data_8E2Q # _entry.id 8E2Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8E2Q pdb_00008e2q 10.2210/pdb8e2q/pdb WWPDB D_1000267713 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8E2Q _pdbx_database_status.recvd_initial_deposition_date 2022-08-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Feliciano, P.R.' 1 ? 'Lee, S.J.' 2 ? 'Ciaramella, G.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Biotechnol. _citation.journal_id_ASTM NABIF9 _citation.journal_id_CSD 2119 _citation.journal_id_ISSN 1087-0156 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 41 _citation.language ? _citation.page_first 686 _citation.page_last 697 _citation.title 'Improved cytosine base editors generated from TadA variants.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41587-022-01611-9 _citation.pdbx_database_id_PubMed 36624149 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lam, D.K.' 1 ? primary 'Feliciano, P.R.' 2 ? primary 'Arif, A.' 3 ? primary 'Bohnuud, T.' 4 ? primary 'Fernandez, T.P.' 5 ? primary 'Gehrke, J.M.' 6 ? primary 'Grayson, P.' 7 ? primary 'Lee, K.D.' 8 ? primary 'Ortega, M.A.' 9 ? primary 'Sawyer, C.' 10 ? primary 'Schwaegerle, N.D.' 11 ? primary 'Peraro, L.' 12 ? primary 'Young, L.' 13 ? primary 'Lee, S.J.' 14 ? primary 'Ciaramella, G.' 15 ? primary 'Gaudelli, N.M.' 16 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8E2Q _cell.details ? _cell.formula_units_Z ? _cell.length_a 85.930 _cell.length_a_esd ? _cell.length_b 85.930 _cell.length_b_esd ? _cell.length_c 224.590 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8E2Q _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'tRNA-specific adenosine deaminase 1.17' 18765.682 4 3.5.4.33 ? ? ? 2 polymer syn ;DNA (5'-D(P*GP*CP*GP*GP*CP*TP*(D8A)P*CP*GP*GP*A)-3') ; 3996.587 4 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 4 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 5 water nat water 18.015 131 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MSEVEFSHEYWMRHALALAKRARDEREVPVGAVLVLNNRVIGEGWNRGIGLHDPTAHAEIMALRQGGLVMQNYRLYDATL YTTFEPCVMCAGAMIHSRIGRVVFGVRNAKTGAAGSLMDVLHHPGMNHRVEITEGILADECEALLCRFFRMPRRVFNAQK KAQSSTD ; ;MSEVEFSHEYWMRHALALAKRARDEREVPVGAVLVLNNRVIGEGWNRGIGLHDPTAHAEIMALRQGGLVMQNYRLYDATL YTTFEPCVMCAGAMIHSRIGRVVFGVRNAKTGAAGSLMDVLHHPGMNHRVEITEGILADECEALLCRFFRMPRRVFNAQK KAQSSTD ; A,B,C,D ? 2 polydeoxyribonucleotide no yes '(DG)(DC)(DT)(DC)(DG)(DG)(DC)(DT)(UEL)(DC)(DG)(DG)(DA)' GCTCGGCTXCGGA E,F,G,H ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 VAL n 1 5 GLU n 1 6 PHE n 1 7 SER n 1 8 HIS n 1 9 GLU n 1 10 TYR n 1 11 TRP n 1 12 MET n 1 13 ARG n 1 14 HIS n 1 15 ALA n 1 16 LEU n 1 17 ALA n 1 18 LEU n 1 19 ALA n 1 20 LYS n 1 21 ARG n 1 22 ALA n 1 23 ARG n 1 24 ASP n 1 25 GLU n 1 26 ARG n 1 27 GLU n 1 28 VAL n 1 29 PRO n 1 30 VAL n 1 31 GLY n 1 32 ALA n 1 33 VAL n 1 34 LEU n 1 35 VAL n 1 36 LEU n 1 37 ASN n 1 38 ASN n 1 39 ARG n 1 40 VAL n 1 41 ILE n 1 42 GLY n 1 43 GLU n 1 44 GLY n 1 45 TRP n 1 46 ASN n 1 47 ARG n 1 48 GLY n 1 49 ILE n 1 50 GLY n 1 51 LEU n 1 52 HIS n 1 53 ASP n 1 54 PRO n 1 55 THR n 1 56 ALA n 1 57 HIS n 1 58 ALA n 1 59 GLU n 1 60 ILE n 1 61 MET n 1 62 ALA n 1 63 LEU n 1 64 ARG n 1 65 GLN n 1 66 GLY n 1 67 GLY n 1 68 LEU n 1 69 VAL n 1 70 MET n 1 71 GLN n 1 72 ASN n 1 73 TYR n 1 74 ARG n 1 75 LEU n 1 76 TYR n 1 77 ASP n 1 78 ALA n 1 79 THR n 1 80 LEU n 1 81 TYR n 1 82 THR n 1 83 THR n 1 84 PHE n 1 85 GLU n 1 86 PRO n 1 87 CYS n 1 88 VAL n 1 89 MET n 1 90 CYS n 1 91 ALA n 1 92 GLY n 1 93 ALA n 1 94 MET n 1 95 ILE n 1 96 HIS n 1 97 SER n 1 98 ARG n 1 99 ILE n 1 100 GLY n 1 101 ARG n 1 102 VAL n 1 103 VAL n 1 104 PHE n 1 105 GLY n 1 106 VAL n 1 107 ARG n 1 108 ASN n 1 109 ALA n 1 110 LYS n 1 111 THR n 1 112 GLY n 1 113 ALA n 1 114 ALA n 1 115 GLY n 1 116 SER n 1 117 LEU n 1 118 MET n 1 119 ASP n 1 120 VAL n 1 121 LEU n 1 122 HIS n 1 123 HIS n 1 124 PRO n 1 125 GLY n 1 126 MET n 1 127 ASN n 1 128 HIS n 1 129 ARG n 1 130 VAL n 1 131 GLU n 1 132 ILE n 1 133 THR n 1 134 GLU n 1 135 GLY n 1 136 ILE n 1 137 LEU n 1 138 ALA n 1 139 ASP n 1 140 GLU n 1 141 CYS n 1 142 GLU n 1 143 ALA n 1 144 LEU n 1 145 LEU n 1 146 CYS n 1 147 ARG n 1 148 PHE n 1 149 PHE n 1 150 ARG n 1 151 MET n 1 152 PRO n 1 153 ARG n 1 154 ARG n 1 155 VAL n 1 156 PHE n 1 157 ASN n 1 158 ALA n 1 159 GLN n 1 160 LYS n 1 161 LYS n 1 162 ALA n 1 163 GLN n 1 164 SER n 1 165 SER n 1 166 THR n 1 167 ASP n 2 1 DG n 2 2 DC n 2 3 DT n 2 4 DC n 2 5 DG n 2 6 DG n 2 7 DC n 2 8 DT n 2 9 UEL n 2 10 DC n 2 11 DG n 2 12 DG n 2 13 DA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 167 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene tadA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 13 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP W8T8U5_ECOLX W8T8U5 ? 1 ;MSEVEFSHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVMQNYRLIDATL YVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLHHPGMNHRVEITEGILADECAALLSDFFRMRRQEIKAQK KAQSSTD ; 1 2 PDB 8E2Q 8E2Q ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8E2Q A 1 ? 167 ? W8T8U5 1 ? 167 ? 1 167 2 1 8E2Q B 1 ? 167 ? W8T8U5 1 ? 167 ? 1 167 3 1 8E2Q C 1 ? 167 ? W8T8U5 1 ? 167 ? 1 167 4 1 8E2Q D 1 ? 167 ? W8T8U5 1 ? 167 ? 1 167 5 2 8E2Q E 1 ? 13 ? 8E2Q 1 ? 13 ? 1 13 6 2 8E2Q F 1 ? 13 ? 8E2Q 1 ? 13 ? 1 13 7 2 8E2Q G 1 ? 13 ? 8E2Q 1 ? 13 ? 1 13 8 2 8E2Q H 1 ? 13 ? 8E2Q 1 ? 13 ? 1 13 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8E2Q ALA A 17 ? UNP W8T8U5 THR 17 conflict 17 1 1 8E2Q ARG A 23 ? UNP W8T8U5 TRP 23 conflict 23 2 1 8E2Q LEU A 36 ? UNP W8T8U5 HIS 36 conflict 36 3 1 8E2Q GLY A 48 ? UNP W8T8U5 PRO 48 conflict 48 4 1 8E2Q LEU A 51 ? UNP W8T8U5 ARG 51 conflict 51 5 1 8E2Q TYR A 76 ? UNP W8T8U5 ILE 76 conflict 76 6 1 8E2Q THR A 82 ? UNP W8T8U5 VAL 82 conflict 82 7 1 8E2Q PHE A 84 ? UNP W8T8U5 LEU 84 conflict 84 8 1 8E2Q VAL A 106 ? UNP W8T8U5 ALA 106 conflict 106 9 1 8E2Q ASN A 108 ? UNP W8T8U5 ASP 108 conflict 108 10 1 8E2Q GLU A 142 ? UNP W8T8U5 ALA 142 conflict 142 11 1 8E2Q CYS A 146 ? UNP W8T8U5 SER 146 conflict 146 12 1 8E2Q ARG A 147 ? UNP W8T8U5 ASP 147 conflict 147 13 1 8E2Q PRO A 152 ? UNP W8T8U5 ARG 152 conflict 152 14 1 8E2Q ARG A 154 ? UNP W8T8U5 GLN 154 conflict 154 15 1 8E2Q VAL A 155 ? UNP W8T8U5 GLU 155 conflict 155 16 1 8E2Q PHE A 156 ? UNP W8T8U5 ILE 156 conflict 156 17 1 8E2Q ASN A 157 ? UNP W8T8U5 LYS 157 conflict 157 18 2 8E2Q ALA B 17 ? UNP W8T8U5 THR 17 conflict 17 19 2 8E2Q ARG B 23 ? UNP W8T8U5 TRP 23 conflict 23 20 2 8E2Q LEU B 36 ? UNP W8T8U5 HIS 36 conflict 36 21 2 8E2Q GLY B 48 ? UNP W8T8U5 PRO 48 conflict 48 22 2 8E2Q LEU B 51 ? UNP W8T8U5 ARG 51 conflict 51 23 2 8E2Q TYR B 76 ? UNP W8T8U5 ILE 76 conflict 76 24 2 8E2Q THR B 82 ? UNP W8T8U5 VAL 82 conflict 82 25 2 8E2Q PHE B 84 ? UNP W8T8U5 LEU 84 conflict 84 26 2 8E2Q VAL B 106 ? UNP W8T8U5 ALA 106 conflict 106 27 2 8E2Q ASN B 108 ? UNP W8T8U5 ASP 108 conflict 108 28 2 8E2Q GLU B 142 ? UNP W8T8U5 ALA 142 conflict 142 29 2 8E2Q CYS B 146 ? UNP W8T8U5 SER 146 conflict 146 30 2 8E2Q ARG B 147 ? UNP W8T8U5 ASP 147 conflict 147 31 2 8E2Q PRO B 152 ? UNP W8T8U5 ARG 152 conflict 152 32 2 8E2Q ARG B 154 ? UNP W8T8U5 GLN 154 conflict 154 33 2 8E2Q VAL B 155 ? UNP W8T8U5 GLU 155 conflict 155 34 2 8E2Q PHE B 156 ? UNP W8T8U5 ILE 156 conflict 156 35 2 8E2Q ASN B 157 ? UNP W8T8U5 LYS 157 conflict 157 36 3 8E2Q ALA C 17 ? UNP W8T8U5 THR 17 conflict 17 37 3 8E2Q ARG C 23 ? UNP W8T8U5 TRP 23 conflict 23 38 3 8E2Q LEU C 36 ? UNP W8T8U5 HIS 36 conflict 36 39 3 8E2Q GLY C 48 ? UNP W8T8U5 PRO 48 conflict 48 40 3 8E2Q LEU C 51 ? UNP W8T8U5 ARG 51 conflict 51 41 3 8E2Q TYR C 76 ? UNP W8T8U5 ILE 76 conflict 76 42 3 8E2Q THR C 82 ? UNP W8T8U5 VAL 82 conflict 82 43 3 8E2Q PHE C 84 ? UNP W8T8U5 LEU 84 conflict 84 44 3 8E2Q VAL C 106 ? UNP W8T8U5 ALA 106 conflict 106 45 3 8E2Q ASN C 108 ? UNP W8T8U5 ASP 108 conflict 108 46 3 8E2Q GLU C 142 ? UNP W8T8U5 ALA 142 conflict 142 47 3 8E2Q CYS C 146 ? UNP W8T8U5 SER 146 conflict 146 48 3 8E2Q ARG C 147 ? UNP W8T8U5 ASP 147 conflict 147 49 3 8E2Q PRO C 152 ? UNP W8T8U5 ARG 152 conflict 152 50 3 8E2Q ARG C 154 ? UNP W8T8U5 GLN 154 conflict 154 51 3 8E2Q VAL C 155 ? UNP W8T8U5 GLU 155 conflict 155 52 3 8E2Q PHE C 156 ? UNP W8T8U5 ILE 156 conflict 156 53 3 8E2Q ASN C 157 ? UNP W8T8U5 LYS 157 conflict 157 54 4 8E2Q ALA D 17 ? UNP W8T8U5 THR 17 conflict 17 55 4 8E2Q ARG D 23 ? UNP W8T8U5 TRP 23 conflict 23 56 4 8E2Q LEU D 36 ? UNP W8T8U5 HIS 36 conflict 36 57 4 8E2Q GLY D 48 ? UNP W8T8U5 PRO 48 conflict 48 58 4 8E2Q LEU D 51 ? UNP W8T8U5 ARG 51 conflict 51 59 4 8E2Q TYR D 76 ? UNP W8T8U5 ILE 76 conflict 76 60 4 8E2Q THR D 82 ? UNP W8T8U5 VAL 82 conflict 82 61 4 8E2Q PHE D 84 ? UNP W8T8U5 LEU 84 conflict 84 62 4 8E2Q VAL D 106 ? UNP W8T8U5 ALA 106 conflict 106 63 4 8E2Q ASN D 108 ? UNP W8T8U5 ASP 108 conflict 108 64 4 8E2Q GLU D 142 ? UNP W8T8U5 ALA 142 conflict 142 65 4 8E2Q CYS D 146 ? UNP W8T8U5 SER 146 conflict 146 66 4 8E2Q ARG D 147 ? UNP W8T8U5 ASP 147 conflict 147 67 4 8E2Q PRO D 152 ? UNP W8T8U5 ARG 152 conflict 152 68 4 8E2Q ARG D 154 ? UNP W8T8U5 GLN 154 conflict 154 69 4 8E2Q VAL D 155 ? UNP W8T8U5 GLU 155 conflict 155 70 4 8E2Q PHE D 156 ? UNP W8T8U5 ILE 156 conflict 156 71 4 8E2Q ASN D 157 ? UNP W8T8U5 LYS 157 conflict 157 72 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DA 'DNA linking' y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 DC 'DNA linking' y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.197 DG 'DNA linking' y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 DT 'DNA linking' y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UEL 'DNA linking' . '(7R)-3-(2-deoxy-5-O-phosphono-beta-D-erythro-pentofuranosyl)-6,7-dihydro-3H-[1,2,3]triazolo[4,5-d]pyrimidin-7-ol' ? 'C9 H14 N5 O7 P' 335.211 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8E2Q _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.49 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3,350, tacsimate pH 6' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-04-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9763 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9763 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8E2Q _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.34 _reflns.d_resolution_low 62.03 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 41554 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.991 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.34 _reflns_shell.d_res_low 2.40 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3041 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.470 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 157.430 _refine.B_iso_mean 43.1387 _refine.B_iso_min 18.870 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8E2Q _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3400 _refine.ls_d_res_low 62.0300 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 41494 _refine.ls_number_reflns_R_free 2085 _refine.ls_number_reflns_R_work 39410 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9800 _refine.ls_percent_reflns_R_free 5.0200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1802 _refine.ls_R_factor_R_free 0.2049 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1690 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 224.590 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 8E2P _refine.pdbx_stereochemistry_target_values TWIN_LSQ_F _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.4100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3400 _refine_hist.d_res_low 62.0300 _refine_hist.number_atoms_solvent 131 _refine_hist.number_atoms_total 5940 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 668 _refine_hist.pdbx_B_iso_mean_ligand 46.71 _refine_hist.pdbx_B_iso_mean_solvent 44.45 _refine_hist.pdbx_number_atoms_protein 4817 _refine_hist.pdbx_number_atoms_nucleic_acid 970 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 1696 6.947 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 1696 6.947 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 1696 6.947 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 1696 6.947 ? 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 5 TORSIONAL ? E 276 6.947 ? 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 6 TORSIONAL ? G 276 6.947 ? 2 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 7 TORSIONAL ? H 276 6.947 ? 2 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3400 2.3900 2728 . 168 2560 94.0000 . . . 0.3236 0.0000 0.2764 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.3900 2.4500 2731 . 122 2609 96.0000 . . . 0.3297 0.0000 0.2771 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.4500 2.5200 2724 . 135 2589 95.0000 . . . 0.2883 0.0000 0.2780 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.5200 2.5900 2700 . 166 2534 94.0000 . . . 0.3295 0.0000 0.2704 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.6000 2.6800 2737 . 140 2597 95.0000 . . . 0.2831 0.0000 0.2638 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.6800 2.7700 2737 . 117 2620 96.0000 . . . 0.2908 0.0000 0.2597 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.7700 2.8900 2716 . 138 2578 95.0000 . . . 0.3024 0.0000 0.2371 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.8900 3.0200 2731 . 121 2610 95.0000 . . . 0.2844 0.0000 0.2235 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.0200 3.1800 2775 . 169 2606 94.0000 . . . 0.2387 0.0000 0.2078 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.1800 3.3700 2729 . 129 2600 95.0000 . . . 0.2184 0.0000 0.1923 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.3700 3.6400 2776 . 136 2640 95.0000 . . . 0.2260 0.0000 0.1728 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.6400 4.0000 2766 . 122 2644 96.0000 . . . 0.1798 0.0000 0.1521 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 4.0000 4.5800 2811 . 124 2687 96.0000 . . . 0.1788 0.0000 0.1349 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 4.5800 5.7700 2848 . 103 2745 96.0000 . . . 0.1937 0.0000 0.1313 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 5.7700 62.0300 2985 . 194 2791 93.0000 . . . 0.1545 0.0000 0.1434 . . . . . . . 15 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 6 through 12 or resid 14 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 2 ;(chain B and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 3 ;(chain C and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 4 ;(chain D and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 60 or resid 62 through 63 or resid 65 through 100 or resid 102 through 152 or resid 154 through 155)) ; 2 1 '(chain E and resid 4 through 13)' 2 2 '(chain G and resid 4 through 13)' 2 3 '(chain H and resid 4 through 13)' # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A PHE 6 . A MET 12 . A PHE 6 A MET 12 ? ;(chain A and (resid 6 through 12 or resid 14 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 1 2 A HIS 14 . A ILE 60 . A HIS 14 A ILE 60 ? ;(chain A and (resid 6 through 12 or resid 14 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 1 3 A ALA 62 . A LEU 63 . A ALA 62 A LEU 63 ? ;(chain A and (resid 6 through 12 or resid 14 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 1 4 A GLN 65 . A SER 97 . A GLN 65 A SER 97 ? ;(chain A and (resid 6 through 12 or resid 14 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 1 5 A ARG 98 . A ARG 98 . A ARG 98 A ARG 98 ? ;(chain A and (resid 6 through 12 or resid 14 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 1 6 A VAL 4 . A ASN 157 . A VAL 4 A ASN 157 ? ;(chain A and (resid 6 through 12 or resid 14 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 1 7 A VAL 4 . A ASN 157 . A VAL 4 A ASN 157 ? ;(chain A and (resid 6 through 12 or resid 14 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 1 8 A VAL 4 . A ASN 157 . A VAL 4 A ASN 157 ? ;(chain A and (resid 6 through 12 or resid 14 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 1 9 A VAL 4 . A ASN 157 . A VAL 4 A ASN 157 ? ;(chain A and (resid 6 through 12 or resid 14 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 2 1 B PHE 6 . B MET 12 . B PHE 6 B MET 12 ? ;(chain B and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 2 2 B HIS 14 . B LYS 20 . B HIS 14 B LYS 20 ? ;(chain B and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 2 3 B ARG 21 . B ALA 22 . B ARG 21 B ALA 22 ? ;(chain B and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 2 4 B SER 2 . B LYS 161 . B SER 2 B LYS 161 ? ;(chain B and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 2 5 B SER 2 . B LYS 161 . B SER 2 B LYS 161 ? ;(chain B and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 2 6 B SER 2 . B LYS 161 . B SER 2 B LYS 161 ? ;(chain B and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 2 7 B SER 2 . B LYS 161 . B SER 2 B LYS 161 ? ;(chain B and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 108 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 3 1 C PHE 6 . C MET 12 . C PHE 6 C MET 12 ? ;(chain C and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 3 2 C HIS 14 . C LYS 20 . C HIS 14 C LYS 20 ? ;(chain C and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 3 3 C ARG 21 . C ALA 22 . C ARG 21 C ALA 22 ? ;(chain C and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 3 4 C VAL 4 . L GOL . . C VAL 4 C GOL 201 ? ;(chain C and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 3 5 C VAL 4 . L GOL . . C VAL 4 C GOL 201 ? ;(chain C and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 3 6 C VAL 4 . L GOL . . C VAL 4 C GOL 201 ? ;(chain C and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 3 7 C VAL 4 . L GOL . . C VAL 4 C GOL 201 ? ;(chain C and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 38 or (resid 39 and (name N or name CA or name C or name O or name CB )) or resid 40 through 60 or resid 62 through 63 or resid 65 through 97 or (resid 98 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 99 through 100 or resid 102 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB )) or resid 128 through 152 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )))) ; 1 4 1 D PHE 6 . D MET 12 . D PHE 6 D MET 12 ? ;(chain D and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 60 or resid 62 through 63 or resid 65 through 100 or resid 102 through 152 or resid 154 through 155)) ; 1 4 2 D HIS 14 . D LYS 20 . D HIS 14 D LYS 20 ? ;(chain D and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 60 or resid 62 through 63 or resid 65 through 100 or resid 102 through 152 or resid 154 through 155)) ; 1 4 3 D ARG 21 . D ALA 22 . D ARG 21 D ALA 22 ? ;(chain D and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 60 or resid 62 through 63 or resid 65 through 100 or resid 102 through 152 or resid 154 through 155)) ; 1 4 4 D GLU 3 . D PHE 156 . D GLU 3 D PHE 156 ? ;(chain D and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 60 or resid 62 through 63 or resid 65 through 100 or resid 102 through 152 or resid 154 through 155)) ; 1 4 5 D GLU 3 . D PHE 156 . D GLU 3 D PHE 156 ? ;(chain D and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 60 or resid 62 through 63 or resid 65 through 100 or resid 102 through 152 or resid 154 through 155)) ; 1 4 6 D GLU 3 . D PHE 156 . D GLU 3 D PHE 156 ? ;(chain D and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 60 or resid 62 through 63 or resid 65 through 100 or resid 102 through 152 or resid 154 through 155)) ; 1 4 7 D GLU 3 . D PHE 156 . D GLU 3 D PHE 156 ? ;(chain D and (resid 6 through 12 or resid 14 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 60 or resid 62 through 63 or resid 65 through 100 or resid 102 through 152 or resid 154 through 155)) ; 2 1 1 E DC 4 . E DA 13 . E DC 4 E DA 13 ? '(chain E and resid 4 through 13)' 2 2 1 G DC 4 . G DA 13 . G DC 4 G DA 13 ? '(chain G and resid 4 through 13)' 2 3 1 H DC 4 . H DA 13 . H DC 4 H DA 13 ? '(chain H and resid 4 through 13)' # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? # _struct.entry_id 8E2Q _struct.title 'Crystal structure of TadAC-1.17 in a complex with ssDNA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8E2Q _struct_keywords.text 'deaminase, ssDNA, TadAC, DNA BINDING PROTEIN, DNA BINDING PROTEIN-DNA complex' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN/DNA' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 3 ? J N N 4 ? K N N 3 ? L N N 4 ? M N N 3 ? N N N 4 ? O N N 3 ? P N N 5 ? Q N N 5 ? R N N 5 ? S N N 5 ? T N N 5 ? U N N 5 ? V N N 5 ? W N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 7 ? GLU A 25 ? SER A 7 GLU A 25 1 ? 19 HELX_P HELX_P2 AA2 ARG A 47 ? HIS A 52 ? ARG A 47 HIS A 52 1 ? 6 HELX_P HELX_P3 AA3 HIS A 57 ? GLN A 71 ? HIS A 57 GLN A 71 1 ? 15 HELX_P HELX_P4 AA4 CYS A 87 ? ARG A 98 ? CYS A 87 ARG A 98 1 ? 12 HELX_P HELX_P5 AA5 LEU A 137 ? PHE A 149 ? LEU A 137 PHE A 149 1 ? 13 HELX_P HELX_P6 AA6 SER B 7 ? GLU B 25 ? SER B 7 GLU B 25 1 ? 19 HELX_P HELX_P7 AA7 ARG B 47 ? HIS B 52 ? ARG B 47 HIS B 52 1 ? 6 HELX_P HELX_P8 AA8 HIS B 57 ? GLN B 71 ? HIS B 57 GLN B 71 1 ? 15 HELX_P HELX_P9 AA9 CYS B 87 ? ARG B 98 ? CYS B 87 ARG B 98 1 ? 12 HELX_P HELX_P10 AB1 LEU B 137 ? PHE B 149 ? LEU B 137 PHE B 149 1 ? 13 HELX_P HELX_P11 AB2 PRO B 152 ? PHE B 156 ? PRO B 152 PHE B 156 5 ? 5 HELX_P HELX_P12 AB3 ASN B 157 ? LYS B 161 ? ASN B 157 LYS B 161 5 ? 5 HELX_P HELX_P13 AB4 SER C 7 ? GLU C 25 ? SER C 7 GLU C 25 1 ? 19 HELX_P HELX_P14 AB5 ARG C 47 ? HIS C 52 ? ARG C 47 HIS C 52 1 ? 6 HELX_P HELX_P15 AB6 HIS C 57 ? GLN C 71 ? HIS C 57 GLN C 71 1 ? 15 HELX_P HELX_P16 AB7 CYS C 87 ? ARG C 98 ? CYS C 87 ARG C 98 1 ? 12 HELX_P HELX_P17 AB8 LEU C 137 ? ARG C 150 ? LEU C 137 ARG C 150 1 ? 14 HELX_P HELX_P18 AB9 SER D 7 ? GLU D 25 ? SER D 7 GLU D 25 1 ? 19 HELX_P HELX_P19 AC1 ARG D 47 ? HIS D 52 ? ARG D 47 HIS D 52 1 ? 6 HELX_P HELX_P20 AC2 HIS D 57 ? GLN D 71 ? HIS D 57 GLN D 71 1 ? 15 HELX_P HELX_P21 AC3 CYS D 87 ? ARG D 98 ? CYS D 87 ARG D 98 1 ? 12 HELX_P HELX_P22 AC4 LEU D 137 ? PHE D 149 ? LEU D 137 PHE D 149 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? E DT 8 "O3'" ? ? ? 1_555 E UEL 9 P ? ? E DT 8 E UEL 9 1_555 ? ? ? ? ? ? ? 1.605 ? ? covale2 covale both ? E UEL 9 "O3'" ? ? ? 1_555 E DC 10 P ? ? E UEL 9 E DC 10 1_555 ? ? ? ? ? ? ? 1.605 ? ? covale3 covale both ? F DT 8 "O3'" ? ? ? 1_555 F UEL 9 P ? ? F DT 8 F UEL 9 1_555 ? ? ? ? ? ? ? 1.604 ? ? covale4 covale both ? F UEL 9 "O3'" ? ? ? 1_555 F DC 10 P ? ? F UEL 9 F DC 10 1_555 ? ? ? ? ? ? ? 1.599 ? ? covale5 covale both ? G DT 8 "O3'" ? ? ? 1_555 G UEL 9 P ? ? G DT 8 G UEL 9 1_555 ? ? ? ? ? ? ? 1.603 ? ? covale6 covale both ? G UEL 9 "O3'" ? ? ? 1_555 G DC 10 P ? ? G UEL 9 G DC 10 1_555 ? ? ? ? ? ? ? 1.602 ? ? covale7 covale both ? H DT 8 "O3'" ? ? ? 1_555 H UEL 9 P ? ? H DT 8 H UEL 9 1_555 ? ? ? ? ? ? ? 1.603 ? ? covale8 covale both ? H UEL 9 "O3'" ? ? ? 1_555 H DC 10 P ? ? H UEL 9 H DC 10 1_555 ? ? ? ? ? ? ? 1.606 ? ? metalc1 metalc ? ? A HIS 57 ND1 ? ? ? 1_555 I ZN . ZN ? ? A HIS 57 A ZN 201 1_555 ? ? ? ? ? ? ? 2.023 ? ? metalc2 metalc ? ? A CYS 87 SG ? ? ? 1_555 I ZN . ZN ? ? A CYS 87 A ZN 201 1_555 ? ? ? ? ? ? ? 2.158 ? ? metalc3 metalc ? ? A CYS 90 SG ? ? ? 1_555 I ZN . ZN ? ? A CYS 90 A ZN 201 1_555 ? ? ? ? ? ? ? 2.038 ? ? metalc4 metalc ? ? I ZN . ZN ? ? ? 1_555 E UEL 9 O6 ? ? A ZN 201 E UEL 9 1_555 ? ? ? ? ? ? ? 2.079 ? ? metalc5 metalc ? ? B HIS 57 ND1 ? ? ? 1_555 K ZN . ZN ? ? B HIS 57 B ZN 202 1_555 ? ? ? ? ? ? ? 2.030 ? ? metalc6 metalc ? ? B CYS 87 SG ? ? ? 1_555 K ZN . ZN ? ? B CYS 87 B ZN 202 1_555 ? ? ? ? ? ? ? 2.175 ? ? metalc7 metalc ? ? B CYS 90 SG ? ? ? 1_555 K ZN . ZN ? ? B CYS 90 B ZN 202 1_555 ? ? ? ? ? ? ? 2.048 ? ? metalc8 metalc ? ? K ZN . ZN ? ? ? 1_555 F UEL 9 O6 ? ? B ZN 202 F UEL 9 1_555 ? ? ? ? ? ? ? 2.170 ? ? metalc9 metalc ? ? C HIS 57 ND1 ? ? ? 1_555 M ZN . ZN ? ? C HIS 57 C ZN 202 1_555 ? ? ? ? ? ? ? 2.049 ? ? metalc10 metalc ? ? C CYS 87 SG ? ? ? 1_555 M ZN . ZN ? ? C CYS 87 C ZN 202 1_555 ? ? ? ? ? ? ? 2.273 ? ? metalc11 metalc ? ? C CYS 90 SG ? ? ? 1_555 M ZN . ZN ? ? C CYS 90 C ZN 202 1_555 ? ? ? ? ? ? ? 2.133 ? ? metalc12 metalc ? ? M ZN . ZN ? ? ? 1_555 G UEL 9 O6 ? ? C ZN 202 G UEL 9 1_555 ? ? ? ? ? ? ? 1.962 ? ? metalc13 metalc ? ? D HIS 57 ND1 ? ? ? 1_555 O ZN . ZN ? ? D HIS 57 D ZN 202 1_555 ? ? ? ? ? ? ? 2.049 ? ? metalc14 metalc ? ? D CYS 87 SG ? ? ? 1_555 O ZN . ZN ? ? D CYS 87 D ZN 202 1_555 ? ? ? ? ? ? ? 2.149 ? ? metalc15 metalc ? ? D CYS 90 SG ? ? ? 1_555 O ZN . ZN ? ? D CYS 90 D ZN 202 1_555 ? ? ? ? ? ? ? 2.105 ? ? metalc16 metalc ? ? O ZN . ZN ? ? ? 1_555 H UEL 9 O6 ? ? D ZN 202 H UEL 9 1_555 ? ? ? ? ? ? ? 1.976 ? ? hydrog1 hydrog ? ? E DG 1 N1 ? ? ? 1_555 E DC 7 N3 ? ? E DG 1 E DC 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog2 hydrog ? ? E DG 1 N2 ? ? ? 1_555 E DC 7 O2 ? ? E DG 1 E DC 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog3 hydrog ? ? E DG 1 O6 ? ? ? 1_555 E DC 7 N4 ? ? E DG 1 E DC 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog4 hydrog ? ? E DC 4 N3 ? ? ? 1_555 E DG 11 N1 ? ? E DC 4 E DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog5 hydrog ? ? E DC 4 N4 ? ? ? 1_555 E DG 11 O6 ? ? E DC 4 E DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog6 hydrog ? ? E DC 4 O2 ? ? ? 1_555 E DG 11 N2 ? ? E DC 4 E DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog7 hydrog ? ? E DG 5 N1 ? ? ? 1_555 E DC 10 N3 ? ? E DG 5 E DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog8 hydrog ? ? E DG 5 N2 ? ? ? 1_555 E DC 10 O2 ? ? E DG 5 E DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog9 hydrog ? ? E DG 5 O6 ? ? ? 1_555 E DC 10 N4 ? ? E DG 5 E DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog10 hydrog ? ? E DG 6 N2 ? ? ? 1_555 E DA 13 N1 ? ? E DG 6 E DA 13 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? ? hydrog11 hydrog ? ? E DG 6 N3 ? ? ? 1_555 E DA 13 N6 ? ? E DG 6 E DA 13 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? ? hydrog12 hydrog ? ? F DG 1 N1 ? ? ? 1_555 F DC 7 N3 ? ? F DG 1 F DC 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog13 hydrog ? ? F DG 1 N2 ? ? ? 1_555 F DC 7 O2 ? ? F DG 1 F DC 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog14 hydrog ? ? F DG 1 O6 ? ? ? 1_555 F DC 7 N4 ? ? F DG 1 F DC 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog15 hydrog ? ? F DC 4 N3 ? ? ? 1_555 F DG 11 N1 ? ? F DC 4 F DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog16 hydrog ? ? F DC 4 N4 ? ? ? 1_555 F DG 11 O6 ? ? F DC 4 F DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog17 hydrog ? ? F DC 4 O2 ? ? ? 1_555 F DG 11 N2 ? ? F DC 4 F DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog18 hydrog ? ? F DG 5 N1 ? ? ? 1_555 F DC 10 N3 ? ? F DG 5 F DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog19 hydrog ? ? F DG 5 N2 ? ? ? 1_555 F DC 10 O2 ? ? F DG 5 F DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog20 hydrog ? ? F DG 5 O6 ? ? ? 1_555 F DC 10 N4 ? ? F DG 5 F DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog21 hydrog ? ? F DG 6 N2 ? ? ? 1_555 F DA 13 N1 ? ? F DG 6 F DA 13 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? ? hydrog22 hydrog ? ? F DG 6 N3 ? ? ? 1_555 F DA 13 N6 ? ? F DG 6 F DA 13 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? ? hydrog23 hydrog ? ? G DC 4 N3 ? ? ? 1_555 G DG 11 N1 ? ? G DC 4 G DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog24 hydrog ? ? G DC 4 N4 ? ? ? 1_555 G DG 11 O6 ? ? G DC 4 G DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog25 hydrog ? ? G DC 4 O2 ? ? ? 1_555 G DG 11 N2 ? ? G DC 4 G DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog26 hydrog ? ? G DG 5 N1 ? ? ? 1_555 G DC 10 N3 ? ? G DG 5 G DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog27 hydrog ? ? G DG 5 N2 ? ? ? 1_555 G DC 10 O2 ? ? G DG 5 G DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog28 hydrog ? ? G DG 5 O6 ? ? ? 1_555 G DC 10 N4 ? ? G DG 5 G DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog29 hydrog ? ? G DG 6 N2 ? ? ? 1_555 G DA 13 N1 ? ? G DG 6 G DA 13 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? ? hydrog30 hydrog ? ? G DG 6 N3 ? ? ? 1_555 G DA 13 N6 ? ? G DG 6 G DA 13 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? ? hydrog31 hydrog ? ? H DC 4 N3 ? ? ? 1_555 H DG 11 N1 ? ? H DC 4 H DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog32 hydrog ? ? H DC 4 N4 ? ? ? 1_555 H DG 11 O6 ? ? H DC 4 H DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog33 hydrog ? ? H DC 4 O2 ? ? ? 1_555 H DG 11 N2 ? ? H DC 4 H DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog34 hydrog ? ? H DG 5 N1 ? ? ? 1_555 H DC 10 N3 ? ? H DG 5 H DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog35 hydrog ? ? H DG 5 N2 ? ? ? 1_555 H DC 10 O2 ? ? H DG 5 H DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog36 hydrog ? ? H DG 5 O6 ? ? ? 1_555 H DC 10 N4 ? ? H DG 5 H DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog37 hydrog ? ? H DG 6 N2 ? ? ? 1_555 H DA 13 N1 ? ? H DG 6 H DA 13 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? ? hydrog38 hydrog ? ? H DG 6 N3 ? ? ? 1_555 H DA 13 N6 ? ? H DG 6 H DA 13 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? hydrog ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? AA3 ? 5 ? AA4 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? parallel AA3 4 5 ? parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? parallel AA4 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 39 ? TRP A 45 ? ARG A 39 TRP A 45 AA1 2 GLY A 31 ? LEU A 36 ? GLY A 31 LEU A 36 AA1 3 THR A 79 ? PHE A 84 ? THR A 79 PHE A 84 AA1 4 ARG A 101 ? VAL A 106 ? ARG A 101 VAL A 106 AA1 5 GLU A 131 ? GLU A 134 ? GLU A 131 GLU A 134 AA2 1 VAL B 40 ? TRP B 45 ? VAL B 40 TRP B 45 AA2 2 GLY B 31 ? VAL B 35 ? GLY B 31 VAL B 35 AA2 3 THR B 79 ? PHE B 84 ? THR B 79 PHE B 84 AA2 4 ARG B 101 ? VAL B 106 ? ARG B 101 VAL B 106 AA2 5 GLU B 131 ? GLU B 134 ? GLU B 131 GLU B 134 AA3 1 ARG C 39 ? TRP C 45 ? ARG C 39 TRP C 45 AA3 2 GLY C 31 ? LEU C 36 ? GLY C 31 LEU C 36 AA3 3 THR C 79 ? PHE C 84 ? THR C 79 PHE C 84 AA3 4 ARG C 101 ? VAL C 106 ? ARG C 101 VAL C 106 AA3 5 GLU C 131 ? GLU C 134 ? GLU C 131 GLU C 134 AA4 1 ARG D 39 ? TRP D 45 ? ARG D 39 TRP D 45 AA4 2 GLY D 31 ? LEU D 36 ? GLY D 31 LEU D 36 AA4 3 THR D 79 ? PHE D 84 ? THR D 79 PHE D 84 AA4 4 ARG D 101 ? VAL D 106 ? ARG D 101 VAL D 106 AA4 5 GLU D 131 ? GLU D 134 ? GLU D 131 GLU D 134 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 42 ? O GLY A 42 N LEU A 34 ? N LEU A 34 AA1 2 3 N VAL A 35 ? N VAL A 35 O THR A 79 ? O THR A 79 AA1 3 4 N LEU A 80 ? N LEU A 80 O VAL A 103 ? O VAL A 103 AA1 4 5 N VAL A 102 ? N VAL A 102 O GLU A 131 ? O GLU A 131 AA2 1 2 O GLY B 42 ? O GLY B 42 N LEU B 34 ? N LEU B 34 AA2 2 3 N VAL B 33 ? N VAL B 33 O TYR B 81 ? O TYR B 81 AA2 3 4 N LEU B 80 ? N LEU B 80 O VAL B 103 ? O VAL B 103 AA2 4 5 N VAL B 102 ? N VAL B 102 O GLU B 131 ? O GLU B 131 AA3 1 2 O GLY C 42 ? O GLY C 42 N LEU C 34 ? N LEU C 34 AA3 2 3 N VAL C 33 ? N VAL C 33 O TYR C 81 ? O TYR C 81 AA3 3 4 N LEU C 80 ? N LEU C 80 O VAL C 103 ? O VAL C 103 AA3 4 5 N VAL C 102 ? N VAL C 102 O GLU C 131 ? O GLU C 131 AA4 1 2 O GLY D 42 ? O GLY D 42 N LEU D 34 ? N LEU D 34 AA4 2 3 N VAL D 35 ? N VAL D 35 O THR D 79 ? O THR D 79 AA4 3 4 N LEU D 80 ? N LEU D 80 O VAL D 103 ? O VAL D 103 AA4 4 5 N VAL D 102 ? N VAL D 102 O GLU D 131 ? O GLU D 131 # _atom_sites.entry_id 8E2Q _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011637 _atom_sites.fract_transf_matrix[1][2] 0.006719 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013438 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004453 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 TRP 45 45 45 TRP TRP A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 CYS 141 141 141 CYS CYS A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 CYS 146 146 146 CYS CYS A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 MET 151 151 151 MET MET A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 ALA 158 158 ? ? ? A . n A 1 159 GLN 159 159 ? ? ? A . n A 1 160 LYS 160 160 ? ? ? A . n A 1 161 LYS 161 161 ? ? ? A . n A 1 162 ALA 162 162 ? ? ? A . n A 1 163 GLN 163 163 ? ? ? A . n A 1 164 SER 164 164 ? ? ? A . n A 1 165 SER 165 165 ? ? ? A . n A 1 166 THR 166 166 ? ? ? A . n A 1 167 ASP 167 167 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 GLU 3 3 3 GLU GLU B . n B 1 4 VAL 4 4 4 VAL VAL B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 PHE 6 6 6 PHE PHE B . n B 1 7 SER 7 7 7 SER SER B . n B 1 8 HIS 8 8 8 HIS HIS B . n B 1 9 GLU 9 9 9 GLU GLU B . n B 1 10 TYR 10 10 10 TYR TYR B . n B 1 11 TRP 11 11 11 TRP TRP B . n B 1 12 MET 12 12 12 MET MET B . n B 1 13 ARG 13 13 13 ARG ARG B . n B 1 14 HIS 14 14 14 HIS HIS B . n B 1 15 ALA 15 15 15 ALA ALA B . n B 1 16 LEU 16 16 16 LEU LEU B . n B 1 17 ALA 17 17 17 ALA ALA B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 ALA 19 19 19 ALA ALA B . n B 1 20 LYS 20 20 20 LYS LYS B . n B 1 21 ARG 21 21 21 ARG ARG B . n B 1 22 ALA 22 22 22 ALA ALA B . n B 1 23 ARG 23 23 23 ARG ARG B . n B 1 24 ASP 24 24 24 ASP ASP B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 ARG 26 26 26 ARG ARG B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 VAL 28 28 28 VAL VAL B . n B 1 29 PRO 29 29 29 PRO PRO B . n B 1 30 VAL 30 30 30 VAL VAL B . n B 1 31 GLY 31 31 31 GLY GLY B . n B 1 32 ALA 32 32 32 ALA ALA B . n B 1 33 VAL 33 33 33 VAL VAL B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 VAL 35 35 35 VAL VAL B . n B 1 36 LEU 36 36 36 LEU LEU B . n B 1 37 ASN 37 37 37 ASN ASN B . n B 1 38 ASN 38 38 38 ASN ASN B . n B 1 39 ARG 39 39 39 ARG ARG B . n B 1 40 VAL 40 40 40 VAL VAL B . n B 1 41 ILE 41 41 41 ILE ILE B . n B 1 42 GLY 42 42 42 GLY GLY B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 GLY 44 44 44 GLY GLY B . n B 1 45 TRP 45 45 45 TRP TRP B . n B 1 46 ASN 46 46 46 ASN ASN B . n B 1 47 ARG 47 47 47 ARG ARG B . n B 1 48 GLY 48 48 48 GLY GLY B . n B 1 49 ILE 49 49 49 ILE ILE B . n B 1 50 GLY 50 50 50 GLY GLY B . n B 1 51 LEU 51 51 51 LEU LEU B . n B 1 52 HIS 52 52 52 HIS HIS B . n B 1 53 ASP 53 53 53 ASP ASP B . n B 1 54 PRO 54 54 54 PRO PRO B . n B 1 55 THR 55 55 55 THR THR B . n B 1 56 ALA 56 56 56 ALA ALA B . n B 1 57 HIS 57 57 57 HIS HIS B . n B 1 58 ALA 58 58 58 ALA ALA B . n B 1 59 GLU 59 59 59 GLU GLU B . n B 1 60 ILE 60 60 60 ILE ILE B . n B 1 61 MET 61 61 61 MET MET B . n B 1 62 ALA 62 62 62 ALA ALA B . n B 1 63 LEU 63 63 63 LEU LEU B . n B 1 64 ARG 64 64 64 ARG ARG B . n B 1 65 GLN 65 65 65 GLN GLN B . n B 1 66 GLY 66 66 66 GLY GLY B . n B 1 67 GLY 67 67 67 GLY GLY B . n B 1 68 LEU 68 68 68 LEU LEU B . n B 1 69 VAL 69 69 69 VAL VAL B . n B 1 70 MET 70 70 70 MET MET B . n B 1 71 GLN 71 71 71 GLN GLN B . n B 1 72 ASN 72 72 72 ASN ASN B . n B 1 73 TYR 73 73 73 TYR TYR B . n B 1 74 ARG 74 74 74 ARG ARG B . n B 1 75 LEU 75 75 75 LEU LEU B . n B 1 76 TYR 76 76 76 TYR TYR B . n B 1 77 ASP 77 77 77 ASP ASP B . n B 1 78 ALA 78 78 78 ALA ALA B . n B 1 79 THR 79 79 79 THR THR B . n B 1 80 LEU 80 80 80 LEU LEU B . n B 1 81 TYR 81 81 81 TYR TYR B . n B 1 82 THR 82 82 82 THR THR B . n B 1 83 THR 83 83 83 THR THR B . n B 1 84 PHE 84 84 84 PHE PHE B . n B 1 85 GLU 85 85 85 GLU GLU B . n B 1 86 PRO 86 86 86 PRO PRO B . n B 1 87 CYS 87 87 87 CYS CYS B . n B 1 88 VAL 88 88 88 VAL VAL B . n B 1 89 MET 89 89 89 MET MET B . n B 1 90 CYS 90 90 90 CYS CYS B . n B 1 91 ALA 91 91 91 ALA ALA B . n B 1 92 GLY 92 92 92 GLY GLY B . n B 1 93 ALA 93 93 93 ALA ALA B . n B 1 94 MET 94 94 94 MET MET B . n B 1 95 ILE 95 95 95 ILE ILE B . n B 1 96 HIS 96 96 96 HIS HIS B . n B 1 97 SER 97 97 97 SER SER B . n B 1 98 ARG 98 98 98 ARG ARG B . n B 1 99 ILE 99 99 99 ILE ILE B . n B 1 100 GLY 100 100 100 GLY GLY B . n B 1 101 ARG 101 101 101 ARG ARG B . n B 1 102 VAL 102 102 102 VAL VAL B . n B 1 103 VAL 103 103 103 VAL VAL B . n B 1 104 PHE 104 104 104 PHE PHE B . n B 1 105 GLY 105 105 105 GLY GLY B . n B 1 106 VAL 106 106 106 VAL VAL B . n B 1 107 ARG 107 107 107 ARG ARG B . n B 1 108 ASN 108 108 108 ASN ASN B . n B 1 109 ALA 109 109 109 ALA ALA B . n B 1 110 LYS 110 110 110 LYS LYS B . n B 1 111 THR 111 111 111 THR THR B . n B 1 112 GLY 112 112 112 GLY GLY B . n B 1 113 ALA 113 113 113 ALA ALA B . n B 1 114 ALA 114 114 114 ALA ALA B . n B 1 115 GLY 115 115 115 GLY GLY B . n B 1 116 SER 116 116 116 SER SER B . n B 1 117 LEU 117 117 117 LEU LEU B . n B 1 118 MET 118 118 118 MET MET B . n B 1 119 ASP 119 119 119 ASP ASP B . n B 1 120 VAL 120 120 120 VAL VAL B . n B 1 121 LEU 121 121 121 LEU LEU B . n B 1 122 HIS 122 122 122 HIS HIS B . n B 1 123 HIS 123 123 123 HIS HIS B . n B 1 124 PRO 124 124 124 PRO PRO B . n B 1 125 GLY 125 125 125 GLY GLY B . n B 1 126 MET 126 126 126 MET MET B . n B 1 127 ASN 127 127 127 ASN ASN B . n B 1 128 HIS 128 128 128 HIS HIS B . n B 1 129 ARG 129 129 129 ARG ARG B . n B 1 130 VAL 130 130 130 VAL VAL B . n B 1 131 GLU 131 131 131 GLU GLU B . n B 1 132 ILE 132 132 132 ILE ILE B . n B 1 133 THR 133 133 133 THR THR B . n B 1 134 GLU 134 134 134 GLU GLU B . n B 1 135 GLY 135 135 135 GLY GLY B . n B 1 136 ILE 136 136 136 ILE ILE B . n B 1 137 LEU 137 137 137 LEU LEU B . n B 1 138 ALA 138 138 138 ALA ALA B . n B 1 139 ASP 139 139 139 ASP ASP B . n B 1 140 GLU 140 140 140 GLU GLU B . n B 1 141 CYS 141 141 141 CYS CYS B . n B 1 142 GLU 142 142 142 GLU GLU B . n B 1 143 ALA 143 143 143 ALA ALA B . n B 1 144 LEU 144 144 144 LEU LEU B . n B 1 145 LEU 145 145 145 LEU LEU B . n B 1 146 CYS 146 146 146 CYS CYS B . n B 1 147 ARG 147 147 147 ARG ARG B . n B 1 148 PHE 148 148 148 PHE PHE B . n B 1 149 PHE 149 149 149 PHE PHE B . n B 1 150 ARG 150 150 150 ARG ARG B . n B 1 151 MET 151 151 151 MET MET B . n B 1 152 PRO 152 152 152 PRO PRO B . n B 1 153 ARG 153 153 153 ARG ARG B . n B 1 154 ARG 154 154 154 ARG ARG B . n B 1 155 VAL 155 155 155 VAL VAL B . n B 1 156 PHE 156 156 156 PHE PHE B . n B 1 157 ASN 157 157 157 ASN ASN B . n B 1 158 ALA 158 158 158 ALA ALA B . n B 1 159 GLN 159 159 159 GLN GLN B . n B 1 160 LYS 160 160 160 LYS LYS B . n B 1 161 LYS 161 161 161 LYS LYS B . n B 1 162 ALA 162 162 ? ? ? B . n B 1 163 GLN 163 163 ? ? ? B . n B 1 164 SER 164 164 ? ? ? B . n B 1 165 SER 165 165 ? ? ? B . n B 1 166 THR 166 166 ? ? ? B . n B 1 167 ASP 167 167 ? ? ? B . n C 1 1 MET 1 1 ? ? ? C . n C 1 2 SER 2 2 ? ? ? C . n C 1 3 GLU 3 3 ? ? ? C . n C 1 4 VAL 4 4 4 VAL VAL C . n C 1 5 GLU 5 5 5 GLU GLU C . n C 1 6 PHE 6 6 6 PHE PHE C . n C 1 7 SER 7 7 7 SER SER C . n C 1 8 HIS 8 8 8 HIS HIS C . n C 1 9 GLU 9 9 9 GLU GLU C . n C 1 10 TYR 10 10 10 TYR TYR C . n C 1 11 TRP 11 11 11 TRP TRP C . n C 1 12 MET 12 12 12 MET MET C . n C 1 13 ARG 13 13 13 ARG ARG C . n C 1 14 HIS 14 14 14 HIS HIS C . n C 1 15 ALA 15 15 15 ALA ALA C . n C 1 16 LEU 16 16 16 LEU LEU C . n C 1 17 ALA 17 17 17 ALA ALA C . n C 1 18 LEU 18 18 18 LEU LEU C . n C 1 19 ALA 19 19 19 ALA ALA C . n C 1 20 LYS 20 20 20 LYS LYS C . n C 1 21 ARG 21 21 21 ARG ARG C . n C 1 22 ALA 22 22 22 ALA ALA C . n C 1 23 ARG 23 23 23 ARG ARG C . n C 1 24 ASP 24 24 24 ASP ASP C . n C 1 25 GLU 25 25 25 GLU GLU C . n C 1 26 ARG 26 26 26 ARG ARG C . n C 1 27 GLU 27 27 27 GLU GLU C . n C 1 28 VAL 28 28 28 VAL VAL C . n C 1 29 PRO 29 29 29 PRO PRO C . n C 1 30 VAL 30 30 30 VAL VAL C . n C 1 31 GLY 31 31 31 GLY GLY C . n C 1 32 ALA 32 32 32 ALA ALA C . n C 1 33 VAL 33 33 33 VAL VAL C . n C 1 34 LEU 34 34 34 LEU LEU C . n C 1 35 VAL 35 35 35 VAL VAL C . n C 1 36 LEU 36 36 36 LEU LEU C . n C 1 37 ASN 37 37 37 ASN ASN C . n C 1 38 ASN 38 38 38 ASN ASN C . n C 1 39 ARG 39 39 39 ARG ARG C . n C 1 40 VAL 40 40 40 VAL VAL C . n C 1 41 ILE 41 41 41 ILE ILE C . n C 1 42 GLY 42 42 42 GLY GLY C . n C 1 43 GLU 43 43 43 GLU GLU C . n C 1 44 GLY 44 44 44 GLY GLY C . n C 1 45 TRP 45 45 45 TRP TRP C . n C 1 46 ASN 46 46 46 ASN ASN C . n C 1 47 ARG 47 47 47 ARG ARG C . n C 1 48 GLY 48 48 48 GLY GLY C . n C 1 49 ILE 49 49 49 ILE ILE C . n C 1 50 GLY 50 50 50 GLY GLY C . n C 1 51 LEU 51 51 51 LEU LEU C . n C 1 52 HIS 52 52 52 HIS HIS C . n C 1 53 ASP 53 53 53 ASP ASP C . n C 1 54 PRO 54 54 54 PRO PRO C . n C 1 55 THR 55 55 55 THR THR C . n C 1 56 ALA 56 56 56 ALA ALA C . n C 1 57 HIS 57 57 57 HIS HIS C . n C 1 58 ALA 58 58 58 ALA ALA C . n C 1 59 GLU 59 59 59 GLU GLU C . n C 1 60 ILE 60 60 60 ILE ILE C . n C 1 61 MET 61 61 61 MET MET C . n C 1 62 ALA 62 62 62 ALA ALA C . n C 1 63 LEU 63 63 63 LEU LEU C . n C 1 64 ARG 64 64 64 ARG ARG C . n C 1 65 GLN 65 65 65 GLN GLN C . n C 1 66 GLY 66 66 66 GLY GLY C . n C 1 67 GLY 67 67 67 GLY GLY C . n C 1 68 LEU 68 68 68 LEU LEU C . n C 1 69 VAL 69 69 69 VAL VAL C . n C 1 70 MET 70 70 70 MET MET C . n C 1 71 GLN 71 71 71 GLN GLN C . n C 1 72 ASN 72 72 72 ASN ASN C . n C 1 73 TYR 73 73 73 TYR TYR C . n C 1 74 ARG 74 74 74 ARG ARG C . n C 1 75 LEU 75 75 75 LEU LEU C . n C 1 76 TYR 76 76 76 TYR TYR C . n C 1 77 ASP 77 77 77 ASP ASP C . n C 1 78 ALA 78 78 78 ALA ALA C . n C 1 79 THR 79 79 79 THR THR C . n C 1 80 LEU 80 80 80 LEU LEU C . n C 1 81 TYR 81 81 81 TYR TYR C . n C 1 82 THR 82 82 82 THR THR C . n C 1 83 THR 83 83 83 THR THR C . n C 1 84 PHE 84 84 84 PHE PHE C . n C 1 85 GLU 85 85 85 GLU GLU C . n C 1 86 PRO 86 86 86 PRO PRO C . n C 1 87 CYS 87 87 87 CYS CYS C . n C 1 88 VAL 88 88 88 VAL VAL C . n C 1 89 MET 89 89 89 MET MET C . n C 1 90 CYS 90 90 90 CYS CYS C . n C 1 91 ALA 91 91 91 ALA ALA C . n C 1 92 GLY 92 92 92 GLY GLY C . n C 1 93 ALA 93 93 93 ALA ALA C . n C 1 94 MET 94 94 94 MET MET C . n C 1 95 ILE 95 95 95 ILE ILE C . n C 1 96 HIS 96 96 96 HIS HIS C . n C 1 97 SER 97 97 97 SER SER C . n C 1 98 ARG 98 98 98 ARG ARG C . n C 1 99 ILE 99 99 99 ILE ILE C . n C 1 100 GLY 100 100 100 GLY GLY C . n C 1 101 ARG 101 101 101 ARG ARG C . n C 1 102 VAL 102 102 102 VAL VAL C . n C 1 103 VAL 103 103 103 VAL VAL C . n C 1 104 PHE 104 104 104 PHE PHE C . n C 1 105 GLY 105 105 105 GLY GLY C . n C 1 106 VAL 106 106 106 VAL VAL C . n C 1 107 ARG 107 107 107 ARG ARG C . n C 1 108 ASN 108 108 108 ASN ASN C . n C 1 109 ALA 109 109 109 ALA ALA C . n C 1 110 LYS 110 110 110 LYS LYS C . n C 1 111 THR 111 111 111 THR THR C . n C 1 112 GLY 112 112 112 GLY GLY C . n C 1 113 ALA 113 113 113 ALA ALA C . n C 1 114 ALA 114 114 114 ALA ALA C . n C 1 115 GLY 115 115 115 GLY GLY C . n C 1 116 SER 116 116 116 SER SER C . n C 1 117 LEU 117 117 117 LEU LEU C . n C 1 118 MET 118 118 118 MET MET C . n C 1 119 ASP 119 119 119 ASP ASP C . n C 1 120 VAL 120 120 120 VAL VAL C . n C 1 121 LEU 121 121 121 LEU LEU C . n C 1 122 HIS 122 122 122 HIS HIS C . n C 1 123 HIS 123 123 123 HIS HIS C . n C 1 124 PRO 124 124 124 PRO PRO C . n C 1 125 GLY 125 125 125 GLY GLY C . n C 1 126 MET 126 126 126 MET MET C . n C 1 127 ASN 127 127 127 ASN ASN C . n C 1 128 HIS 128 128 128 HIS HIS C . n C 1 129 ARG 129 129 129 ARG ARG C . n C 1 130 VAL 130 130 130 VAL VAL C . n C 1 131 GLU 131 131 131 GLU GLU C . n C 1 132 ILE 132 132 132 ILE ILE C . n C 1 133 THR 133 133 133 THR THR C . n C 1 134 GLU 134 134 134 GLU GLU C . n C 1 135 GLY 135 135 135 GLY GLY C . n C 1 136 ILE 136 136 136 ILE ILE C . n C 1 137 LEU 137 137 137 LEU LEU C . n C 1 138 ALA 138 138 138 ALA ALA C . n C 1 139 ASP 139 139 139 ASP ASP C . n C 1 140 GLU 140 140 140 GLU GLU C . n C 1 141 CYS 141 141 141 CYS CYS C . n C 1 142 GLU 142 142 142 GLU GLU C . n C 1 143 ALA 143 143 143 ALA ALA C . n C 1 144 LEU 144 144 144 LEU LEU C . n C 1 145 LEU 145 145 145 LEU LEU C . n C 1 146 CYS 146 146 146 CYS CYS C . n C 1 147 ARG 147 147 147 ARG ARG C . n C 1 148 PHE 148 148 148 PHE PHE C . n C 1 149 PHE 149 149 149 PHE PHE C . n C 1 150 ARG 150 150 150 ARG ARG C . n C 1 151 MET 151 151 151 MET MET C . n C 1 152 PRO 152 152 152 PRO PRO C . n C 1 153 ARG 153 153 153 ARG ARG C . n C 1 154 ARG 154 154 154 ARG ARG C . n C 1 155 VAL 155 155 155 VAL VAL C . n C 1 156 PHE 156 156 156 PHE PHE C . n C 1 157 ASN 157 157 ? ? ? C . n C 1 158 ALA 158 158 ? ? ? C . n C 1 159 GLN 159 159 ? ? ? C . n C 1 160 LYS 160 160 ? ? ? C . n C 1 161 LYS 161 161 ? ? ? C . n C 1 162 ALA 162 162 ? ? ? C . n C 1 163 GLN 163 163 ? ? ? C . n C 1 164 SER 164 164 ? ? ? C . n C 1 165 SER 165 165 ? ? ? C . n C 1 166 THR 166 166 ? ? ? C . n C 1 167 ASP 167 167 ? ? ? C . n D 1 1 MET 1 1 ? ? ? D . n D 1 2 SER 2 2 ? ? ? D . n D 1 3 GLU 3 3 3 GLU GLU D . n D 1 4 VAL 4 4 4 VAL VAL D . n D 1 5 GLU 5 5 5 GLU GLU D . n D 1 6 PHE 6 6 6 PHE PHE D . n D 1 7 SER 7 7 7 SER SER D . n D 1 8 HIS 8 8 8 HIS HIS D . n D 1 9 GLU 9 9 9 GLU GLU D . n D 1 10 TYR 10 10 10 TYR TYR D . n D 1 11 TRP 11 11 11 TRP TRP D . n D 1 12 MET 12 12 12 MET MET D . n D 1 13 ARG 13 13 13 ARG ARG D . n D 1 14 HIS 14 14 14 HIS HIS D . n D 1 15 ALA 15 15 15 ALA ALA D . n D 1 16 LEU 16 16 16 LEU LEU D . n D 1 17 ALA 17 17 17 ALA ALA D . n D 1 18 LEU 18 18 18 LEU LEU D . n D 1 19 ALA 19 19 19 ALA ALA D . n D 1 20 LYS 20 20 20 LYS LYS D . n D 1 21 ARG 21 21 21 ARG ARG D . n D 1 22 ALA 22 22 22 ALA ALA D . n D 1 23 ARG 23 23 23 ARG ARG D . n D 1 24 ASP 24 24 24 ASP ASP D . n D 1 25 GLU 25 25 25 GLU GLU D . n D 1 26 ARG 26 26 26 ARG ARG D . n D 1 27 GLU 27 27 27 GLU GLU D . n D 1 28 VAL 28 28 28 VAL VAL D . n D 1 29 PRO 29 29 29 PRO PRO D . n D 1 30 VAL 30 30 30 VAL VAL D . n D 1 31 GLY 31 31 31 GLY GLY D . n D 1 32 ALA 32 32 32 ALA ALA D . n D 1 33 VAL 33 33 33 VAL VAL D . n D 1 34 LEU 34 34 34 LEU LEU D . n D 1 35 VAL 35 35 35 VAL VAL D . n D 1 36 LEU 36 36 36 LEU LEU D . n D 1 37 ASN 37 37 37 ASN ASN D . n D 1 38 ASN 38 38 38 ASN ASN D . n D 1 39 ARG 39 39 39 ARG ARG D . n D 1 40 VAL 40 40 40 VAL VAL D . n D 1 41 ILE 41 41 41 ILE ILE D . n D 1 42 GLY 42 42 42 GLY GLY D . n D 1 43 GLU 43 43 43 GLU GLU D . n D 1 44 GLY 44 44 44 GLY GLY D . n D 1 45 TRP 45 45 45 TRP TRP D . n D 1 46 ASN 46 46 46 ASN ASN D . n D 1 47 ARG 47 47 47 ARG ARG D . n D 1 48 GLY 48 48 48 GLY GLY D . n D 1 49 ILE 49 49 49 ILE ILE D . n D 1 50 GLY 50 50 50 GLY GLY D . n D 1 51 LEU 51 51 51 LEU LEU D . n D 1 52 HIS 52 52 52 HIS HIS D . n D 1 53 ASP 53 53 53 ASP ASP D . n D 1 54 PRO 54 54 54 PRO PRO D . n D 1 55 THR 55 55 55 THR THR D . n D 1 56 ALA 56 56 56 ALA ALA D . n D 1 57 HIS 57 57 57 HIS HIS D . n D 1 58 ALA 58 58 58 ALA ALA D . n D 1 59 GLU 59 59 59 GLU GLU D . n D 1 60 ILE 60 60 60 ILE ILE D . n D 1 61 MET 61 61 61 MET MET D . n D 1 62 ALA 62 62 62 ALA ALA D . n D 1 63 LEU 63 63 63 LEU LEU D . n D 1 64 ARG 64 64 64 ARG ARG D . n D 1 65 GLN 65 65 65 GLN GLN D . n D 1 66 GLY 66 66 66 GLY GLY D . n D 1 67 GLY 67 67 67 GLY GLY D . n D 1 68 LEU 68 68 68 LEU LEU D . n D 1 69 VAL 69 69 69 VAL VAL D . n D 1 70 MET 70 70 70 MET MET D . n D 1 71 GLN 71 71 71 GLN GLN D . n D 1 72 ASN 72 72 72 ASN ASN D . n D 1 73 TYR 73 73 73 TYR TYR D . n D 1 74 ARG 74 74 74 ARG ARG D . n D 1 75 LEU 75 75 75 LEU LEU D . n D 1 76 TYR 76 76 76 TYR TYR D . n D 1 77 ASP 77 77 77 ASP ASP D . n D 1 78 ALA 78 78 78 ALA ALA D . n D 1 79 THR 79 79 79 THR THR D . n D 1 80 LEU 80 80 80 LEU LEU D . n D 1 81 TYR 81 81 81 TYR TYR D . n D 1 82 THR 82 82 82 THR THR D . n D 1 83 THR 83 83 83 THR THR D . n D 1 84 PHE 84 84 84 PHE PHE D . n D 1 85 GLU 85 85 85 GLU GLU D . n D 1 86 PRO 86 86 86 PRO PRO D . n D 1 87 CYS 87 87 87 CYS CYS D . n D 1 88 VAL 88 88 88 VAL VAL D . n D 1 89 MET 89 89 89 MET MET D . n D 1 90 CYS 90 90 90 CYS CYS D . n D 1 91 ALA 91 91 91 ALA ALA D . n D 1 92 GLY 92 92 92 GLY GLY D . n D 1 93 ALA 93 93 93 ALA ALA D . n D 1 94 MET 94 94 94 MET MET D . n D 1 95 ILE 95 95 95 ILE ILE D . n D 1 96 HIS 96 96 96 HIS HIS D . n D 1 97 SER 97 97 97 SER SER D . n D 1 98 ARG 98 98 98 ARG ARG D . n D 1 99 ILE 99 99 99 ILE ILE D . n D 1 100 GLY 100 100 100 GLY GLY D . n D 1 101 ARG 101 101 101 ARG ARG D . n D 1 102 VAL 102 102 102 VAL VAL D . n D 1 103 VAL 103 103 103 VAL VAL D . n D 1 104 PHE 104 104 104 PHE PHE D . n D 1 105 GLY 105 105 105 GLY GLY D . n D 1 106 VAL 106 106 106 VAL VAL D . n D 1 107 ARG 107 107 107 ARG ARG D . n D 1 108 ASN 108 108 108 ASN ASN D . n D 1 109 ALA 109 109 109 ALA ALA D . n D 1 110 LYS 110 110 110 LYS LYS D . n D 1 111 THR 111 111 111 THR THR D . n D 1 112 GLY 112 112 112 GLY GLY D . n D 1 113 ALA 113 113 113 ALA ALA D . n D 1 114 ALA 114 114 114 ALA ALA D . n D 1 115 GLY 115 115 115 GLY GLY D . n D 1 116 SER 116 116 116 SER SER D . n D 1 117 LEU 117 117 117 LEU LEU D . n D 1 118 MET 118 118 118 MET MET D . n D 1 119 ASP 119 119 119 ASP ASP D . n D 1 120 VAL 120 120 120 VAL VAL D . n D 1 121 LEU 121 121 121 LEU LEU D . n D 1 122 HIS 122 122 122 HIS HIS D . n D 1 123 HIS 123 123 123 HIS HIS D . n D 1 124 PRO 124 124 124 PRO PRO D . n D 1 125 GLY 125 125 125 GLY GLY D . n D 1 126 MET 126 126 126 MET MET D . n D 1 127 ASN 127 127 127 ASN ASN D . n D 1 128 HIS 128 128 128 HIS HIS D . n D 1 129 ARG 129 129 129 ARG ARG D . n D 1 130 VAL 130 130 130 VAL VAL D . n D 1 131 GLU 131 131 131 GLU GLU D . n D 1 132 ILE 132 132 132 ILE ILE D . n D 1 133 THR 133 133 133 THR THR D . n D 1 134 GLU 134 134 134 GLU GLU D . n D 1 135 GLY 135 135 135 GLY GLY D . n D 1 136 ILE 136 136 136 ILE ILE D . n D 1 137 LEU 137 137 137 LEU LEU D . n D 1 138 ALA 138 138 138 ALA ALA D . n D 1 139 ASP 139 139 139 ASP ASP D . n D 1 140 GLU 140 140 140 GLU GLU D . n D 1 141 CYS 141 141 141 CYS CYS D . n D 1 142 GLU 142 142 142 GLU GLU D . n D 1 143 ALA 143 143 143 ALA ALA D . n D 1 144 LEU 144 144 144 LEU LEU D . n D 1 145 LEU 145 145 145 LEU LEU D . n D 1 146 CYS 146 146 146 CYS CYS D . n D 1 147 ARG 147 147 147 ARG ARG D . n D 1 148 PHE 148 148 148 PHE PHE D . n D 1 149 PHE 149 149 149 PHE PHE D . n D 1 150 ARG 150 150 150 ARG ARG D . n D 1 151 MET 151 151 151 MET MET D . n D 1 152 PRO 152 152 152 PRO PRO D . n D 1 153 ARG 153 153 153 ARG ARG D . n D 1 154 ARG 154 154 154 ARG ARG D . n D 1 155 VAL 155 155 155 VAL VAL D . n D 1 156 PHE 156 156 156 PHE PHE D . n D 1 157 ASN 157 157 ? ? ? D . n D 1 158 ALA 158 158 ? ? ? D . n D 1 159 GLN 159 159 ? ? ? D . n D 1 160 LYS 160 160 ? ? ? D . n D 1 161 LYS 161 161 ? ? ? D . n D 1 162 ALA 162 162 ? ? ? D . n D 1 163 GLN 163 163 ? ? ? D . n D 1 164 SER 164 164 ? ? ? D . n D 1 165 SER 165 165 ? ? ? D . n D 1 166 THR 166 166 ? ? ? D . n D 1 167 ASP 167 167 ? ? ? D . n E 2 1 DG 1 1 1 DG DG E . n E 2 2 DC 2 2 ? ? ? E . n E 2 3 DT 3 3 ? ? ? E . n E 2 4 DC 4 4 4 DC DC E . n E 2 5 DG 5 5 5 DG DG E . n E 2 6 DG 6 6 6 DG DG E . n E 2 7 DC 7 7 7 DC DC E . n E 2 8 DT 8 8 8 DT DT E . n E 2 9 UEL 9 9 9 UEL D8A E . n E 2 10 DC 10 10 10 DC DC E . n E 2 11 DG 11 11 11 DG DG E . n E 2 12 DG 12 12 12 DG DG E . n E 2 13 DA 13 13 13 DA DA E . n F 2 1 DG 1 1 1 DG DG F . n F 2 2 DC 2 2 2 DC DC F . n F 2 3 DT 3 3 3 DT DT F . n F 2 4 DC 4 4 4 DC DC F . n F 2 5 DG 5 5 5 DG DG F . n F 2 6 DG 6 6 6 DG DG F . n F 2 7 DC 7 7 7 DC DC F . n F 2 8 DT 8 8 8 DT DT F . n F 2 9 UEL 9 9 9 UEL D8A F . n F 2 10 DC 10 10 10 DC DC F . n F 2 11 DG 11 11 11 DG DG F . n F 2 12 DG 12 12 12 DG DG F . n F 2 13 DA 13 13 13 DA DA F . n G 2 1 DG 1 1 ? ? ? G . n G 2 2 DC 2 2 ? ? ? G . n G 2 3 DT 3 3 3 DT DT G . n G 2 4 DC 4 4 4 DC DC G . n G 2 5 DG 5 5 5 DG DG G . n G 2 6 DG 6 6 6 DG DG G . n G 2 7 DC 7 7 7 DC DC G . n G 2 8 DT 8 8 8 DT DT G . n G 2 9 UEL 9 9 9 UEL D8A G . n G 2 10 DC 10 10 10 DC DC G . n G 2 11 DG 11 11 11 DG DG G . n G 2 12 DG 12 12 12 DG DG G . n G 2 13 DA 13 13 13 DA DA G . n H 2 1 DG 1 1 ? ? ? H . n H 2 2 DC 2 2 2 DC DC H . n H 2 3 DT 3 3 3 DT DT H . n H 2 4 DC 4 4 4 DC DC H . n H 2 5 DG 5 5 5 DG DG H . n H 2 6 DG 6 6 6 DG DG H . n H 2 7 DC 7 7 7 DC DC H . n H 2 8 DT 8 8 8 DT DT H . n H 2 9 UEL 9 9 9 UEL D8A H . n H 2 10 DC 10 10 10 DC DC H . n H 2 11 DG 11 11 11 DG DG H . n H 2 12 DG 12 12 12 DG DG H . n H 2 13 DA 13 13 13 DA DA H . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email pfeliciano@beamtx.com _pdbx_contact_author.name_first Giuseppe _pdbx_contact_author.name_last Ciaramella _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3339-7211 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code I 3 ZN 1 201 1 ZN ZN A . J 4 GOL 1 201 201 GOL GOL B . K 3 ZN 1 202 2 ZN ZN B . L 4 GOL 1 201 201 GOL GOL C . M 3 ZN 1 202 3 ZN ZN C . N 4 GOL 1 201 201 GOL GOL D . O 3 ZN 1 202 4 ZN ZN D . P 5 HOH 1 301 75 HOH HOH A . P 5 HOH 2 302 110 HOH HOH A . P 5 HOH 3 303 92 HOH HOH A . P 5 HOH 4 304 118 HOH HOH A . P 5 HOH 5 305 36 HOH HOH A . P 5 HOH 6 306 25 HOH HOH A . P 5 HOH 7 307 102 HOH HOH A . P 5 HOH 8 308 17 HOH HOH A . P 5 HOH 9 309 55 HOH HOH A . P 5 HOH 10 310 12 HOH HOH A . P 5 HOH 11 311 53 HOH HOH A . P 5 HOH 12 312 26 HOH HOH A . P 5 HOH 13 313 44 HOH HOH A . P 5 HOH 14 314 67 HOH HOH A . P 5 HOH 15 315 5 HOH HOH A . P 5 HOH 16 316 57 HOH HOH A . P 5 HOH 17 317 131 HOH HOH A . P 5 HOH 18 318 109 HOH HOH A . P 5 HOH 19 319 104 HOH HOH A . P 5 HOH 20 320 49 HOH HOH A . P 5 HOH 21 321 70 HOH HOH A . P 5 HOH 22 322 130 HOH HOH A . P 5 HOH 23 323 100 HOH HOH A . P 5 HOH 24 324 54 HOH HOH A . P 5 HOH 25 325 122 HOH HOH A . P 5 HOH 26 326 64 HOH HOH A . P 5 HOH 27 327 81 HOH HOH A . P 5 HOH 28 328 123 HOH HOH A . P 5 HOH 29 329 20 HOH HOH A . P 5 HOH 30 330 111 HOH HOH A . Q 5 HOH 1 301 4 HOH HOH B . Q 5 HOH 2 302 6 HOH HOH B . Q 5 HOH 3 303 95 HOH HOH B . Q 5 HOH 4 304 21 HOH HOH B . Q 5 HOH 5 305 15 HOH HOH B . Q 5 HOH 6 306 10 HOH HOH B . Q 5 HOH 7 307 34 HOH HOH B . Q 5 HOH 8 308 105 HOH HOH B . Q 5 HOH 9 309 18 HOH HOH B . Q 5 HOH 10 310 65 HOH HOH B . Q 5 HOH 11 311 37 HOH HOH B . Q 5 HOH 12 312 11 HOH HOH B . Q 5 HOH 13 313 13 HOH HOH B . Q 5 HOH 14 314 9 HOH HOH B . Q 5 HOH 15 315 83 HOH HOH B . Q 5 HOH 16 316 112 HOH HOH B . Q 5 HOH 17 317 31 HOH HOH B . Q 5 HOH 18 318 68 HOH HOH B . Q 5 HOH 19 319 133 HOH HOH B . Q 5 HOH 20 320 86 HOH HOH B . Q 5 HOH 21 321 63 HOH HOH B . Q 5 HOH 22 322 80 HOH HOH B . Q 5 HOH 23 323 88 HOH HOH B . Q 5 HOH 24 324 33 HOH HOH B . Q 5 HOH 25 325 78 HOH HOH B . Q 5 HOH 26 326 101 HOH HOH B . Q 5 HOH 27 327 85 HOH HOH B . R 5 HOH 1 301 16 HOH HOH C . R 5 HOH 2 302 7 HOH HOH C . R 5 HOH 3 303 45 HOH HOH C . R 5 HOH 4 304 90 HOH HOH C . R 5 HOH 5 305 87 HOH HOH C . R 5 HOH 6 306 24 HOH HOH C . R 5 HOH 7 307 22 HOH HOH C . R 5 HOH 8 308 50 HOH HOH C . R 5 HOH 9 309 8 HOH HOH C . R 5 HOH 10 310 73 HOH HOH C . R 5 HOH 11 311 2 HOH HOH C . R 5 HOH 12 312 60 HOH HOH C . R 5 HOH 13 313 19 HOH HOH C . R 5 HOH 14 314 89 HOH HOH C . R 5 HOH 15 315 35 HOH HOH C . R 5 HOH 16 316 76 HOH HOH C . R 5 HOH 17 317 28 HOH HOH C . R 5 HOH 18 318 71 HOH HOH C . R 5 HOH 19 319 119 HOH HOH C . R 5 HOH 20 320 94 HOH HOH C . R 5 HOH 21 321 69 HOH HOH C . R 5 HOH 22 322 98 HOH HOH C . R 5 HOH 23 323 77 HOH HOH C . R 5 HOH 24 324 121 HOH HOH C . S 5 HOH 1 301 43 HOH HOH D . S 5 HOH 2 302 14 HOH HOH D . S 5 HOH 3 303 72 HOH HOH D . S 5 HOH 4 304 113 HOH HOH D . S 5 HOH 5 305 30 HOH HOH D . S 5 HOH 6 306 61 HOH HOH D . S 5 HOH 7 307 3 HOH HOH D . S 5 HOH 8 308 97 HOH HOH D . S 5 HOH 9 309 108 HOH HOH D . S 5 HOH 10 310 48 HOH HOH D . S 5 HOH 11 311 91 HOH HOH D . S 5 HOH 12 312 52 HOH HOH D . S 5 HOH 13 313 66 HOH HOH D . S 5 HOH 14 314 58 HOH HOH D . S 5 HOH 15 315 41 HOH HOH D . S 5 HOH 16 316 38 HOH HOH D . S 5 HOH 17 317 114 HOH HOH D . S 5 HOH 18 318 116 HOH HOH D . S 5 HOH 19 319 32 HOH HOH D . S 5 HOH 20 320 115 HOH HOH D . S 5 HOH 21 321 59 HOH HOH D . S 5 HOH 22 322 27 HOH HOH D . S 5 HOH 23 323 62 HOH HOH D . S 5 HOH 24 324 117 HOH HOH D . S 5 HOH 25 325 29 HOH HOH D . S 5 HOH 26 326 129 HOH HOH D . T 5 HOH 1 101 1 HOH HOH E . T 5 HOH 2 102 56 HOH HOH E . T 5 HOH 3 103 39 HOH HOH E . U 5 HOH 1 101 93 HOH HOH F . U 5 HOH 2 102 46 HOH HOH F . U 5 HOH 3 103 103 HOH HOH F . U 5 HOH 4 104 128 HOH HOH F . U 5 HOH 5 105 40 HOH HOH F . U 5 HOH 6 106 107 HOH HOH F . U 5 HOH 7 107 127 HOH HOH F . V 5 HOH 1 101 42 HOH HOH G . V 5 HOH 2 102 47 HOH HOH G . V 5 HOH 3 103 120 HOH HOH G . V 5 HOH 4 104 79 HOH HOH G . V 5 HOH 5 105 126 HOH HOH G . V 5 HOH 6 106 99 HOH HOH G . W 5 HOH 1 101 124 HOH HOH H . W 5 HOH 2 102 125 HOH HOH H . W 5 HOH 3 103 82 HOH HOH H . W 5 HOH 4 104 74 HOH HOH H . W 5 HOH 5 105 96 HOH HOH H . W 5 HOH 6 106 106 HOH HOH H . W 5 HOH 7 107 132 HOH HOH H . W 5 HOH 8 108 84 HOH HOH H . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA tetrameric 4 2 author_and_software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,E,F,I,J,K,P,Q,T,U 2 1 C,D,G,H,L,M,N,O,R,S,V,W # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7480 ? 1 MORE -107 ? 1 'SSA (A^2)' 15260 ? 2 'ABSA (A^2)' 7440 ? 2 MORE -104 ? 2 'SSA (A^2)' 14960 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 ZN ? I ZN . ? A ZN 201 ? 1_555 SG ? A CYS 87 ? A CYS 87 ? 1_555 108.3 ? 2 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 ZN ? I ZN . ? A ZN 201 ? 1_555 SG ? A CYS 90 ? A CYS 90 ? 1_555 113.0 ? 3 SG ? A CYS 87 ? A CYS 87 ? 1_555 ZN ? I ZN . ? A ZN 201 ? 1_555 SG ? A CYS 90 ? A CYS 90 ? 1_555 113.6 ? 4 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 ZN ? I ZN . ? A ZN 201 ? 1_555 O6 ? E UEL 9 ? E UEL 9 ? 1_555 102.9 ? 5 SG ? A CYS 87 ? A CYS 87 ? 1_555 ZN ? I ZN . ? A ZN 201 ? 1_555 O6 ? E UEL 9 ? E UEL 9 ? 1_555 107.0 ? 6 SG ? A CYS 90 ? A CYS 90 ? 1_555 ZN ? I ZN . ? A ZN 201 ? 1_555 O6 ? E UEL 9 ? E UEL 9 ? 1_555 111.4 ? 7 ND1 ? B HIS 57 ? B HIS 57 ? 1_555 ZN ? K ZN . ? B ZN 202 ? 1_555 SG ? B CYS 87 ? B CYS 87 ? 1_555 99.7 ? 8 ND1 ? B HIS 57 ? B HIS 57 ? 1_555 ZN ? K ZN . ? B ZN 202 ? 1_555 SG ? B CYS 90 ? B CYS 90 ? 1_555 116.6 ? 9 SG ? B CYS 87 ? B CYS 87 ? 1_555 ZN ? K ZN . ? B ZN 202 ? 1_555 SG ? B CYS 90 ? B CYS 90 ? 1_555 116.1 ? 10 ND1 ? B HIS 57 ? B HIS 57 ? 1_555 ZN ? K ZN . ? B ZN 202 ? 1_555 O6 ? F UEL 9 ? F UEL 9 ? 1_555 107.2 ? 11 SG ? B CYS 87 ? B CYS 87 ? 1_555 ZN ? K ZN . ? B ZN 202 ? 1_555 O6 ? F UEL 9 ? F UEL 9 ? 1_555 99.4 ? 12 SG ? B CYS 90 ? B CYS 90 ? 1_555 ZN ? K ZN . ? B ZN 202 ? 1_555 O6 ? F UEL 9 ? F UEL 9 ? 1_555 115.5 ? 13 ND1 ? C HIS 57 ? C HIS 57 ? 1_555 ZN ? M ZN . ? C ZN 202 ? 1_555 SG ? C CYS 87 ? C CYS 87 ? 1_555 99.7 ? 14 ND1 ? C HIS 57 ? C HIS 57 ? 1_555 ZN ? M ZN . ? C ZN 202 ? 1_555 SG ? C CYS 90 ? C CYS 90 ? 1_555 110.2 ? 15 SG ? C CYS 87 ? C CYS 87 ? 1_555 ZN ? M ZN . ? C ZN 202 ? 1_555 SG ? C CYS 90 ? C CYS 90 ? 1_555 104.0 ? 16 ND1 ? C HIS 57 ? C HIS 57 ? 1_555 ZN ? M ZN . ? C ZN 202 ? 1_555 O6 ? G UEL 9 ? G UEL 9 ? 1_555 106.5 ? 17 SG ? C CYS 87 ? C CYS 87 ? 1_555 ZN ? M ZN . ? C ZN 202 ? 1_555 O6 ? G UEL 9 ? G UEL 9 ? 1_555 117.5 ? 18 SG ? C CYS 90 ? C CYS 90 ? 1_555 ZN ? M ZN . ? C ZN 202 ? 1_555 O6 ? G UEL 9 ? G UEL 9 ? 1_555 117.6 ? 19 ND1 ? D HIS 57 ? D HIS 57 ? 1_555 ZN ? O ZN . ? D ZN 202 ? 1_555 SG ? D CYS 87 ? D CYS 87 ? 1_555 101.4 ? 20 ND1 ? D HIS 57 ? D HIS 57 ? 1_555 ZN ? O ZN . ? D ZN 202 ? 1_555 SG ? D CYS 90 ? D CYS 90 ? 1_555 114.7 ? 21 SG ? D CYS 87 ? D CYS 87 ? 1_555 ZN ? O ZN . ? D ZN 202 ? 1_555 SG ? D CYS 90 ? D CYS 90 ? 1_555 113.9 ? 22 ND1 ? D HIS 57 ? D HIS 57 ? 1_555 ZN ? O ZN . ? D ZN 202 ? 1_555 O6 ? H UEL 9 ? H UEL 9 ? 1_555 105.4 ? 23 SG ? D CYS 87 ? D CYS 87 ? 1_555 ZN ? O ZN . ? D ZN 202 ? 1_555 O6 ? H UEL 9 ? H UEL 9 ? 1_555 109.0 ? 24 SG ? D CYS 90 ? D CYS 90 ? 1_555 ZN ? O ZN . ? D ZN 202 ? 1_555 O6 ? H UEL 9 ? H UEL 9 ? 1_555 111.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-01-11 2 'Structure model' 1 1 2023-02-08 3 'Structure model' 1 2 2023-05-31 4 'Structure model' 1 3 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 3 'Structure model' struct_ncs_dom_lim 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_DOI' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 2 'Structure model' '_citation_author.name' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation_author.identifier_ORCID' 10 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 11 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 12 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 13 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 14 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 15 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 16 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 17 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 8E2Q _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 "O4'" _pdbx_validate_rmsd_angle.auth_asym_id_1 H _pdbx_validate_rmsd_angle.auth_comp_id_1 DC _pdbx_validate_rmsd_angle.auth_seq_id_1 7 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 "C1'" _pdbx_validate_rmsd_angle.auth_asym_id_2 H _pdbx_validate_rmsd_angle.auth_comp_id_2 DC _pdbx_validate_rmsd_angle.auth_seq_id_2 7 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 N1 _pdbx_validate_rmsd_angle.auth_asym_id_3 H _pdbx_validate_rmsd_angle.auth_comp_id_3 DC _pdbx_validate_rmsd_angle.auth_seq_id_3 7 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 110.29 _pdbx_validate_rmsd_angle.angle_target_value 108.30 _pdbx_validate_rmsd_angle.angle_deviation 1.99 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 56 ? ? -80.95 48.01 2 1 SER A 116 ? ? -80.24 -87.88 3 1 ALA B 56 ? ? -82.39 48.38 4 1 LEU B 75 ? ? -118.61 63.95 5 1 ALA C 56 ? ? -80.69 48.50 6 1 LEU C 75 ? ? -118.70 63.19 7 1 SER C 116 ? ? -80.22 -87.35 8 1 ALA D 56 ? ? -82.31 49.14 9 1 LEU D 75 ? ? -118.78 62.16 10 1 SER D 116 ? ? -79.35 -87.28 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 21 ? CG ? A ARG 21 CG 2 1 Y 1 A ARG 21 ? CD ? A ARG 21 CD 3 1 Y 1 A ARG 21 ? NE ? A ARG 21 NE 4 1 Y 1 A ARG 21 ? CZ ? A ARG 21 CZ 5 1 Y 1 A ARG 21 ? NH1 ? A ARG 21 NH1 6 1 Y 1 A ARG 21 ? NH2 ? A ARG 21 NH2 7 1 Y 1 A ARG 39 ? CG ? A ARG 39 CG 8 1 Y 1 A ARG 39 ? CD ? A ARG 39 CD 9 1 Y 1 A ARG 39 ? NE ? A ARG 39 NE 10 1 Y 1 A ARG 39 ? CZ ? A ARG 39 CZ 11 1 Y 1 A ARG 39 ? NH1 ? A ARG 39 NH1 12 1 Y 1 A ARG 39 ? NH2 ? A ARG 39 NH2 13 1 Y 1 A ARG 154 ? CG ? A ARG 154 CG 14 1 Y 1 A ARG 154 ? CD ? A ARG 154 CD 15 1 Y 1 A ARG 154 ? NE ? A ARG 154 NE 16 1 Y 1 A ARG 154 ? CZ ? A ARG 154 CZ 17 1 Y 1 A ARG 154 ? NH1 ? A ARG 154 NH1 18 1 Y 1 A ARG 154 ? NH2 ? A ARG 154 NH2 19 1 Y 1 B LYS 160 ? CG ? B LYS 160 CG 20 1 Y 1 B LYS 160 ? CD ? B LYS 160 CD 21 1 Y 1 B LYS 160 ? CE ? B LYS 160 CE 22 1 Y 1 B LYS 160 ? NZ ? B LYS 160 NZ 23 1 Y 1 C ARG 107 ? NE ? C ARG 107 NE 24 1 Y 1 C ARG 107 ? CZ ? C ARG 107 CZ 25 1 Y 1 C ARG 107 ? NH1 ? C ARG 107 NH1 26 1 Y 1 C ARG 107 ? NH2 ? C ARG 107 NH2 27 1 Y 1 D GLU 3 ? CG ? D GLU 3 CG 28 1 Y 1 D GLU 3 ? CD ? D GLU 3 CD 29 1 Y 1 D GLU 3 ? OE1 ? D GLU 3 OE1 30 1 Y 1 D GLU 3 ? OE2 ? D GLU 3 OE2 31 1 Y 1 D VAL 4 ? CG1 ? D VAL 4 CG1 32 1 Y 1 D VAL 4 ? CG2 ? D VAL 4 CG2 33 1 Y 1 D GLU 5 ? CG ? D GLU 5 CG 34 1 Y 1 D GLU 5 ? CD ? D GLU 5 CD 35 1 Y 1 D GLU 5 ? OE1 ? D GLU 5 OE1 36 1 Y 1 D GLU 5 ? OE2 ? D GLU 5 OE2 37 1 Y 1 D ARG 13 ? CG ? D ARG 13 CG 38 1 Y 1 D ARG 13 ? CD ? D ARG 13 CD 39 1 Y 1 D ARG 13 ? NE ? D ARG 13 NE 40 1 Y 1 D ARG 13 ? CZ ? D ARG 13 CZ 41 1 Y 1 D ARG 13 ? NH1 ? D ARG 13 NH1 42 1 Y 1 D ARG 13 ? NH2 ? D ARG 13 NH2 43 1 Y 1 D ARG 39 ? CG ? D ARG 39 CG 44 1 Y 1 D ARG 39 ? CD ? D ARG 39 CD 45 1 Y 1 D ARG 39 ? NE ? D ARG 39 NE 46 1 Y 1 D ARG 39 ? CZ ? D ARG 39 CZ 47 1 Y 1 D ARG 39 ? NH1 ? D ARG 39 NH1 48 1 Y 1 D ARG 39 ? NH2 ? D ARG 39 NH2 49 1 Y 1 D ARG 98 ? NE ? D ARG 98 NE 50 1 Y 1 D ARG 98 ? CZ ? D ARG 98 CZ 51 1 Y 1 D ARG 98 ? NH1 ? D ARG 98 NH1 52 1 Y 1 D ARG 98 ? NH2 ? D ARG 98 NH2 53 1 Y 1 D ARG 107 ? NE ? D ARG 107 NE 54 1 Y 1 D ARG 107 ? CZ ? D ARG 107 CZ 55 1 Y 1 D ARG 107 ? NH1 ? D ARG 107 NH1 56 1 Y 1 D ARG 107 ? NH2 ? D ARG 107 NH2 57 1 Y 1 D ASN 127 ? CG ? D ASN 127 CG 58 1 Y 1 D ASN 127 ? OD1 ? D ASN 127 OD1 59 1 Y 1 D ASN 127 ? ND2 ? D ASN 127 ND2 60 1 Y 1 D ARG 153 ? CG ? D ARG 153 CG 61 1 Y 1 D ARG 153 ? CD ? D ARG 153 CD 62 1 Y 1 D ARG 153 ? NE ? D ARG 153 NE 63 1 Y 1 D ARG 153 ? CZ ? D ARG 153 CZ 64 1 Y 1 D ARG 153 ? NH1 ? D ARG 153 NH1 65 1 Y 1 D ARG 153 ? NH2 ? D ARG 153 NH2 66 1 Y 1 D ARG 154 ? CG ? D ARG 154 CG 67 1 Y 1 D ARG 154 ? CD ? D ARG 154 CD 68 1 Y 1 D ARG 154 ? NE ? D ARG 154 NE 69 1 Y 1 D ARG 154 ? CZ ? D ARG 154 CZ 70 1 Y 1 D ARG 154 ? NH1 ? D ARG 154 NH1 71 1 Y 1 D ARG 154 ? NH2 ? D ARG 154 NH2 72 1 Y 1 D VAL 155 ? CG1 ? D VAL 155 CG1 73 1 Y 1 D VAL 155 ? CG2 ? D VAL 155 CG2 74 1 Y 1 D PHE 156 ? CG ? D PHE 156 CG 75 1 Y 1 D PHE 156 ? CD1 ? D PHE 156 CD1 76 1 Y 1 D PHE 156 ? CD2 ? D PHE 156 CD2 77 1 Y 1 D PHE 156 ? CE1 ? D PHE 156 CE1 78 1 Y 1 D PHE 156 ? CE2 ? D PHE 156 CE2 79 1 Y 1 D PHE 156 ? CZ ? D PHE 156 CZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A ALA 158 ? A ALA 158 5 1 Y 1 A GLN 159 ? A GLN 159 6 1 Y 1 A LYS 160 ? A LYS 160 7 1 Y 1 A LYS 161 ? A LYS 161 8 1 Y 1 A ALA 162 ? A ALA 162 9 1 Y 1 A GLN 163 ? A GLN 163 10 1 Y 1 A SER 164 ? A SER 164 11 1 Y 1 A SER 165 ? A SER 165 12 1 Y 1 A THR 166 ? A THR 166 13 1 Y 1 A ASP 167 ? A ASP 167 14 1 Y 1 B MET 1 ? B MET 1 15 1 Y 1 B ALA 162 ? B ALA 162 16 1 Y 1 B GLN 163 ? B GLN 163 17 1 Y 1 B SER 164 ? B SER 164 18 1 Y 1 B SER 165 ? B SER 165 19 1 Y 1 B THR 166 ? B THR 166 20 1 Y 1 B ASP 167 ? B ASP 167 21 1 Y 1 C MET 1 ? C MET 1 22 1 Y 1 C SER 2 ? C SER 2 23 1 Y 1 C GLU 3 ? C GLU 3 24 1 Y 1 C ASN 157 ? C ASN 157 25 1 Y 1 C ALA 158 ? C ALA 158 26 1 Y 1 C GLN 159 ? C GLN 159 27 1 Y 1 C LYS 160 ? C LYS 160 28 1 Y 1 C LYS 161 ? C LYS 161 29 1 Y 1 C ALA 162 ? C ALA 162 30 1 Y 1 C GLN 163 ? C GLN 163 31 1 Y 1 C SER 164 ? C SER 164 32 1 Y 1 C SER 165 ? C SER 165 33 1 Y 1 C THR 166 ? C THR 166 34 1 Y 1 C ASP 167 ? C ASP 167 35 1 Y 1 D MET 1 ? D MET 1 36 1 Y 1 D SER 2 ? D SER 2 37 1 Y 1 D ASN 157 ? D ASN 157 38 1 Y 1 D ALA 158 ? D ALA 158 39 1 Y 1 D GLN 159 ? D GLN 159 40 1 Y 1 D LYS 160 ? D LYS 160 41 1 Y 1 D LYS 161 ? D LYS 161 42 1 Y 1 D ALA 162 ? D ALA 162 43 1 Y 1 D GLN 163 ? D GLN 163 44 1 Y 1 D SER 164 ? D SER 164 45 1 Y 1 D SER 165 ? D SER 165 46 1 Y 1 D THR 166 ? D THR 166 47 1 Y 1 D ASP 167 ? D ASP 167 48 1 Y 1 E DC 2 ? E DC 2 49 1 Y 1 E DT 3 ? E DT 3 50 1 Y 1 G DG 1 ? G DG 1 51 1 Y 1 G DC 2 ? G DC 2 52 1 Y 1 H DG 1 ? H DG 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DA OP3 O N N 88 DA P P N N 89 DA OP1 O N N 90 DA OP2 O N N 91 DA "O5'" O N N 92 DA "C5'" C N N 93 DA "C4'" C N R 94 DA "O4'" O N N 95 DA "C3'" C N S 96 DA "O3'" O N N 97 DA "C2'" C N N 98 DA "C1'" C N R 99 DA N9 N Y N 100 DA C8 C Y N 101 DA N7 N Y N 102 DA C5 C Y N 103 DA C6 C Y N 104 DA N6 N N N 105 DA N1 N Y N 106 DA C2 C Y N 107 DA N3 N Y N 108 DA C4 C Y N 109 DA HOP3 H N N 110 DA HOP2 H N N 111 DA "H5'" H N N 112 DA "H5''" H N N 113 DA "H4'" H N N 114 DA "H3'" H N N 115 DA "HO3'" H N N 116 DA "H2'" H N N 117 DA "H2''" H N N 118 DA "H1'" H N N 119 DA H8 H N N 120 DA H61 H N N 121 DA H62 H N N 122 DA H2 H N N 123 DC OP3 O N N 124 DC P P N N 125 DC OP1 O N N 126 DC OP2 O N N 127 DC "O5'" O N N 128 DC "C5'" C N N 129 DC "C4'" C N R 130 DC "O4'" O N N 131 DC "C3'" C N S 132 DC "O3'" O N N 133 DC "C2'" C N N 134 DC "C1'" C N R 135 DC N1 N N N 136 DC C2 C N N 137 DC O2 O N N 138 DC N3 N N N 139 DC C4 C N N 140 DC N4 N N N 141 DC C5 C N N 142 DC C6 C N N 143 DC HOP3 H N N 144 DC HOP2 H N N 145 DC "H5'" H N N 146 DC "H5''" H N N 147 DC "H4'" H N N 148 DC "H3'" H N N 149 DC "HO3'" H N N 150 DC "H2'" H N N 151 DC "H2''" H N N 152 DC "H1'" H N N 153 DC H41 H N N 154 DC H42 H N N 155 DC H5 H N N 156 DC H6 H N N 157 DG OP3 O N N 158 DG P P N N 159 DG OP1 O N N 160 DG OP2 O N N 161 DG "O5'" O N N 162 DG "C5'" C N N 163 DG "C4'" C N R 164 DG "O4'" O N N 165 DG "C3'" C N S 166 DG "O3'" O N N 167 DG "C2'" C N N 168 DG "C1'" C N R 169 DG N9 N Y N 170 DG C8 C Y N 171 DG N7 N Y N 172 DG C5 C Y N 173 DG C6 C N N 174 DG O6 O N N 175 DG N1 N N N 176 DG C2 C N N 177 DG N2 N N N 178 DG N3 N N N 179 DG C4 C Y N 180 DG HOP3 H N N 181 DG HOP2 H N N 182 DG "H5'" H N N 183 DG "H5''" H N N 184 DG "H4'" H N N 185 DG "H3'" H N N 186 DG "HO3'" H N N 187 DG "H2'" H N N 188 DG "H2''" H N N 189 DG "H1'" H N N 190 DG H8 H N N 191 DG H1 H N N 192 DG H21 H N N 193 DG H22 H N N 194 DT OP3 O N N 195 DT P P N N 196 DT OP1 O N N 197 DT OP2 O N N 198 DT "O5'" O N N 199 DT "C5'" C N N 200 DT "C4'" C N R 201 DT "O4'" O N N 202 DT "C3'" C N S 203 DT "O3'" O N N 204 DT "C2'" C N N 205 DT "C1'" C N R 206 DT N1 N N N 207 DT C2 C N N 208 DT O2 O N N 209 DT N3 N N N 210 DT C4 C N N 211 DT O4 O N N 212 DT C5 C N N 213 DT C7 C N N 214 DT C6 C N N 215 DT HOP3 H N N 216 DT HOP2 H N N 217 DT "H5'" H N N 218 DT "H5''" H N N 219 DT "H4'" H N N 220 DT "H3'" H N N 221 DT "HO3'" H N N 222 DT "H2'" H N N 223 DT "H2''" H N N 224 DT "H1'" H N N 225 DT H3 H N N 226 DT H71 H N N 227 DT H72 H N N 228 DT H73 H N N 229 DT H6 H N N 230 GLN N N N N 231 GLN CA C N S 232 GLN C C N N 233 GLN O O N N 234 GLN CB C N N 235 GLN CG C N N 236 GLN CD C N N 237 GLN OE1 O N N 238 GLN NE2 N N N 239 GLN OXT O N N 240 GLN H H N N 241 GLN H2 H N N 242 GLN HA H N N 243 GLN HB2 H N N 244 GLN HB3 H N N 245 GLN HG2 H N N 246 GLN HG3 H N N 247 GLN HE21 H N N 248 GLN HE22 H N N 249 GLN HXT H N N 250 GLU N N N N 251 GLU CA C N S 252 GLU C C N N 253 GLU O O N N 254 GLU CB C N N 255 GLU CG C N N 256 GLU CD C N N 257 GLU OE1 O N N 258 GLU OE2 O N N 259 GLU OXT O N N 260 GLU H H N N 261 GLU H2 H N N 262 GLU HA H N N 263 GLU HB2 H N N 264 GLU HB3 H N N 265 GLU HG2 H N N 266 GLU HG3 H N N 267 GLU HE2 H N N 268 GLU HXT H N N 269 GLY N N N N 270 GLY CA C N N 271 GLY C C N N 272 GLY O O N N 273 GLY OXT O N N 274 GLY H H N N 275 GLY H2 H N N 276 GLY HA2 H N N 277 GLY HA3 H N N 278 GLY HXT H N N 279 GOL C1 C N N 280 GOL O1 O N N 281 GOL C2 C N N 282 GOL O2 O N N 283 GOL C3 C N N 284 GOL O3 O N N 285 GOL H11 H N N 286 GOL H12 H N N 287 GOL HO1 H N N 288 GOL H2 H N N 289 GOL HO2 H N N 290 GOL H31 H N N 291 GOL H32 H N N 292 GOL HO3 H N N 293 HIS N N N N 294 HIS CA C N S 295 HIS C C N N 296 HIS O O N N 297 HIS CB C N N 298 HIS CG C Y N 299 HIS ND1 N Y N 300 HIS CD2 C Y N 301 HIS CE1 C Y N 302 HIS NE2 N Y N 303 HIS OXT O N N 304 HIS H H N N 305 HIS H2 H N N 306 HIS HA H N N 307 HIS HB2 H N N 308 HIS HB3 H N N 309 HIS HD1 H N N 310 HIS HD2 H N N 311 HIS HE1 H N N 312 HIS HE2 H N N 313 HIS HXT H N N 314 HOH O O N N 315 HOH H1 H N N 316 HOH H2 H N N 317 ILE N N N N 318 ILE CA C N S 319 ILE C C N N 320 ILE O O N N 321 ILE CB C N S 322 ILE CG1 C N N 323 ILE CG2 C N N 324 ILE CD1 C N N 325 ILE OXT O N N 326 ILE H H N N 327 ILE H2 H N N 328 ILE HA H N N 329 ILE HB H N N 330 ILE HG12 H N N 331 ILE HG13 H N N 332 ILE HG21 H N N 333 ILE HG22 H N N 334 ILE HG23 H N N 335 ILE HD11 H N N 336 ILE HD12 H N N 337 ILE HD13 H N N 338 ILE HXT H N N 339 LEU N N N N 340 LEU CA C N S 341 LEU C C N N 342 LEU O O N N 343 LEU CB C N N 344 LEU CG C N N 345 LEU CD1 C N N 346 LEU CD2 C N N 347 LEU OXT O N N 348 LEU H H N N 349 LEU H2 H N N 350 LEU HA H N N 351 LEU HB2 H N N 352 LEU HB3 H N N 353 LEU HG H N N 354 LEU HD11 H N N 355 LEU HD12 H N N 356 LEU HD13 H N N 357 LEU HD21 H N N 358 LEU HD22 H N N 359 LEU HD23 H N N 360 LEU HXT H N N 361 LYS N N N N 362 LYS CA C N S 363 LYS C C N N 364 LYS O O N N 365 LYS CB C N N 366 LYS CG C N N 367 LYS CD C N N 368 LYS CE C N N 369 LYS NZ N N N 370 LYS OXT O N N 371 LYS H H N N 372 LYS H2 H N N 373 LYS HA H N N 374 LYS HB2 H N N 375 LYS HB3 H N N 376 LYS HG2 H N N 377 LYS HG3 H N N 378 LYS HD2 H N N 379 LYS HD3 H N N 380 LYS HE2 H N N 381 LYS HE3 H N N 382 LYS HZ1 H N N 383 LYS HZ2 H N N 384 LYS HZ3 H N N 385 LYS HXT H N N 386 MET N N N N 387 MET CA C N S 388 MET C C N N 389 MET O O N N 390 MET CB C N N 391 MET CG C N N 392 MET SD S N N 393 MET CE C N N 394 MET OXT O N N 395 MET H H N N 396 MET H2 H N N 397 MET HA H N N 398 MET HB2 H N N 399 MET HB3 H N N 400 MET HG2 H N N 401 MET HG3 H N N 402 MET HE1 H N N 403 MET HE2 H N N 404 MET HE3 H N N 405 MET HXT H N N 406 PHE N N N N 407 PHE CA C N S 408 PHE C C N N 409 PHE O O N N 410 PHE CB C N N 411 PHE CG C Y N 412 PHE CD1 C Y N 413 PHE CD2 C Y N 414 PHE CE1 C Y N 415 PHE CE2 C Y N 416 PHE CZ C Y N 417 PHE OXT O N N 418 PHE H H N N 419 PHE H2 H N N 420 PHE HA H N N 421 PHE HB2 H N N 422 PHE HB3 H N N 423 PHE HD1 H N N 424 PHE HD2 H N N 425 PHE HE1 H N N 426 PHE HE2 H N N 427 PHE HZ H N N 428 PHE HXT H N N 429 PRO N N N N 430 PRO CA C N S 431 PRO C C N N 432 PRO O O N N 433 PRO CB C N N 434 PRO CG C N N 435 PRO CD C N N 436 PRO OXT O N N 437 PRO H H N N 438 PRO HA H N N 439 PRO HB2 H N N 440 PRO HB3 H N N 441 PRO HG2 H N N 442 PRO HG3 H N N 443 PRO HD2 H N N 444 PRO HD3 H N N 445 PRO HXT H N N 446 SER N N N N 447 SER CA C N S 448 SER C C N N 449 SER O O N N 450 SER CB C N N 451 SER OG O N N 452 SER OXT O N N 453 SER H H N N 454 SER H2 H N N 455 SER HA H N N 456 SER HB2 H N N 457 SER HB3 H N N 458 SER HG H N N 459 SER HXT H N N 460 THR N N N N 461 THR CA C N S 462 THR C C N N 463 THR O O N N 464 THR CB C N R 465 THR OG1 O N N 466 THR CG2 C N N 467 THR OXT O N N 468 THR H H N N 469 THR H2 H N N 470 THR HA H N N 471 THR HB H N N 472 THR HG1 H N N 473 THR HG21 H N N 474 THR HG22 H N N 475 THR HG23 H N N 476 THR HXT H N N 477 TRP N N N N 478 TRP CA C N S 479 TRP C C N N 480 TRP O O N N 481 TRP CB C N N 482 TRP CG C Y N 483 TRP CD1 C Y N 484 TRP CD2 C Y N 485 TRP NE1 N Y N 486 TRP CE2 C Y N 487 TRP CE3 C Y N 488 TRP CZ2 C Y N 489 TRP CZ3 C Y N 490 TRP CH2 C Y N 491 TRP OXT O N N 492 TRP H H N N 493 TRP H2 H N N 494 TRP HA H N N 495 TRP HB2 H N N 496 TRP HB3 H N N 497 TRP HD1 H N N 498 TRP HE1 H N N 499 TRP HE3 H N N 500 TRP HZ2 H N N 501 TRP HZ3 H N N 502 TRP HH2 H N N 503 TRP HXT H N N 504 TYR N N N N 505 TYR CA C N S 506 TYR C C N N 507 TYR O O N N 508 TYR CB C N N 509 TYR CG C Y N 510 TYR CD1 C Y N 511 TYR CD2 C Y N 512 TYR CE1 C Y N 513 TYR CE2 C Y N 514 TYR CZ C Y N 515 TYR OH O N N 516 TYR OXT O N N 517 TYR H H N N 518 TYR H2 H N N 519 TYR HA H N N 520 TYR HB2 H N N 521 TYR HB3 H N N 522 TYR HD1 H N N 523 TYR HD2 H N N 524 TYR HE1 H N N 525 TYR HE2 H N N 526 TYR HH H N N 527 TYR HXT H N N 528 UEL C4 C Y N 529 UEL C5 C Y N 530 UEL C6 C N R 531 UEL C2 C N N 532 UEL "C1'" C N R 533 UEL "C2'" C N N 534 UEL "C3'" C N S 535 UEL "C4'" C N R 536 UEL "C5'" C N N 537 UEL N1 N N N 538 UEL N3 N N N 539 UEL N7 N Y N 540 UEL N8 N Y N 541 UEL N9 N Y N 542 UEL "O3'" O N N 543 UEL "O4'" O N N 544 UEL "O5'" O N N 545 UEL O6 O N N 546 UEL OP1 O N N 547 UEL OP2 O N N 548 UEL P P N N 549 UEL OP3 O N N 550 UEL H1 H N N 551 UEL H2 H N N 552 UEL H3 H N N 553 UEL H4 H N N 554 UEL H5 H N N 555 UEL H6 H N N 556 UEL H7 H N N 557 UEL H8 H N N 558 UEL H9 H N N 559 UEL H10 H N N 560 UEL H11 H N N 561 UEL H12 H N N 562 UEL H13 H N N 563 UEL H14 H N N 564 VAL N N N N 565 VAL CA C N S 566 VAL C C N N 567 VAL O O N N 568 VAL CB C N N 569 VAL CG1 C N N 570 VAL CG2 C N N 571 VAL OXT O N N 572 VAL H H N N 573 VAL H2 H N N 574 VAL HA H N N 575 VAL HB H N N 576 VAL HG11 H N N 577 VAL HG12 H N N 578 VAL HG13 H N N 579 VAL HG21 H N N 580 VAL HG22 H N N 581 VAL HG23 H N N 582 VAL HXT H N N 583 ZN ZN ZN N N 584 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DA OP3 P sing N N 83 DA OP3 HOP3 sing N N 84 DA P OP1 doub N N 85 DA P OP2 sing N N 86 DA P "O5'" sing N N 87 DA OP2 HOP2 sing N N 88 DA "O5'" "C5'" sing N N 89 DA "C5'" "C4'" sing N N 90 DA "C5'" "H5'" sing N N 91 DA "C5'" "H5''" sing N N 92 DA "C4'" "O4'" sing N N 93 DA "C4'" "C3'" sing N N 94 DA "C4'" "H4'" sing N N 95 DA "O4'" "C1'" sing N N 96 DA "C3'" "O3'" sing N N 97 DA "C3'" "C2'" sing N N 98 DA "C3'" "H3'" sing N N 99 DA "O3'" "HO3'" sing N N 100 DA "C2'" "C1'" sing N N 101 DA "C2'" "H2'" sing N N 102 DA "C2'" "H2''" sing N N 103 DA "C1'" N9 sing N N 104 DA "C1'" "H1'" sing N N 105 DA N9 C8 sing Y N 106 DA N9 C4 sing Y N 107 DA C8 N7 doub Y N 108 DA C8 H8 sing N N 109 DA N7 C5 sing Y N 110 DA C5 C6 sing Y N 111 DA C5 C4 doub Y N 112 DA C6 N6 sing N N 113 DA C6 N1 doub Y N 114 DA N6 H61 sing N N 115 DA N6 H62 sing N N 116 DA N1 C2 sing Y N 117 DA C2 N3 doub Y N 118 DA C2 H2 sing N N 119 DA N3 C4 sing Y N 120 DC OP3 P sing N N 121 DC OP3 HOP3 sing N N 122 DC P OP1 doub N N 123 DC P OP2 sing N N 124 DC P "O5'" sing N N 125 DC OP2 HOP2 sing N N 126 DC "O5'" "C5'" sing N N 127 DC "C5'" "C4'" sing N N 128 DC "C5'" "H5'" sing N N 129 DC "C5'" "H5''" sing N N 130 DC "C4'" "O4'" sing N N 131 DC "C4'" "C3'" sing N N 132 DC "C4'" "H4'" sing N N 133 DC "O4'" "C1'" sing N N 134 DC "C3'" "O3'" sing N N 135 DC "C3'" "C2'" sing N N 136 DC "C3'" "H3'" sing N N 137 DC "O3'" "HO3'" sing N N 138 DC "C2'" "C1'" sing N N 139 DC "C2'" "H2'" sing N N 140 DC "C2'" "H2''" sing N N 141 DC "C1'" N1 sing N N 142 DC "C1'" "H1'" sing N N 143 DC N1 C2 sing N N 144 DC N1 C6 sing N N 145 DC C2 O2 doub N N 146 DC C2 N3 sing N N 147 DC N3 C4 doub N N 148 DC C4 N4 sing N N 149 DC C4 C5 sing N N 150 DC N4 H41 sing N N 151 DC N4 H42 sing N N 152 DC C5 C6 doub N N 153 DC C5 H5 sing N N 154 DC C6 H6 sing N N 155 DG OP3 P sing N N 156 DG OP3 HOP3 sing N N 157 DG P OP1 doub N N 158 DG P OP2 sing N N 159 DG P "O5'" sing N N 160 DG OP2 HOP2 sing N N 161 DG "O5'" "C5'" sing N N 162 DG "C5'" "C4'" sing N N 163 DG "C5'" "H5'" sing N N 164 DG "C5'" "H5''" sing N N 165 DG "C4'" "O4'" sing N N 166 DG "C4'" "C3'" sing N N 167 DG "C4'" "H4'" sing N N 168 DG "O4'" "C1'" sing N N 169 DG "C3'" "O3'" sing N N 170 DG "C3'" "C2'" sing N N 171 DG "C3'" "H3'" sing N N 172 DG "O3'" "HO3'" sing N N 173 DG "C2'" "C1'" sing N N 174 DG "C2'" "H2'" sing N N 175 DG "C2'" "H2''" sing N N 176 DG "C1'" N9 sing N N 177 DG "C1'" "H1'" sing N N 178 DG N9 C8 sing Y N 179 DG N9 C4 sing Y N 180 DG C8 N7 doub Y N 181 DG C8 H8 sing N N 182 DG N7 C5 sing Y N 183 DG C5 C6 sing N N 184 DG C5 C4 doub Y N 185 DG C6 O6 doub N N 186 DG C6 N1 sing N N 187 DG N1 C2 sing N N 188 DG N1 H1 sing N N 189 DG C2 N2 sing N N 190 DG C2 N3 doub N N 191 DG N2 H21 sing N N 192 DG N2 H22 sing N N 193 DG N3 C4 sing N N 194 DT OP3 P sing N N 195 DT OP3 HOP3 sing N N 196 DT P OP1 doub N N 197 DT P OP2 sing N N 198 DT P "O5'" sing N N 199 DT OP2 HOP2 sing N N 200 DT "O5'" "C5'" sing N N 201 DT "C5'" "C4'" sing N N 202 DT "C5'" "H5'" sing N N 203 DT "C5'" "H5''" sing N N 204 DT "C4'" "O4'" sing N N 205 DT "C4'" "C3'" sing N N 206 DT "C4'" "H4'" sing N N 207 DT "O4'" "C1'" sing N N 208 DT "C3'" "O3'" sing N N 209 DT "C3'" "C2'" sing N N 210 DT "C3'" "H3'" sing N N 211 DT "O3'" "HO3'" sing N N 212 DT "C2'" "C1'" sing N N 213 DT "C2'" "H2'" sing N N 214 DT "C2'" "H2''" sing N N 215 DT "C1'" N1 sing N N 216 DT "C1'" "H1'" sing N N 217 DT N1 C2 sing N N 218 DT N1 C6 sing N N 219 DT C2 O2 doub N N 220 DT C2 N3 sing N N 221 DT N3 C4 sing N N 222 DT N3 H3 sing N N 223 DT C4 O4 doub N N 224 DT C4 C5 sing N N 225 DT C5 C7 sing N N 226 DT C5 C6 doub N N 227 DT C7 H71 sing N N 228 DT C7 H72 sing N N 229 DT C7 H73 sing N N 230 DT C6 H6 sing N N 231 GLN N CA sing N N 232 GLN N H sing N N 233 GLN N H2 sing N N 234 GLN CA C sing N N 235 GLN CA CB sing N N 236 GLN CA HA sing N N 237 GLN C O doub N N 238 GLN C OXT sing N N 239 GLN CB CG sing N N 240 GLN CB HB2 sing N N 241 GLN CB HB3 sing N N 242 GLN CG CD sing N N 243 GLN CG HG2 sing N N 244 GLN CG HG3 sing N N 245 GLN CD OE1 doub N N 246 GLN CD NE2 sing N N 247 GLN NE2 HE21 sing N N 248 GLN NE2 HE22 sing N N 249 GLN OXT HXT sing N N 250 GLU N CA sing N N 251 GLU N H sing N N 252 GLU N H2 sing N N 253 GLU CA C sing N N 254 GLU CA CB sing N N 255 GLU CA HA sing N N 256 GLU C O doub N N 257 GLU C OXT sing N N 258 GLU CB CG sing N N 259 GLU CB HB2 sing N N 260 GLU CB HB3 sing N N 261 GLU CG CD sing N N 262 GLU CG HG2 sing N N 263 GLU CG HG3 sing N N 264 GLU CD OE1 doub N N 265 GLU CD OE2 sing N N 266 GLU OE2 HE2 sing N N 267 GLU OXT HXT sing N N 268 GLY N CA sing N N 269 GLY N H sing N N 270 GLY N H2 sing N N 271 GLY CA C sing N N 272 GLY CA HA2 sing N N 273 GLY CA HA3 sing N N 274 GLY C O doub N N 275 GLY C OXT sing N N 276 GLY OXT HXT sing N N 277 GOL C1 O1 sing N N 278 GOL C1 C2 sing N N 279 GOL C1 H11 sing N N 280 GOL C1 H12 sing N N 281 GOL O1 HO1 sing N N 282 GOL C2 O2 sing N N 283 GOL C2 C3 sing N N 284 GOL C2 H2 sing N N 285 GOL O2 HO2 sing N N 286 GOL C3 O3 sing N N 287 GOL C3 H31 sing N N 288 GOL C3 H32 sing N N 289 GOL O3 HO3 sing N N 290 HIS N CA sing N N 291 HIS N H sing N N 292 HIS N H2 sing N N 293 HIS CA C sing N N 294 HIS CA CB sing N N 295 HIS CA HA sing N N 296 HIS C O doub N N 297 HIS C OXT sing N N 298 HIS CB CG sing N N 299 HIS CB HB2 sing N N 300 HIS CB HB3 sing N N 301 HIS CG ND1 sing Y N 302 HIS CG CD2 doub Y N 303 HIS ND1 CE1 doub Y N 304 HIS ND1 HD1 sing N N 305 HIS CD2 NE2 sing Y N 306 HIS CD2 HD2 sing N N 307 HIS CE1 NE2 sing Y N 308 HIS CE1 HE1 sing N N 309 HIS NE2 HE2 sing N N 310 HIS OXT HXT sing N N 311 HOH O H1 sing N N 312 HOH O H2 sing N N 313 ILE N CA sing N N 314 ILE N H sing N N 315 ILE N H2 sing N N 316 ILE CA C sing N N 317 ILE CA CB sing N N 318 ILE CA HA sing N N 319 ILE C O doub N N 320 ILE C OXT sing N N 321 ILE CB CG1 sing N N 322 ILE CB CG2 sing N N 323 ILE CB HB sing N N 324 ILE CG1 CD1 sing N N 325 ILE CG1 HG12 sing N N 326 ILE CG1 HG13 sing N N 327 ILE CG2 HG21 sing N N 328 ILE CG2 HG22 sing N N 329 ILE CG2 HG23 sing N N 330 ILE CD1 HD11 sing N N 331 ILE CD1 HD12 sing N N 332 ILE CD1 HD13 sing N N 333 ILE OXT HXT sing N N 334 LEU N CA sing N N 335 LEU N H sing N N 336 LEU N H2 sing N N 337 LEU CA C sing N N 338 LEU CA CB sing N N 339 LEU CA HA sing N N 340 LEU C O doub N N 341 LEU C OXT sing N N 342 LEU CB CG sing N N 343 LEU CB HB2 sing N N 344 LEU CB HB3 sing N N 345 LEU CG CD1 sing N N 346 LEU CG CD2 sing N N 347 LEU CG HG sing N N 348 LEU CD1 HD11 sing N N 349 LEU CD1 HD12 sing N N 350 LEU CD1 HD13 sing N N 351 LEU CD2 HD21 sing N N 352 LEU CD2 HD22 sing N N 353 LEU CD2 HD23 sing N N 354 LEU OXT HXT sing N N 355 LYS N CA sing N N 356 LYS N H sing N N 357 LYS N H2 sing N N 358 LYS CA C sing N N 359 LYS CA CB sing N N 360 LYS CA HA sing N N 361 LYS C O doub N N 362 LYS C OXT sing N N 363 LYS CB CG sing N N 364 LYS CB HB2 sing N N 365 LYS CB HB3 sing N N 366 LYS CG CD sing N N 367 LYS CG HG2 sing N N 368 LYS CG HG3 sing N N 369 LYS CD CE sing N N 370 LYS CD HD2 sing N N 371 LYS CD HD3 sing N N 372 LYS CE NZ sing N N 373 LYS CE HE2 sing N N 374 LYS CE HE3 sing N N 375 LYS NZ HZ1 sing N N 376 LYS NZ HZ2 sing N N 377 LYS NZ HZ3 sing N N 378 LYS OXT HXT sing N N 379 MET N CA sing N N 380 MET N H sing N N 381 MET N H2 sing N N 382 MET CA C sing N N 383 MET CA CB sing N N 384 MET CA HA sing N N 385 MET C O doub N N 386 MET C OXT sing N N 387 MET CB CG sing N N 388 MET CB HB2 sing N N 389 MET CB HB3 sing N N 390 MET CG SD sing N N 391 MET CG HG2 sing N N 392 MET CG HG3 sing N N 393 MET SD CE sing N N 394 MET CE HE1 sing N N 395 MET CE HE2 sing N N 396 MET CE HE3 sing N N 397 MET OXT HXT sing N N 398 PHE N CA sing N N 399 PHE N H sing N N 400 PHE N H2 sing N N 401 PHE CA C sing N N 402 PHE CA CB sing N N 403 PHE CA HA sing N N 404 PHE C O doub N N 405 PHE C OXT sing N N 406 PHE CB CG sing N N 407 PHE CB HB2 sing N N 408 PHE CB HB3 sing N N 409 PHE CG CD1 doub Y N 410 PHE CG CD2 sing Y N 411 PHE CD1 CE1 sing Y N 412 PHE CD1 HD1 sing N N 413 PHE CD2 CE2 doub Y N 414 PHE CD2 HD2 sing N N 415 PHE CE1 CZ doub Y N 416 PHE CE1 HE1 sing N N 417 PHE CE2 CZ sing Y N 418 PHE CE2 HE2 sing N N 419 PHE CZ HZ sing N N 420 PHE OXT HXT sing N N 421 PRO N CA sing N N 422 PRO N CD sing N N 423 PRO N H sing N N 424 PRO CA C sing N N 425 PRO CA CB sing N N 426 PRO CA HA sing N N 427 PRO C O doub N N 428 PRO C OXT sing N N 429 PRO CB CG sing N N 430 PRO CB HB2 sing N N 431 PRO CB HB3 sing N N 432 PRO CG CD sing N N 433 PRO CG HG2 sing N N 434 PRO CG HG3 sing N N 435 PRO CD HD2 sing N N 436 PRO CD HD3 sing N N 437 PRO OXT HXT sing N N 438 SER N CA sing N N 439 SER N H sing N N 440 SER N H2 sing N N 441 SER CA C sing N N 442 SER CA CB sing N N 443 SER CA HA sing N N 444 SER C O doub N N 445 SER C OXT sing N N 446 SER CB OG sing N N 447 SER CB HB2 sing N N 448 SER CB HB3 sing N N 449 SER OG HG sing N N 450 SER OXT HXT sing N N 451 THR N CA sing N N 452 THR N H sing N N 453 THR N H2 sing N N 454 THR CA C sing N N 455 THR CA CB sing N N 456 THR CA HA sing N N 457 THR C O doub N N 458 THR C OXT sing N N 459 THR CB OG1 sing N N 460 THR CB CG2 sing N N 461 THR CB HB sing N N 462 THR OG1 HG1 sing N N 463 THR CG2 HG21 sing N N 464 THR CG2 HG22 sing N N 465 THR CG2 HG23 sing N N 466 THR OXT HXT sing N N 467 TRP N CA sing N N 468 TRP N H sing N N 469 TRP N H2 sing N N 470 TRP CA C sing N N 471 TRP CA CB sing N N 472 TRP CA HA sing N N 473 TRP C O doub N N 474 TRP C OXT sing N N 475 TRP CB CG sing N N 476 TRP CB HB2 sing N N 477 TRP CB HB3 sing N N 478 TRP CG CD1 doub Y N 479 TRP CG CD2 sing Y N 480 TRP CD1 NE1 sing Y N 481 TRP CD1 HD1 sing N N 482 TRP CD2 CE2 doub Y N 483 TRP CD2 CE3 sing Y N 484 TRP NE1 CE2 sing Y N 485 TRP NE1 HE1 sing N N 486 TRP CE2 CZ2 sing Y N 487 TRP CE3 CZ3 doub Y N 488 TRP CE3 HE3 sing N N 489 TRP CZ2 CH2 doub Y N 490 TRP CZ2 HZ2 sing N N 491 TRP CZ3 CH2 sing Y N 492 TRP CZ3 HZ3 sing N N 493 TRP CH2 HH2 sing N N 494 TRP OXT HXT sing N N 495 TYR N CA sing N N 496 TYR N H sing N N 497 TYR N H2 sing N N 498 TYR CA C sing N N 499 TYR CA CB sing N N 500 TYR CA HA sing N N 501 TYR C O doub N N 502 TYR C OXT sing N N 503 TYR CB CG sing N N 504 TYR CB HB2 sing N N 505 TYR CB HB3 sing N N 506 TYR CG CD1 doub Y N 507 TYR CG CD2 sing Y N 508 TYR CD1 CE1 sing Y N 509 TYR CD1 HD1 sing N N 510 TYR CD2 CE2 doub Y N 511 TYR CD2 HD2 sing N N 512 TYR CE1 CZ doub Y N 513 TYR CE1 HE1 sing N N 514 TYR CE2 CZ sing Y N 515 TYR CE2 HE2 sing N N 516 TYR CZ OH sing N N 517 TYR OH HH sing N N 518 TYR OXT HXT sing N N 519 UEL N1 C6 sing N N 520 UEL N1 C2 sing N N 521 UEL C6 O6 sing N N 522 UEL C6 C5 sing N N 523 UEL C5 N7 sing Y N 524 UEL C5 C4 doub Y N 525 UEL C2 N3 doub N N 526 UEL N7 N8 doub Y N 527 UEL C4 N3 sing N N 528 UEL C4 N9 sing Y N 529 UEL N8 N9 sing Y N 530 UEL OP1 P doub N N 531 UEL N9 "C1'" sing N N 532 UEL "O4'" "C1'" sing N N 533 UEL "O4'" "C4'" sing N N 534 UEL "C1'" "C2'" sing N N 535 UEL "C5'" "C4'" sing N N 536 UEL "C5'" "O5'" sing N N 537 UEL P "O5'" sing N N 538 UEL P OP2 sing N N 539 UEL "C4'" "C3'" sing N N 540 UEL "C2'" "C3'" sing N N 541 UEL "C3'" "O3'" sing N N 542 UEL P OP3 sing N N 543 UEL C6 H1 sing N N 544 UEL C2 H2 sing N N 545 UEL "C1'" H3 sing N N 546 UEL "C2'" H4 sing N N 547 UEL "C2'" H5 sing N N 548 UEL "C3'" H6 sing N N 549 UEL "C4'" H7 sing N N 550 UEL "C5'" H8 sing N N 551 UEL "C5'" H9 sing N N 552 UEL N1 H10 sing N N 553 UEL "O3'" H11 sing N N 554 UEL O6 H12 sing N N 555 UEL OP2 H13 sing N N 556 UEL OP3 H14 sing N N 557 VAL N CA sing N N 558 VAL N H sing N N 559 VAL N H2 sing N N 560 VAL CA C sing N N 561 VAL CA CB sing N N 562 VAL CA HA sing N N 563 VAL C O doub N N 564 VAL C OXT sing N N 565 VAL CB CG1 sing N N 566 VAL CB CG2 sing N N 567 VAL CB HB sing N N 568 VAL CG1 HG11 sing N N 569 VAL CG1 HG12 sing N N 570 VAL CG1 HG13 sing N N 571 VAL CG2 HG21 sing N N 572 VAL CG2 HG22 sing N N 573 VAL CG2 HG23 sing N N 574 VAL OXT HXT sing N N 575 # _ndb_struct_conf_na.entry_id 8E2Q _ndb_struct_conf_na.feature 'double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 E DG 1 1_555 E DC 7 1_555 0.345 0.034 0.433 10.720 -15.906 2.591 1 E_DG1:DC7_E E 1 ? E 7 ? 19 1 1 E DA 13 1_555 E DG 6 1_555 -3.277 4.292 0.350 -16.300 -1.208 68.916 2 E_DA13:DG6_E E 13 ? E 6 ? 10 6 1 E DC 10 1_555 E DG 5 1_555 0.383 -0.104 -0.035 6.603 -3.965 -2.777 3 E_DC10:DG5_E E 10 ? E 5 ? 19 1 1 E DG 11 1_555 E DC 4 1_555 -0.242 -0.174 -0.211 5.446 12.506 4.754 4 E_DG11:DC4_E E 11 ? E 4 ? 19 1 1 F DG 1 1_555 F DC 7 1_555 0.229 -0.153 0.544 -0.020 -23.436 1.396 5 F_DG1:DC7_F F 1 ? F 7 ? 19 1 1 F DA 13 1_555 F DG 6 1_555 -3.142 4.278 0.423 -16.897 0.193 67.210 6 F_DA13:DG6_F F 13 ? F 6 ? 10 6 1 F DC 10 1_555 F DG 5 1_555 0.557 -0.328 0.024 6.216 -2.834 -0.967 7 F_DC10:DG5_F F 10 ? F 5 ? 19 1 1 F DG 11 1_555 F DC 4 1_555 -0.428 -0.248 -0.132 12.165 11.565 5.324 8 F_DG11:DC4_F F 11 ? F 4 ? 19 1 1 G DC 4 1_555 G DG 11 1_555 0.429 -0.387 -0.179 -9.640 11.411 1.154 9 G_DC4:DG11_G G 4 ? G 11 ? 19 1 1 G DG 5 1_555 G DC 10 1_555 -0.236 -0.227 0.217 -3.241 -2.924 -1.180 10 G_DG5:DC10_G G 5 ? G 10 ? 19 1 1 G DG 6 1_555 G DA 13 1_555 2.954 -3.972 -0.469 21.864 -3.115 -68.005 11 G_DG6:DA13_G G 6 ? G 13 ? 10 6 1 H DC 4 1_555 H DG 11 1_555 0.555 -0.311 -0.072 -2.552 11.245 4.462 12 H_DC4:DG11_H H 4 ? H 11 ? 19 1 1 H DG 5 1_555 H DC 10 1_555 -0.460 -0.267 0.189 -5.090 -4.025 -1.716 13 H_DG5:DC10_H H 5 ? H 10 ? 19 1 1 H DG 6 1_555 H DA 13 1_555 3.374 -4.090 -0.450 18.004 0.440 -64.454 14 H_DG6:DA13_H H 6 ? H 13 ? 10 6 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 E DG 1 1_555 E DC 7 1_555 E DA 13 1_555 E DG 6 1_555 -5.160 2.416 -4.135 105.871 30.381 127.842 1.512 1.748 -5.436 15.971 -55.656 150.844 1 EE_DG1DA13:DG6DC7_EE E 1 ? E 7 ? E 13 ? E 6 ? 1 E DA 13 1_555 E DG 6 1_555 E DC 10 1_555 E DG 5 1_555 -3.677 -0.618 0.533 122.144 -129.894 20.266 -0.739 1.434 -1.942 -65.457 -61.551 178.328 2 EE_DA13DC10:DG5DG6_EE E 13 ? E 6 ? E 10 ? E 5 ? 1 E DC 10 1_555 E DG 5 1_555 E DG 11 1_555 E DC 4 1_555 0.926 -1.148 3.768 -3.061 -11.859 36.145 0.043 -1.884 3.855 -18.473 4.767 38.098 3 EE_DC10DG11:DC4DG5_EE E 10 ? E 5 ? E 11 ? E 4 ? 1 F DG 1 1_555 F DC 7 1_555 F DA 13 1_555 F DG 6 1_555 -4.675 2.383 -4.665 105.702 26.210 138.629 1.407 1.622 -5.623 13.535 -54.584 156.298 4 FF_DG1DA13:DG6DC7_FF F 1 ? F 7 ? F 13 ? F 6 ? 1 F DA 13 1_555 F DG 6 1_555 F DC 10 1_555 F DG 5 1_555 -3.218 -1.074 1.708 121.049 -130.690 -48.928 1.408 -0.803 1.981 65.745 60.896 -178.304 5 FF_DA13DC10:DG5DG6_FF F 13 ? F 6 ? F 10 ? F 5 ? 1 F DC 10 1_555 F DG 5 1_555 F DG 11 1_555 F DC 4 1_555 1.034 -1.207 3.580 -1.597 -14.354 36.370 0.204 -1.771 3.732 -21.961 2.443 39.043 6 FF_DC10DG11:DC4DG5_FF F 10 ? F 5 ? F 11 ? F 4 ? 1 G DC 4 1_555 G DG 11 1_555 G DG 5 1_555 G DC 10 1_555 -0.541 -1.075 3.538 2.367 -10.696 35.768 -0.090 1.196 3.657 -16.932 -3.748 37.355 7 GG_DC4DG5:DC10DG11_GG G 4 ? G 11 ? G 5 ? G 10 ? 1 G DG 5 1_555 G DC 10 1_555 G DG 6 1_555 G DA 13 1_555 1.891 0.604 3.187 0.437 -0.274 90.846 0.430 -1.319 3.193 -0.192 -0.307 90.848 8 GG_DG5DG6:DA13DC10_GG G 5 ? G 10 ? G 6 ? G 13 ? 1 H DC 4 1_555 H DG 11 1_555 H DG 5 1_555 H DC 10 1_555 -0.641 -1.258 3.732 4.888 -12.808 34.916 0.057 1.769 3.825 -20.400 -7.786 37.432 9 HH_DC4DG5:DC10DG11_HH H 4 ? H 11 ? H 5 ? H 10 ? 1 H DG 5 1_555 H DC 10 1_555 H DG 6 1_555 H DA 13 1_555 2.270 0.601 2.967 3.511 2.334 92.816 0.374 -1.506 3.043 1.611 -2.423 92.890 10 HH_DG5DG6:DA13DC10_HH H 5 ? H 10 ? H 6 ? H 13 ? # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id UEL _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id UEL _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 GLYCEROL GOL 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8E2P _pdbx_initial_refinement_model.details ? # _pdbx_reflns_twin.domain_id 1 _pdbx_reflns_twin.crystal_id 1 _pdbx_reflns_twin.diffrn_id 1 _pdbx_reflns_twin.fraction 0.280 _pdbx_reflns_twin.operator -h,-k,l _pdbx_reflns_twin.type ? _pdbx_reflns_twin.mean_F_square_over_mean_F2 ? _pdbx_reflns_twin.mean_I2_over_mean_I_square ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #