data_8FBI # _entry.id 8FBI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.367 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8FBI pdb_00008fbi 10.2210/pdb8fbi/pdb WWPDB D_1000270340 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8FBI _pdbx_database_status.recvd_initial_deposition_date 2022-11-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, J.Y.' 1 ? 'Khmelinskaia, A.' 2 ? 'Bera, A.K.' 3 ? 'King, N.P.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 120 _citation.language ? _citation.page_first e2214556120 _citation.page_last e2214556120 _citation.title 'Improving the secretion of designed protein assemblies through negative design of cryptic transmembrane domains.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2214556120 _citation.pdbx_database_id_PubMed 36888664 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, J.Y.J.' 1 0000-0002-1511-6976 primary 'Khmelinskaia, A.' 2 ? primary 'Sheffler, W.' 3 ? primary 'Miranda, M.C.' 4 ? primary 'Antanasijevic, A.' 5 ? primary 'Borst, A.J.' 6 0000-0003-4297-7824 primary 'Torres, S.V.' 7 0000-0001-8226-8227 primary 'Shu, C.' 8 ? primary 'Hsia, Y.' 9 0000-0001-7467-8373 primary 'Nattermann, U.' 10 ? primary 'Ellis, D.' 11 ? primary 'Walkey, C.' 12 ? primary 'Ahlrichs, M.' 13 ? primary 'Chan, S.' 14 0000-0002-1617-0464 primary 'Kang, A.' 15 0000-0001-5487-0499 primary 'Nguyen, H.' 16 0000-0001-9696-4004 primary 'Sydeman, C.' 17 ? primary 'Sankaran, B.' 18 ? primary 'Wu, M.' 19 ? primary 'Bera, A.K.' 20 ? primary 'Carter, L.' 21 0000-0002-9837-9068 primary 'Fiala, B.' 22 0000-0003-0148-5268 primary 'Murphy, M.' 23 ? primary 'Baker, D.' 24 0000-0001-7896-6217 primary 'Ward, A.B.' 25 0000-0001-7153-3769 primary 'King, N.P.' 26 0000-0002-2978-4692 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8FBI _cell.details ? _cell.formula_units_Z ? _cell.length_a 115.661 _cell.length_a_esd ? _cell.length_b 115.661 _cell.length_b_esd ? _cell.length_c 72.079 _cell.length_c_esd ? _cell.volume 835051.519 _cell.volume_esd ? _cell.Z_PDB 9 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8FBI _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall 'R 3' _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description KWOCA_39 _entity.formula_weight 33340.488 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPETFEAIARAIEVAREVEKVAQRAEEEGNPDLRDSAKELARAVDEAIEEAKKQGNPELVEWVARAAKVAAEVIKVAIQA EKEGNRDLFRAALELVRAVIEAIEEAVKQGNPELVEWVARAAKVAAEVIKVAIQAEKEGARDLFRLALELVRAVIEAIEF AVKLGDPEMVERAARIAKTAAELIKRAIRAKKEGDKDQEREAKKRVTRLIIELTLMVLKASLDLLRRILEELKEMLERLE KNPDKDVIVKVLKVIVKAIEASVDNQRVSADNQKMLAELAGSWSGGGSEQKLISEEDLGGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MPETFEAIARAIEVAREVEKVAQRAEEEGNPDLRDSAKELARAVDEAIEEAKKQGNPELVEWVARAAKVAAEVIKVAIQA EKEGNRDLFRAALELVRAVIEAIEEAVKQGNPELVEWVARAAKVAAEVIKVAIQAEKEGARDLFRLALELVRAVIEAIEF AVKLGDPEMVERAARIAKTAAELIKRAIRAKKEGDKDQEREAKKRVTRLIIELTLMVLKASLDLLRRILEELKEMLERLE KNPDKDVIVKVLKVIVKAIEASVDNQRVSADNQKMLAELAGSWSGGGSEQKLISEEDLGGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 GLU n 1 4 THR n 1 5 PHE n 1 6 GLU n 1 7 ALA n 1 8 ILE n 1 9 ALA n 1 10 ARG n 1 11 ALA n 1 12 ILE n 1 13 GLU n 1 14 VAL n 1 15 ALA n 1 16 ARG n 1 17 GLU n 1 18 VAL n 1 19 GLU n 1 20 LYS n 1 21 VAL n 1 22 ALA n 1 23 GLN n 1 24 ARG n 1 25 ALA n 1 26 GLU n 1 27 GLU n 1 28 GLU n 1 29 GLY n 1 30 ASN n 1 31 PRO n 1 32 ASP n 1 33 LEU n 1 34 ARG n 1 35 ASP n 1 36 SER n 1 37 ALA n 1 38 LYS n 1 39 GLU n 1 40 LEU n 1 41 ALA n 1 42 ARG n 1 43 ALA n 1 44 VAL n 1 45 ASP n 1 46 GLU n 1 47 ALA n 1 48 ILE n 1 49 GLU n 1 50 GLU n 1 51 ALA n 1 52 LYS n 1 53 LYS n 1 54 GLN n 1 55 GLY n 1 56 ASN n 1 57 PRO n 1 58 GLU n 1 59 LEU n 1 60 VAL n 1 61 GLU n 1 62 TRP n 1 63 VAL n 1 64 ALA n 1 65 ARG n 1 66 ALA n 1 67 ALA n 1 68 LYS n 1 69 VAL n 1 70 ALA n 1 71 ALA n 1 72 GLU n 1 73 VAL n 1 74 ILE n 1 75 LYS n 1 76 VAL n 1 77 ALA n 1 78 ILE n 1 79 GLN n 1 80 ALA n 1 81 GLU n 1 82 LYS n 1 83 GLU n 1 84 GLY n 1 85 ASN n 1 86 ARG n 1 87 ASP n 1 88 LEU n 1 89 PHE n 1 90 ARG n 1 91 ALA n 1 92 ALA n 1 93 LEU n 1 94 GLU n 1 95 LEU n 1 96 VAL n 1 97 ARG n 1 98 ALA n 1 99 VAL n 1 100 ILE n 1 101 GLU n 1 102 ALA n 1 103 ILE n 1 104 GLU n 1 105 GLU n 1 106 ALA n 1 107 VAL n 1 108 LYS n 1 109 GLN n 1 110 GLY n 1 111 ASN n 1 112 PRO n 1 113 GLU n 1 114 LEU n 1 115 VAL n 1 116 GLU n 1 117 TRP n 1 118 VAL n 1 119 ALA n 1 120 ARG n 1 121 ALA n 1 122 ALA n 1 123 LYS n 1 124 VAL n 1 125 ALA n 1 126 ALA n 1 127 GLU n 1 128 VAL n 1 129 ILE n 1 130 LYS n 1 131 VAL n 1 132 ALA n 1 133 ILE n 1 134 GLN n 1 135 ALA n 1 136 GLU n 1 137 LYS n 1 138 GLU n 1 139 GLY n 1 140 ALA n 1 141 ARG n 1 142 ASP n 1 143 LEU n 1 144 PHE n 1 145 ARG n 1 146 LEU n 1 147 ALA n 1 148 LEU n 1 149 GLU n 1 150 LEU n 1 151 VAL n 1 152 ARG n 1 153 ALA n 1 154 VAL n 1 155 ILE n 1 156 GLU n 1 157 ALA n 1 158 ILE n 1 159 GLU n 1 160 PHE n 1 161 ALA n 1 162 VAL n 1 163 LYS n 1 164 LEU n 1 165 GLY n 1 166 ASP n 1 167 PRO n 1 168 GLU n 1 169 MET n 1 170 VAL n 1 171 GLU n 1 172 ARG n 1 173 ALA n 1 174 ALA n 1 175 ARG n 1 176 ILE n 1 177 ALA n 1 178 LYS n 1 179 THR n 1 180 ALA n 1 181 ALA n 1 182 GLU n 1 183 LEU n 1 184 ILE n 1 185 LYS n 1 186 ARG n 1 187 ALA n 1 188 ILE n 1 189 ARG n 1 190 ALA n 1 191 LYS n 1 192 LYS n 1 193 GLU n 1 194 GLY n 1 195 ASP n 1 196 LYS n 1 197 ASP n 1 198 GLN n 1 199 GLU n 1 200 ARG n 1 201 GLU n 1 202 ALA n 1 203 LYS n 1 204 LYS n 1 205 ARG n 1 206 VAL n 1 207 THR n 1 208 ARG n 1 209 LEU n 1 210 ILE n 1 211 ILE n 1 212 GLU n 1 213 LEU n 1 214 THR n 1 215 LEU n 1 216 MET n 1 217 VAL n 1 218 LEU n 1 219 LYS n 1 220 ALA n 1 221 SER n 1 222 LEU n 1 223 ASP n 1 224 LEU n 1 225 LEU n 1 226 ARG n 1 227 ARG n 1 228 ILE n 1 229 LEU n 1 230 GLU n 1 231 GLU n 1 232 LEU n 1 233 LYS n 1 234 GLU n 1 235 MET n 1 236 LEU n 1 237 GLU n 1 238 ARG n 1 239 LEU n 1 240 GLU n 1 241 LYS n 1 242 ASN n 1 243 PRO n 1 244 ASP n 1 245 LYS n 1 246 ASP n 1 247 VAL n 1 248 ILE n 1 249 VAL n 1 250 LYS n 1 251 VAL n 1 252 LEU n 1 253 LYS n 1 254 VAL n 1 255 ILE n 1 256 VAL n 1 257 LYS n 1 258 ALA n 1 259 ILE n 1 260 GLU n 1 261 ALA n 1 262 SER n 1 263 VAL n 1 264 ASP n 1 265 ASN n 1 266 GLN n 1 267 ARG n 1 268 VAL n 1 269 SER n 1 270 ALA n 1 271 ASP n 1 272 ASN n 1 273 GLN n 1 274 LYS n 1 275 MET n 1 276 LEU n 1 277 ALA n 1 278 GLU n 1 279 LEU n 1 280 ALA n 1 281 GLY n 1 282 SER n 1 283 TRP n 1 284 SER n 1 285 GLY n 1 286 GLY n 1 287 GLY n 1 288 SER n 1 289 GLU n 1 290 GLN n 1 291 LYS n 1 292 LEU n 1 293 ILE n 1 294 SER n 1 295 GLU n 1 296 GLU n 1 297 ASP n 1 298 LEU n 1 299 GLY n 1 300 GLY n 1 301 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 301 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8FBI _struct_ref.pdbx_db_accession 8FBI _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8FBI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 301 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8FBI _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 301 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 301 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8FBI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.78 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium acetate, 0.1 M Na3C6H5O7, pH 5.6, 30% v/v MPD' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-06-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 185.19 _reflns.entry_id 8FBI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.61 _reflns.d_resolution_low 58.51 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4127 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.978 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.212 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.61 _reflns_shell.d_res_low 3.96 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 983 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.6 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.665 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.663 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 183.89 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8FBI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.61 _refine.ls_d_res_low 58.51 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4126 _refine.ls_number_reflns_R_free 517 _refine.ls_number_reflns_R_work 3609 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.88 _refine.ls_percent_reflns_R_free 12.53 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2384 _refine.ls_R_factor_R_free 0.2788 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2328 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.24 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 39.8896 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5199 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.61 _refine_hist.d_res_low 58.51 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2141 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2141 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0011 ? 2152 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.3257 ? 2891 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0289 ? 347 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0020 ? 377 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.4364 ? 857 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.61 3.97 . . 149 882 100.00 . . . . 0.3614 . . . . . . . . . . . 0.3779 'X-RAY DIFFRACTION' 3.97 4.55 . . 141 894 100.00 . . . . 0.2900 . . . . . . . . . . . 0.2853 'X-RAY DIFFRACTION' 4.55 5.73 . . 101 923 99.81 . . . . 0.3265 . . . . . . . . . . . 0.3628 'X-RAY DIFFRACTION' 5.73 58.51 . . 126 910 99.71 . . . . 0.1841 . . . . . . . . . . . 0.2439 # _struct.entry_id 8FBI _struct.title 'Improving the secretion of designed protein assemblies through negative design of cryptic transmembrane domains' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8FBI _struct_keywords.text 'designed protein, protein assemblies, negative design, cryptic transmembrane domains, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 7 ? GLU A 27 ? ALA A 7 GLU A 27 1 ? 21 HELX_P HELX_P2 AA2 ASN A 30 ? GLY A 55 ? ASN A 30 GLY A 55 1 ? 26 HELX_P HELX_P3 AA3 ASN A 56 ? GLU A 83 ? ASN A 56 GLU A 83 1 ? 28 HELX_P HELX_P4 AA4 ASN A 85 ? GLN A 109 ? ASN A 85 GLN A 109 1 ? 25 HELX_P HELX_P5 AA5 GLU A 113 ? GLU A 138 ? GLU A 113 GLU A 138 1 ? 26 HELX_P HELX_P6 AA6 ALA A 140 ? GLY A 165 ? ALA A 140 GLY A 165 1 ? 26 HELX_P HELX_P7 AA7 ASP A 166 ? GLU A 193 ? ASP A 166 GLU A 193 1 ? 28 HELX_P HELX_P8 AA8 ASP A 195 ? ASN A 242 ? ASP A 195 ASN A 242 1 ? 48 HELX_P HELX_P9 AA9 ASP A 244 ? ALA A 280 ? ASP A 244 ALA A 280 1 ? 37 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 8FBI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008646 _atom_sites.fract_transf_matrix[1][2] 0.004992 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009983 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013874 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 5.96793 ? ? ? 14.89577 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 15.91112 ? ? ? 10.84690 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 PHE 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 TRP 117 117 117 TRP TRP A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 MET 169 169 169 MET MET A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 LYS 192 192 192 LYS LYS A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 GLN 198 198 198 GLN GLN A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 LYS 203 203 203 LYS LYS A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 ARG 205 205 205 ARG ARG A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 THR 207 207 207 THR THR A . n A 1 208 ARG 208 208 208 ARG ARG A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 ILE 211 211 211 ILE ILE A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 THR 214 214 214 THR THR A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 MET 216 216 216 MET MET A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 ARG 226 226 226 ARG ARG A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 MET 235 235 235 MET MET A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 LYS 241 241 241 LYS LYS A . n A 1 242 ASN 242 242 242 ASN ASN A . n A 1 243 PRO 243 243 243 PRO PRO A . n A 1 244 ASP 244 244 244 ASP ASP A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 ASP 246 246 246 ASP ASP A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 ILE 248 248 248 ILE ILE A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 LYS 250 250 250 LYS LYS A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 VAL 254 254 254 VAL VAL A . n A 1 255 ILE 255 255 255 ILE ILE A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 LYS 257 257 257 LYS LYS A . n A 1 258 ALA 258 258 258 ALA ALA A . n A 1 259 ILE 259 259 259 ILE ILE A . n A 1 260 GLU 260 260 260 GLU GLU A . n A 1 261 ALA 261 261 261 ALA ALA A . n A 1 262 SER 262 262 262 SER SER A . n A 1 263 VAL 263 263 263 VAL VAL A . n A 1 264 ASP 264 264 264 ASP ASP A . n A 1 265 ASN 265 265 265 ASN ASN A . n A 1 266 GLN 266 266 266 GLN GLN A . n A 1 267 ARG 267 267 267 ARG ARG A . n A 1 268 VAL 268 268 268 VAL VAL A . n A 1 269 SER 269 269 269 SER SER A . n A 1 270 ALA 270 270 270 ALA ALA A . n A 1 271 ASP 271 271 271 ASP ASP A . n A 1 272 ASN 272 272 272 ASN ASN A . n A 1 273 GLN 273 273 273 GLN GLN A . n A 1 274 LYS 274 274 274 LYS LYS A . n A 1 275 MET 275 275 275 MET MET A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 ALA 277 277 277 ALA ALA A . n A 1 278 GLU 278 278 278 GLU GLU A . n A 1 279 LEU 279 279 279 LEU LEU A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 GLY 281 281 ? ? ? A . n A 1 282 SER 282 282 ? ? ? A . n A 1 283 TRP 283 283 ? ? ? A . n A 1 284 SER 284 284 ? ? ? A . n A 1 285 GLY 285 285 ? ? ? A . n A 1 286 GLY 286 286 ? ? ? A . n A 1 287 GLY 287 287 ? ? ? A . n A 1 288 SER 288 288 ? ? ? A . n A 1 289 GLU 289 289 ? ? ? A . n A 1 290 GLN 290 290 ? ? ? A . n A 1 291 LYS 291 291 ? ? ? A . n A 1 292 LEU 292 292 ? ? ? A . n A 1 293 ILE 293 293 ? ? ? A . n A 1 294 SER 294 294 ? ? ? A . n A 1 295 GLU 295 295 ? ? ? A . n A 1 296 GLU 296 296 ? ? ? A . n A 1 297 ASP 297 297 ? ? ? A . n A 1 298 LEU 298 298 ? ? ? A . n A 1 299 GLY 299 299 ? ? ? A . n A 1 300 GLY 300 300 ? ? ? A . n A 1 301 SER 301 301 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email neil@ipd.uw.edu _pdbx_contact_author.name_first Neil _pdbx_contact_author.name_last King _pdbx_contact_author.name_mi P _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2978-4692 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6110 ? 1 MORE -55 ? 1 'SSA (A^2)' 36720 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-03-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z 3 -x+y,-x,z 4 x+1/3,y+2/3,z+2/3 5 -y+1/3,x-y+2/3,z+2/3 6 -x+y+1/3,-x+2/3,z+2/3 7 x+2/3,y+1/3,z+1/3 8 -y+2/3,x-y+1/3,z+1/3 9 -x+y+2/3,-x+1/3,z+1/3 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 140 ? ? -158.80 73.85 2 1 GLU A 193 ? ? -97.16 36.24 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A PHE 5 ? A PHE 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A GLY 281 ? A GLY 281 8 1 Y 1 A SER 282 ? A SER 282 9 1 Y 1 A TRP 283 ? A TRP 283 10 1 Y 1 A SER 284 ? A SER 284 11 1 Y 1 A GLY 285 ? A GLY 285 12 1 Y 1 A GLY 286 ? A GLY 286 13 1 Y 1 A GLY 287 ? A GLY 287 14 1 Y 1 A SER 288 ? A SER 288 15 1 Y 1 A GLU 289 ? A GLU 289 16 1 Y 1 A GLN 290 ? A GLN 290 17 1 Y 1 A LYS 291 ? A LYS 291 18 1 Y 1 A LEU 292 ? A LEU 292 19 1 Y 1 A ILE 293 ? A ILE 293 20 1 Y 1 A SER 294 ? A SER 294 21 1 Y 1 A GLU 295 ? A GLU 295 22 1 Y 1 A GLU 296 ? A GLU 296 23 1 Y 1 A ASP 297 ? A ASP 297 24 1 Y 1 A LEU 298 ? A LEU 298 25 1 Y 1 A GLY 299 ? A GLY 299 26 1 Y 1 A GLY 300 ? A GLY 300 27 1 Y 1 A SER 301 ? A SER 301 # _pdbx_audit_support.funding_organization 'Bill & Melinda Gates Foundation' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'R 3 :H' _space_group.name_Hall 'R 3' _space_group.IT_number 146 _space_group.crystal_system trigonal _space_group.id 1 #