHE PHE A . n A 1 103 HIS 103 88 88 HIS HIS A . n A 1 104 GLU 104 89 89 GLU GLU A . n A 1 105 HIS 105 90 90 HIS HIS A . n A 1 106 ALA 106 91 91 ALA ALA A . n A 1 107 GLU 107 92 92 GLU GLU A . n A 1 108 VAL 108 93 93 VAL VAL A . n A 1 109 VAL 109 94 94 VAL VAL A . n A 1 110 PHE 110 95 95 PHE PHE A . n A 1 111 THR 111 96 96 THR THR A . n A 1 112 ALA 112 97 97 ALA ALA A . n A 1 113 ASN 113 98 98 ASN ASN A . n A 1 114 ASP 114 99 99 ASP ASP A . n A 1 115 SER 115 100 100 SER SER A . n A 1 116 GLY 116 101 101 GLY GLY A . n A 1 117 PRO 117 102 102 PRO PRO A . n A 1 118 ARG 118 103 103 ARG ARG A . n A 1 119 ARG 119 104 104 ARG ARG A . n A 1 120 TYR 120 105 105 TYR TYR A . n A 1 121 THR 121 106 106 THR THR A . n A 1 122 ILE 122 107 107 ILE ILE A . n A 1 123 ALA 123 108 108 ALA ALA A . n A 1 124 ALA 124 109 109 ALA ALA A . n A 1 125 LEU 125 110 110 LEU LEU A . n A 1 126 LEU 126 111 111 LEU LEU A . n A 1 127 SER 127 112 112 SER SER A . n A 1 128 PRO 128 113 113 PRO PRO A . n A 1 129 TYR 129 114 114 TYR TYR A . n A 1 130 SER 130 115 115 SER SER A . n A 1 131 TYR 131 116 116 TYR TYR A . n A 1 132 SER 132 117 117 SER SER A . n A 1 133 THR 133 118 118 THR THR A . n A 1 134 THR 134 119 119 THR THR A . n A 1 135 ALA 135 120 120 ALA ALA A . n A 1 136 VAL 136 121 121 VAL VAL A . n A 1 137 VAL 137 122 122 VAL VAL A . n A 1 138 THR 138 123 123 THR THR A . n A 1 139 ASN 139 124 124 ASN ASN A . n A 1 140 PRO 140 125 125 PRO PRO A . n A 1 141 LYS 141 126 ? ? ? A . n A 1 142 GLU 142 127 ? ? ? A . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email jessica.holien@rmit.edu.au _pdbx_contact_author.name_first Jessica _pdbx_contact_author.name_last Holien _pdbx_contact_author.name_mi K _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8735-2871 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FQ7 1 201 201 FQ7 FQ7 A . C 3 HOH 1 301 37 HOH HOH A . C 3 HOH 2 302 5 HOH HOH A . C 3 HOH 3 303 14 HOH HOH A . C 3 HOH 4 304 26 HOH HOH A . C 3 HOH 5 305 23 HOH HOH A . C 3 HOH 6 306 34 HOH HOH A . C 3 HOH 7 307 25 HOH HOH A . C 3 HOH 8 308 12 HOH HOH A . C 3 HOH 9 309 10 HOH HOH A . C 3 HOH 10 310 18 HOH HOH A . C 3 HOH 11 311 22 HOH HOH A . C 3 HOH 12 312 28 HOH HOH A . C 3 HOH 13 313 39 HOH HOH A . C 3 HOH 14 314 3 HOH HOH A . C 3 HOH 15 315 21 HOH HOH A . C 3 HOH 16 316 2 HOH HOH A . C 3 HOH 17 317 4 HOH HOH A . C 3 HOH 18 318 24 HOH HOH A . C 3 HOH 19 319 13 HOH HOH A . C 3 HOH 20 320 11 HOH HOH A . C 3 HOH 21 321 8 HOH HOH A . C 3 HOH 22 322 27 HOH HOH A . C 3 HOH 23 323 6 HOH HOH A . C 3 HOH 24 324 1 HOH HOH A . C 3 HOH 25 325 20 HOH HOH A . C 3 HOH 26 326 9 HOH HOH A . C 3 HOH 27 327 33 HOH HOH A . C 3 HOH 28 328 15 HOH HOH A . C 3 HOH 29 329 35 HOH HOH A . C 3 HOH 30 330 16 HOH HOH A . C 3 HOH 31 331 7 HOH HOH A . C 3 HOH 32 332 17 HOH HOH A . C 3 HOH 33 333 19 HOH HOH A . C 3 HOH 34 334 38 HOH HOH A . C 3 HOH 35 335 29 HOH HOH A . C 3 HOH 36 336 36 HOH HOH A . C 3 HOH 37 337 30 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 41.1980000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 41.1980000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A FQ7 201 ? B FQ7 . 2 1 A FQ7 201 ? B FQ7 . 3 1 A HOH 303 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-10 2 'Structure model' 1 1 2022-11-30 3 'Structure model' 1 2 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 2 'Structure model' '_citation_author.name' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z 4 -x,-y,z 5 x+1/2,y+1/2,z+1/2 6 x+1/2,-y+1/2,-z+1/2 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? 7.4.0 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.7 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 4 # _pdbx_entry_details.entry_id 8DW5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASN 98 ? ? O A HOH 301 ? ? 2.14 2 1 NH2 A ARG 21 ? ? O A HOH 302 ? ? 2.15 3 1 O A HOH 328 ? ? O A HOH 331 ? ? 2.15 4 1 O A ASP 99 ? ? N A GLY 101 ? ? 2.19 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A LEU 17 ? ? CG A LEU 17 ? ? CD1 A LEU 17 ? ? 93.77 111.00 -17.23 1.70 N 2 1 CG1 A ILE 68 ? ? CB A ILE 68 ? ? CG2 A ILE 68 ? ? 97.19 111.40 -14.21 2.20 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 100 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -53.77 _pdbx_validate_torsion.psi 74.45 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 61 ? CG ? A GLU 76 CG 2 1 Y 1 A GLU 61 ? CD ? A GLU 76 CD 3 1 Y 1 A GLU 61 ? OE1 ? A GLU 76 OE1 4 1 Y 1 A GLU 61 ? OE2 ? A GLU 76 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -14 ? A MET 1 2 1 Y 1 A ARG -13 ? A ARG 2 3 1 Y 1 A GLY -12 ? A GLY 3 4 1 Y 1 A SER -11 ? A SER 4 5 1 Y 1 A HIS -10 ? A HIS 5 6 1 Y 1 A HIS -9 ? A HIS 6 7 1 Y 1 A HIS -8 ? A HIS 7 8 1 Y 1 A HIS -7 ? A HIS 8 9 1 Y 1 A HIS -6 ? A HIS 9 10 1 Y 1 A HIS -5 ? A HIS 10 11 1 Y 1 A GLY -4 ? A GLY 11 12 1 Y 1 A MET -3 ? A MET 12 13 1 Y 1 A ALA -2 ? A ALA 13 14 1 Y 1 A SER -1 ? A SER 14 15 1 Y 1 A MET 0 ? A MET 15 16 1 Y 1 A GLY 1 ? A GLY 16 17 1 Y 1 A PRO 2 ? A PRO 17 18 1 Y 1 A THR 3 ? A THR 18 19 1 Y 1 A GLY 4 ? A GLY 19 20 1 Y 1 A THR 5 ? A THR 20 21 1 Y 1 A GLY 6 ? A GLY 21 22 1 Y 1 A GLU 7 ? A GLU 22 23 1 Y 1 A SER 8 ? A SER 23 24 1 Y 1 A LYS 9 ? A LYS 24 25 1 Y 1 A LYS 126 ? A LYS 141 26 1 Y 1 A GLU 127 ? A GLU 142 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FQ7 C4 C Y N 88 FQ7 C5 C Y N 89 FQ7 C6 C Y N 90 FQ7 N2 N N N 91 FQ7 O2 O N N 92 FQ7 C1A C N N 93 FQ7 O3 O N N 94 FQ7 C1 C Y N 95 FQ7 C3 C Y N 96 FQ7 C2 C Y N 97 FQ7 "C1'" C Y N 98 FQ7 "C2'" C Y N 99 FQ7 "C3'" C Y N 100 FQ7 "CL3'" CL N N 101 FQ7 "C4'" C Y N 102 FQ7 "C5'" C Y N 103 FQ7 "CL5'" CL N N 104 FQ7 "C6'" C Y N 105 FQ7 H1 H N N 106 FQ7 H2 H N N 107 FQ7 H3 H N N 108 FQ7 H4 H N N 109 FQ7 H5 H N N 110 FQ7 H6 H N N 111 FQ7 H7 H N N 112 FQ7 H8 H N N 113 FQ7 H9 H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HIS N N N N 144 HIS CA C N S 145 HIS C C N N 146 HIS O O N N 147 HIS CB C N N 148 HIS CG C Y N 149 HIS ND1 N Y N 150 HIS CD2 C Y N 151 HIS CE1 C Y N 152 HIS NE2 N Y N 153 HIS OXT O N N 154 HIS H H N N 155 HIS H2 H N N 156 HIS HA H N N 157 HIS HB2 H N N 158 HIS HB3 H N N 159 HIS HD1 H N N 160 HIS HD2 H N N 161 HIS HE1 H N N 162 HIS HE2 H N N 163 HIS HXT H N N 164 HOH O O N N 165 HOH H1 H N N 166 HOH H2 H N N 167 ILE N N N N 168 ILE CA C N S 169 ILE C C N N 170 ILE O O N N 171 ILE CB C N S 172 ILE CG1 C N N 173 ILE CG2 C N N 174 ILE CD1 C N N 175 ILE OXT O N N 176 ILE H H N N 177 ILE H2 H N N 178 ILE HA H N N 179 ILE HB H N N 180 ILE HG12 H N N 181 ILE HG13 H N N 182 ILE HG21 H N N 183 ILE HG22 H N N 184 ILE HG23 H N N 185 ILE HD11 H N N 186 ILE HD12 H N N 187 ILE HD13 H N N 188 ILE HXT H N N 189 LEU N N N N 190 LEU CA C N S 191 LEU C C N N 192 LEU O O N N 193 LEU CB C N N 194 LEU CG C N N 195 LEU CD1 C N N 196 LEU CD2 C N N 197 LEU OXT O N N 198 LEU H H N N 199 LEU H2 H N N 200 LEU HA H N N 201 LEU HB2 H N N 202 LEU HB3 H N N 203 LEU HG H N N 204 LEU HD11 H N N 205 LEU HD12 H N N 206 LEU HD13 H N N 207 LEU HD21 H N N 208 LEU HD22 H N N 209 LEU HD23 H N N 210 LEU HXT H N N 211 LYS N N N N 212 LYS CA C N S 213 LYS C C N N 214 LYS O O N N 215 LYS CB C N N 216 LYS CG C N N 217 LYS CD C N N 218 LYS CE C N N 219 LYS NZ N N N 220 LYS OXT O N N 221 LYS H H N N 222 LYS H2 H N N 223 LYS HA H N N 224 LYS HB2 H N N 225 LYS HB3 H N N 226 LYS HG2 H N N 227 LYS HG3 H N N 228 LYS HD2 H N N 229 LYS HD3 H N N 230 LYS HE2 H N N 231 LYS HE3 H N N 232 LYS HZ1 H N N 233 LYS HZ2 H N N 234 LYS HZ3 H N N 235 LYS HXT H N N 236 MET N N N N 237 MET CA C N S 238 MET C C N N 239 MET O O N N 240 MET CB C N N 241 MET CG C N N 242 MET SD S N N 243 MET CE C N N 244 MET OXT O N N 245 MET H H N N 246 MET H2 H N N 247 MET HA H N N 248 MET HB2 H N N 249 MET HB3 H N N 250 MET HG2 H N N 251 MET HG3 H N N 252 MET HE1 H N N 253 MET HE2 H N N 254 MET HE3 H N N 255 MET HXT H N N 256 PHE N N N N 257 PHE CA C N S 258 PHE C C N N 259 PHE O O N N 260 PHE CB C N N 261 PHE CG C Y N 262 PHE CD1 C Y N 263 PHE CD2 C Y N 264 PHE CE1 C Y N 265 PHE CE2 C Y N 266 PHE CZ C Y N 267 PHE OXT O N N 268 PHE H H N N 269 PHE H2 H N N 270 PHE HA H N N 271 PHE HB2 H N N 272 PHE HB3 H N N 273 PHE HD1 H N N 274 PHE HD2 H N N 275 PHE HE1 H N N 276 PHE HE2 H N N 277 PHE HZ H N N 278 PHE HXT H N N 279 PRO N N N N 280 PRO CA C N S 281 PRO C C N N 282 PRO O O N N 283 PRO CB C N N 284 PRO CG C N N 285 PRO CD C N N 286 PRO OXT O N N 287 PRO H H N N 288 PRO HA H N N 289 PRO HB2 H N N 290 PRO HB3 H N N 291 PRO HG2 H N N 292 PRO HG3 H N N 293 PRO HD2 H N N 294 PRO HD3 H N N 295 PRO HXT H N N 296 SER N N N N 297 SER CA C N S 298 SER C C N N 299 SER O O N N 300 SER CB C N N 301 SER OG O N N 302 SER OXT O N N 303 SER H H N N 304 SER H2 H N N 305 SER HA H N N 306 SER HB2 H N N 307 SER HB3 H N N 308 SER HG H N N 309 SER HXT H N N 310 THR N N N N 311 THR CA C N S 312 THR C C N N 313 THR O O N N 314 THR CB C N R 315 THR OG1 O N N 316 THR CG2 C N N 317 THR OXT O N N 318 THR H H N N 319 THR H2 H N N 320 THR HA H N N 321 THR HB H N N 322 THR HG1 H N N 323 THR HG21 H N N 324 THR HG22 H N N 325 THR HG23 H N N 326 THR HXT H N N 327 TRP N N N N 328 TRP CA C N S 329 TRP C C N N 330 TRP O O N N 331 TRP CB C N N 332 TRP CG C Y N 333 TRP CD1 C Y N 334 TRP CD2 C Y N 335 TRP NE1 N Y N 336 TRP CE2 C Y N 337 TRP CE3 C Y N 338 TRP CZ2 C Y N 339 TRP CZ3 C Y N 340 TRP CH2 C Y N 341 TRP OXT O N N 342 TRP H H N N 343 TRP H2 H N N 344 TRP HA H N N 345 TRP HB2 H N N 346 TRP HB3 H N N 347 TRP HD1 H N N 348 TRP HE1 H N N 349 TRP HE3 H N N 350 TRP HZ2 H N N 351 TRP HZ3 H N N 352 TRP HH2 H N N 353 TRP HXT H N N 354 TYR N N N N 355 TYR CA C N S 356 TYR C C N N 357 TYR O O N N 358 TYR CB C N N 359 TYR CG C Y N 360 TYR CD1 C Y N 361 TYR CD2 C Y N 362 TYR CE1 C Y N 363 TYR CE2 C Y N 364 TYR CZ C Y N 365 TYR OH O N N 366 TYR OXT O N N 367 TYR H H N N 368 TYR H2 H N N 369 TYR HA H N N 370 TYR HB2 H N N 371 TYR HB3 H N N 372 TYR HD1 H N N 373 TYR HD2 H N N 374 TYR HE1 H N N 375 TYR HE2 H N N 376 TYR HH H N N 377 TYR HXT H N N 378 VAL N N N N 379 VAL CA C N S 380 VAL C C N N 381 VAL O O N N 382 VAL CB C N N 383 VAL CG1 C N N 384 VAL CG2 C N N 385 VAL OXT O N N 386 VAL H H N N 387 VAL H2 H N N 388 VAL HA H N N 389 VAL HB H N N 390 VAL HG11 H N N 391 VAL HG12 H N N 392 VAL HG13 H N N 393 VAL HG21 H N N 394 VAL HG22 H N N 395 VAL HG23 H N N 396 VAL HXT H N N 397 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FQ7 "CL5'" "C5'" sing N N 83 FQ7 "CL3'" "C3'" sing N N 84 FQ7 "C4'" "C5'" doub Y N 85 FQ7 "C4'" "C3'" sing Y N 86 FQ7 "C5'" "C6'" sing Y N 87 FQ7 "C3'" "C2'" doub Y N 88 FQ7 "C6'" "C1'" doub Y N 89 FQ7 "C2'" "C1'" sing Y N 90 FQ7 "C1'" N2 sing N N 91 FQ7 C3 C2 doub Y N 92 FQ7 C3 C4 sing Y N 93 FQ7 N2 C2 sing N N 94 FQ7 C2 C1 sing Y N 95 FQ7 C4 C5 doub Y N 96 FQ7 C1 C1A sing N N 97 FQ7 C1 C6 doub Y N 98 FQ7 C5 C6 sing Y N 99 FQ7 O3 C1A doub N N 100 FQ7 C1A O2 sing N N 101 FQ7 C4 H1 sing N N 102 FQ7 C5 H2 sing N N 103 FQ7 C6 H3 sing N N 104 FQ7 N2 H4 sing N N 105 FQ7 O2 H5 sing N N 106 FQ7 C3 H6 sing N N 107 FQ7 "C2'" H7 sing N N 108 FQ7 "C4'" H8 sing N N 109 FQ7 "C6'" H9 sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FQ7 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FQ7 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-[(3,5-dichlorophenyl)amino]benzoic acid' FQ7 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1THA _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'I 2 2 2' _space_group.name_Hall 'I 2 2' _space_group.IT_number 23 _space_group.crystal_system orthorhombic _space_group.id 1 #