data_8FJY # _entry.id 8FJY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8FJY pdb_00008fjy 10.2210/pdb8fjy/pdb WWPDB D_1000270497 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8FJY _pdbx_database_status.recvd_initial_deposition_date 2022-12-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wong-Roushar, J.' 1 0000-0002-3278-3711 'Dann III, C.E.' 2 0000-0002-0117-9474 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 66 _citation.language ? _citation.page_first 11294 _citation.page_last 11323 _citation.title 'Structure-Based Design of Transport-Specific Multitargeted One-Carbon Metabolism Inhibitors in Cytosol and Mitochondria.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.3c00763 _citation.pdbx_database_id_PubMed 37582241 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nayeen, M.J.' 1 ? primary 'Katinas, J.M.' 2 ? primary 'Magdum, T.' 3 0009-0004-4710-9975 primary 'Shah, K.' 4 ? primary 'Wong, J.E.' 5 ? primary ;O'Connor, C.E. ; 6 ? primary 'Fifer, A.N.' 7 ? primary 'Wallace-Povirk, A.' 8 0000-0002-9562-5892 primary 'Hou, Z.' 9 0000-0001-5631-5202 primary 'Matherly, L.H.' 10 0000-0001-6860-8133 primary 'Dann 3rd, C.E.' 11 ? primary 'Gangjee, A.' 12 0000-0002-5513-7616 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 8FJY _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.478 _cell.length_a_esd ? _cell.length_b 75.478 _cell.length_b_esd ? _cell.length_c 100.771 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8FJY _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Trifunctional purine biosynthetic protein adenosine-3' 22810.139 1 6.3.4.13,6.3.3.1,2.1.2.2 ? 'UNP residues 808-1010' ? 2 non-polymer syn 'GLYCINAMIDE RIBONUCLEOTIDE' 284.160 1 ? ? ? ? 3 non-polymer syn 'N-{4-[3-(2-amino-4-oxo-3,4-dihydro-5H-pyrrolo[3,2-d]pyrimidin-5-yl)propyl]benzoyl}-L-glutamic acid' 441.437 1 ? ? ? ? 4 water nat water 18.015 15 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFS IDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRG DTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFS IDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRG DTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ARG n 1 4 VAL n 1 5 ALA n 1 6 VAL n 1 7 LEU n 1 8 ILE n 1 9 SER n 1 10 GLY n 1 11 THR n 1 12 GLY n 1 13 SER n 1 14 ASN n 1 15 LEU n 1 16 GLN n 1 17 ALA n 1 18 LEU n 1 19 ILE n 1 20 ASP n 1 21 SER n 1 22 THR n 1 23 ARG n 1 24 GLU n 1 25 PRO n 1 26 ASN n 1 27 SER n 1 28 SER n 1 29 ALA n 1 30 GLN n 1 31 ILE n 1 32 ASP n 1 33 ILE n 1 34 VAL n 1 35 ILE n 1 36 SER n 1 37 ASN n 1 38 LYS n 1 39 ALA n 1 40 ALA n 1 41 VAL n 1 42 ALA n 1 43 GLY n 1 44 LEU n 1 45 ASP n 1 46 LYS n 1 47 ALA n 1 48 GLU n 1 49 ARG n 1 50 ALA n 1 51 GLY n 1 52 ILE n 1 53 PRO n 1 54 THR n 1 55 ARG n 1 56 VAL n 1 57 ILE n 1 58 ASN n 1 59 HIS n 1 60 LYS n 1 61 LEU n 1 62 TYR n 1 63 LYS n 1 64 ASN n 1 65 ARG n 1 66 VAL n 1 67 GLU n 1 68 PHE n 1 69 ASP n 1 70 SER n 1 71 ALA n 1 72 ILE n 1 73 ASP n 1 74 LEU n 1 75 VAL n 1 76 LEU n 1 77 GLU n 1 78 GLU n 1 79 PHE n 1 80 SER n 1 81 ILE n 1 82 ASP n 1 83 ILE n 1 84 VAL n 1 85 CYS n 1 86 LEU n 1 87 ALA n 1 88 GLY n 1 89 PHE n 1 90 MET n 1 91 ARG n 1 92 ILE n 1 93 LEU n 1 94 SER n 1 95 GLY n 1 96 PRO n 1 97 PHE n 1 98 VAL n 1 99 GLN n 1 100 LYS n 1 101 TRP n 1 102 ASN n 1 103 GLY n 1 104 LYS n 1 105 MET n 1 106 LEU n 1 107 ASN n 1 108 ILE n 1 109 HIS n 1 110 PRO n 1 111 SER n 1 112 LEU n 1 113 LEU n 1 114 PRO n 1 115 SER n 1 116 PHE n 1 117 LYS n 1 118 GLY n 1 119 SER n 1 120 ASN n 1 121 ALA n 1 122 HIS n 1 123 GLU n 1 124 GLN n 1 125 ALA n 1 126 LEU n 1 127 GLU n 1 128 THR n 1 129 GLY n 1 130 VAL n 1 131 THR n 1 132 VAL n 1 133 THR n 1 134 GLY n 1 135 CYS n 1 136 THR n 1 137 VAL n 1 138 HIS n 1 139 PHE n 1 140 VAL n 1 141 ALA n 1 142 GLU n 1 143 ASP n 1 144 VAL n 1 145 ASP n 1 146 ALA n 1 147 GLY n 1 148 GLN n 1 149 ILE n 1 150 ILE n 1 151 LEU n 1 152 GLN n 1 153 GLU n 1 154 ALA n 1 155 VAL n 1 156 PRO n 1 157 VAL n 1 158 LYS n 1 159 ARG n 1 160 GLY n 1 161 ASP n 1 162 THR n 1 163 VAL n 1 164 ALA n 1 165 THR n 1 166 LEU n 1 167 SER n 1 168 GLU n 1 169 ARG n 1 170 VAL n 1 171 LYS n 1 172 LEU n 1 173 ALA n 1 174 GLU n 1 175 HIS n 1 176 LYS n 1 177 ILE n 1 178 PHE n 1 179 PRO n 1 180 ALA n 1 181 ALA n 1 182 LEU n 1 183 GLN n 1 184 LEU n 1 185 VAL n 1 186 ALA n 1 187 SER n 1 188 GLY n 1 189 THR n 1 190 VAL n 1 191 GLN n 1 192 LEU n 1 193 GLY n 1 194 GLU n 1 195 ASN n 1 196 GLY n 1 197 LYS n 1 198 ILE n 1 199 CYS n 1 200 TRP n 1 201 VAL n 1 202 LYS n 1 203 GLU n 1 204 GLU n 1 205 HIS n 1 206 HIS n 1 207 HIS n 1 208 HIS n 1 209 HIS n 1 210 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 210 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GART, PGFT, PRGS' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PUR2_HUMAN _struct_ref.pdbx_db_accession P22102 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSI DIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGD TVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEE ; _struct_ref.pdbx_align_begin 808 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8FJY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 204 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22102 _struct_ref_seq.db_align_beg 808 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1010 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 808 _struct_ref_seq.pdbx_auth_seq_align_end 1010 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8FJY MET A 1 ? UNP P22102 ? ? 'initiating methionine' 807 1 1 8FJY HIS A 205 ? UNP P22102 ? ? 'expression tag' 1011 2 1 8FJY HIS A 206 ? UNP P22102 ? ? 'expression tag' 1012 3 1 8FJY HIS A 207 ? UNP P22102 ? ? 'expression tag' 1013 4 1 8FJY HIS A 208 ? UNP P22102 ? ? 'expression tag' 1014 5 1 8FJY HIS A 209 ? UNP P22102 ? ? 'expression tag' 1015 6 1 8FJY HIS A 210 ? UNP P22102 ? ? 'expression tag' 1016 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GAR non-polymer . 'GLYCINAMIDE RIBONUCLEOTIDE' ? 'C7 H13 N2 O8 P -2' 284.160 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 Y6U non-polymer . 'N-{4-[3-(2-amino-4-oxo-3,4-dihydro-5H-pyrrolo[3,2-d]pyrimidin-5-yl)propyl]benzoyl}-L-glutamic acid' ? 'C21 H23 N5 O6' 441.437 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8FJY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.63 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.14 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris (pH 7.5), 0.333 mM NaCl, 20% polyethylene glycol (PEG) 4000, and 2% PEG 400' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CMOS _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RDI CMOS_8M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-03-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 4.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 4.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8FJY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.98 _reflns.d_resolution_low 39.9096 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7148 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.562 _reflns.pdbx_Rpim_I_all 0.174 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.977 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.534 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.98 _reflns_shell.d_res_low 3.16 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1129 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.859 _reflns_shell.pdbx_Rpim_I_all 0.905 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.407 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.710 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8FJY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.980 _refine.ls_d_res_low 39.9096 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7082 _refine.ls_number_reflns_R_free 368 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.38 _refine.ls_percent_reflns_R_free 5.20 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2082 _refine.ls_R_factor_R_free 0.2511 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2059 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.66 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.53 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.980 _refine_hist.d_res_low 39.9096 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 1554 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1489 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 50 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1564 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.930 ? 2129 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.954 ? 928 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.050 ? 256 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 271 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.9804 3.0869 . . 33 612 95 . . . . 0.3965 . . . . . . . . . . . 0.3541 'X-RAY DIFFRACTION' 3.0869 3.2105 . . 38 660 100.00 . . . . 0.3352 . . . . . . . . . . . 0.3460 'X-RAY DIFFRACTION' 3.2105 3.3565 . . 28 668 99 . . . . 0.2658 . . . . . . . . . . . 0.3544 'X-RAY DIFFRACTION' 3.3565 3.5334 . . 36 680 100 . . . . 0.2484 . . . . . . . . . . . 0.3386 'X-RAY DIFFRACTION' 3.5334 3.7546 . . 25 680 100 . . . . 0.2274 . . . . . . . . . . . 0.3071 'X-RAY DIFFRACTION' 3.7546 4.0442 . . 37 668 100 . . . . 0.2065 . . . . . . . . . . . 0.2496 'X-RAY DIFFRACTION' 4.0442 4.4507 . . 671 671 100 . . . . 0.1544 . . . . . . . . . . . 0.2200 'X-RAY DIFFRACTION' 4.4507 5.0936 . . 40 668 100 . . . . 0.1558 . . . . . . . . . . . 0.2081 'X-RAY DIFFRACTION' 5.0936 6.4131 . . 44 679 100 . . . . 0.1765 . . . . . . . . . . . 0.1906 'X-RAY DIFFRACTION' 6.4131 39.9096 . . 43 740 100 . . . . 0.1767 . . . . . . . . . . . 0.2290 # _struct.entry_id 8FJY _struct.title 'Human GAR transformylase in complex with GAR substrate and AGF291 inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8FJY _struct_keywords.text 'GARFTase, purine biosynthesis, monomer, inhibitor, LIGASE, LIGASE-INHIBITOR complex' _struct_keywords.pdbx_keywords LIGASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 12 ? ARG A 23 ? GLY A 818 ARG A 829 1 ? 12 HELX_P HELX_P2 AA2 VAL A 41 ? ALA A 50 ? VAL A 847 ALA A 856 1 ? 10 HELX_P HELX_P3 AA3 ASN A 58 ? TYR A 62 ? ASN A 864 TYR A 868 5 ? 5 HELX_P HELX_P4 AA4 ASN A 64 ? PHE A 79 ? ASN A 870 PHE A 885 1 ? 16 HELX_P HELX_P5 AA5 SER A 94 ? TRP A 101 ? SER A 900 TRP A 907 1 ? 8 HELX_P HELX_P6 AA6 ASN A 120 ? GLY A 129 ? ASN A 926 GLY A 935 1 ? 10 HELX_P HELX_P7 AA7 THR A 162 ? SER A 187 ? THR A 968 SER A 993 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 113 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 919 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 114 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 920 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 12.09 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 54 ? VAL A 56 ? THR A 860 VAL A 862 AA1 2 GLN A 30 ? SER A 36 ? GLN A 836 SER A 842 AA1 3 ARG A 3 ? ILE A 8 ? ARG A 809 ILE A 814 AA1 4 ILE A 83 ? LEU A 86 ? ILE A 889 LEU A 892 AA1 5 MET A 105 ? HIS A 109 ? MET A 911 HIS A 915 AA1 6 VAL A 132 ? PHE A 139 ? VAL A 938 PHE A 945 AA1 7 ILE A 149 ? PRO A 156 ? ILE A 955 PRO A 962 AA2 1 GLN A 191 ? LEU A 192 ? GLN A 997 LEU A 998 AA2 2 ILE A 198 ? CYS A 199 ? ILE A 1004 CYS A 1005 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 55 ? O ARG A 861 N SER A 36 ? N SER A 842 AA1 2 3 O GLN A 30 ? O GLN A 836 N VAL A 4 ? N VAL A 810 AA1 3 4 N LEU A 7 ? N LEU A 813 O CYS A 85 ? O CYS A 891 AA1 4 5 N LEU A 86 ? N LEU A 892 O LEU A 106 ? O LEU A 912 AA1 5 6 N HIS A 109 ? N HIS A 915 O THR A 136 ? O THR A 942 AA1 6 7 N THR A 133 ? N THR A 939 O VAL A 155 ? O VAL A 961 AA2 1 2 N GLN A 191 ? N GLN A 997 O CYS A 199 ? O CYS A 1005 # _atom_sites.entry_id 8FJY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013249 _atom_sites.fract_transf_matrix[1][2] 0.007649 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015299 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009923 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 807 ? ? ? A . n A 1 2 ALA 2 808 808 ALA ALA A . n A 1 3 ARG 3 809 809 ARG ARG A . n A 1 4 VAL 4 810 810 VAL VAL A . n A 1 5 ALA 5 811 811 ALA ALA A . n A 1 6 VAL 6 812 812 VAL VAL A . n A 1 7 LEU 7 813 813 LEU LEU A . n A 1 8 ILE 8 814 814 ILE ILE A . n A 1 9 SER 9 815 815 SER SER A . n A 1 10 GLY 10 816 816 GLY GLY A . n A 1 11 THR 11 817 817 THR THR A . n A 1 12 GLY 12 818 818 GLY GLY A . n A 1 13 SER 13 819 819 SER SER A . n A 1 14 ASN 14 820 820 ASN ASN A . n A 1 15 LEU 15 821 821 LEU LEU A . n A 1 16 GLN 16 822 822 GLN GLN A . n A 1 17 ALA 17 823 823 ALA ALA A . n A 1 18 LEU 18 824 824 LEU LEU A . n A 1 19 ILE 19 825 825 ILE ILE A . n A 1 20 ASP 20 826 826 ASP ASP A . n A 1 21 SER 21 827 827 SER SER A . n A 1 22 THR 22 828 828 THR THR A . n A 1 23 ARG 23 829 829 ARG ARG A . n A 1 24 GLU 24 830 830 GLU GLU A . n A 1 25 PRO 25 831 831 PRO PRO A . n A 1 26 ASN 26 832 832 ASN ASN A . n A 1 27 SER 27 833 833 SER SER A . n A 1 28 SER 28 834 834 SER SER A . n A 1 29 ALA 29 835 835 ALA ALA A . n A 1 30 GLN 30 836 836 GLN GLN A . n A 1 31 ILE 31 837 837 ILE ILE A . n A 1 32 ASP 32 838 838 ASP ASP A . n A 1 33 ILE 33 839 839 ILE ILE A . n A 1 34 VAL 34 840 840 VAL VAL A . n A 1 35 ILE 35 841 841 ILE ILE A . n A 1 36 SER 36 842 842 SER SER A . n A 1 37 ASN 37 843 843 ASN ASN A . n A 1 38 LYS 38 844 844 LYS LYS A . n A 1 39 ALA 39 845 845 ALA ALA A . n A 1 40 ALA 40 846 846 ALA ALA A . n A 1 41 VAL 41 847 847 VAL VAL A . n A 1 42 ALA 42 848 848 ALA ALA A . n A 1 43 GLY 43 849 849 GLY GLY A . n A 1 44 LEU 44 850 850 LEU LEU A . n A 1 45 ASP 45 851 851 ASP ASP A . n A 1 46 LYS 46 852 852 LYS LYS A . n A 1 47 ALA 47 853 853 ALA ALA A . n A 1 48 GLU 48 854 854 GLU GLU A . n A 1 49 ARG 49 855 855 ARG ARG A . n A 1 50 ALA 50 856 856 ALA ALA A . n A 1 51 GLY 51 857 857 GLY GLY A . n A 1 52 ILE 52 858 858 ILE ILE A . n A 1 53 PRO 53 859 859 PRO PRO A . n A 1 54 THR 54 860 860 THR THR A . n A 1 55 ARG 55 861 861 ARG ARG A . n A 1 56 VAL 56 862 862 VAL VAL A . n A 1 57 ILE 57 863 863 ILE ILE A . n A 1 58 ASN 58 864 864 ASN ASN A . n A 1 59 HIS 59 865 865 HIS HIS A . n A 1 60 LYS 60 866 866 LYS LYS A . n A 1 61 LEU 61 867 867 LEU LEU A . n A 1 62 TYR 62 868 868 TYR TYR A . n A 1 63 LYS 63 869 869 LYS LYS A . n A 1 64 ASN 64 870 870 ASN ASN A . n A 1 65 ARG 65 871 871 ARG ARG A . n A 1 66 VAL 66 872 872 VAL VAL A . n A 1 67 GLU 67 873 873 GLU GLU A . n A 1 68 PHE 68 874 874 PHE PHE A . n A 1 69 ASP 69 875 875 ASP ASP A . n A 1 70 SER 70 876 876 SER SER A . n A 1 71 ALA 71 877 877 ALA ALA A . n A 1 72 ILE 72 878 878 ILE ILE A . n A 1 73 ASP 73 879 879 ASP ASP A . n A 1 74 LEU 74 880 880 LEU LEU A . n A 1 75 VAL 75 881 881 VAL VAL A . n A 1 76 LEU 76 882 882 LEU LEU A . n A 1 77 GLU 77 883 883 GLU GLU A . n A 1 78 GLU 78 884 884 GLU GLU A . n A 1 79 PHE 79 885 885 PHE PHE A . n A 1 80 SER 80 886 886 SER SER A . n A 1 81 ILE 81 887 887 ILE ILE A . n A 1 82 ASP 82 888 888 ASP ASP A . n A 1 83 ILE 83 889 889 ILE ILE A . n A 1 84 VAL 84 890 890 VAL VAL A . n A 1 85 CYS 85 891 891 CYS CYS A . n A 1 86 LEU 86 892 892 LEU LEU A . n A 1 87 ALA 87 893 893 ALA ALA A . n A 1 88 GLY 88 894 894 GLY GLY A . n A 1 89 PHE 89 895 895 PHE PHE A . n A 1 90 MET 90 896 896 MET MET A . n A 1 91 ARG 91 897 897 ARG ARG A . n A 1 92 ILE 92 898 898 ILE ILE A . n A 1 93 LEU 93 899 899 LEU LEU A . n A 1 94 SER 94 900 900 SER SER A . n A 1 95 GLY 95 901 901 GLY GLY A . n A 1 96 PRO 96 902 902 PRO PRO A . n A 1 97 PHE 97 903 903 PHE PHE A . n A 1 98 VAL 98 904 904 VAL VAL A . n A 1 99 GLN 99 905 905 GLN ALA A . n A 1 100 LYS 100 906 906 LYS LYS A . n A 1 101 TRP 101 907 907 TRP TRP A . n A 1 102 ASN 102 908 908 ASN ASN A . n A 1 103 GLY 103 909 909 GLY GLY A . n A 1 104 LYS 104 910 910 LYS LYS A . n A 1 105 MET 105 911 911 MET MET A . n A 1 106 LEU 106 912 912 LEU LEU A . n A 1 107 ASN 107 913 913 ASN ASN A . n A 1 108 ILE 108 914 914 ILE ILE A . n A 1 109 HIS 109 915 915 HIS HIS A . n A 1 110 PRO 110 916 916 PRO PRO A . n A 1 111 SER 111 917 917 SER SER A . n A 1 112 LEU 112 918 918 LEU LEU A . n A 1 113 LEU 113 919 919 LEU LEU A . n A 1 114 PRO 114 920 920 PRO PRO A . n A 1 115 SER 115 921 921 SER SER A . n A 1 116 PHE 116 922 922 PHE PHE A . n A 1 117 LYS 117 923 923 LYS LYS A . n A 1 118 GLY 118 924 924 GLY GLY A . n A 1 119 SER 119 925 925 SER SER A . n A 1 120 ASN 120 926 926 ASN ASN A . n A 1 121 ALA 121 927 927 ALA ALA A . n A 1 122 HIS 122 928 928 HIS HIS A . n A 1 123 GLU 123 929 929 GLU GLU A . n A 1 124 GLN 124 930 930 GLN GLN A . n A 1 125 ALA 125 931 931 ALA ALA A . n A 1 126 LEU 126 932 932 LEU LEU A . n A 1 127 GLU 127 933 933 GLU GLU A . n A 1 128 THR 128 934 934 THR THR A . n A 1 129 GLY 129 935 935 GLY GLY A . n A 1 130 VAL 130 936 936 VAL VAL A . n A 1 131 THR 131 937 937 THR THR A . n A 1 132 VAL 132 938 938 VAL VAL A . n A 1 133 THR 133 939 939 THR THR A . n A 1 134 GLY 134 940 940 GLY GLY A . n A 1 135 CYS 135 941 941 CYS CYS A . n A 1 136 THR 136 942 942 THR THR A . n A 1 137 VAL 137 943 943 VAL VAL A . n A 1 138 HIS 138 944 944 HIS HIS A . n A 1 139 PHE 139 945 945 PHE PHE A . n A 1 140 VAL 140 946 946 VAL VAL A . n A 1 141 ALA 141 947 947 ALA ALA A . n A 1 142 GLU 142 948 948 GLU GLU A . n A 1 143 ASP 143 949 949 ASP ASP A . n A 1 144 VAL 144 950 950 VAL VAL A . n A 1 145 ASP 145 951 951 ASP ASP A . n A 1 146 ALA 146 952 952 ALA ALA A . n A 1 147 GLY 147 953 953 GLY GLY A . n A 1 148 GLN 148 954 954 GLN GLN A . n A 1 149 ILE 149 955 955 ILE ILE A . n A 1 150 ILE 150 956 956 ILE ILE A . n A 1 151 LEU 151 957 957 LEU LEU A . n A 1 152 GLN 152 958 958 GLN GLN A . n A 1 153 GLU 153 959 959 GLU GLU A . n A 1 154 ALA 154 960 960 ALA ALA A . n A 1 155 VAL 155 961 961 VAL VAL A . n A 1 156 PRO 156 962 962 PRO PRO A . n A 1 157 VAL 157 963 963 VAL VAL A . n A 1 158 LYS 158 964 964 LYS LYS A . n A 1 159 ARG 159 965 965 ARG ARG A . n A 1 160 GLY 160 966 966 GLY GLY A . n A 1 161 ASP 161 967 967 ASP ASP A . n A 1 162 THR 162 968 968 THR THR A . n A 1 163 VAL 163 969 969 VAL VAL A . n A 1 164 ALA 164 970 970 ALA ALA A . n A 1 165 THR 165 971 971 THR THR A . n A 1 166 LEU 166 972 972 LEU LEU A . n A 1 167 SER 167 973 973 SER SER A . n A 1 168 GLU 168 974 974 GLU GLU A . n A 1 169 ARG 169 975 975 ARG ARG A . n A 1 170 VAL 170 976 976 VAL VAL A . n A 1 171 LYS 171 977 977 LYS LYS A . n A 1 172 LEU 172 978 978 LEU LEU A . n A 1 173 ALA 173 979 979 ALA ALA A . n A 1 174 GLU 174 980 980 GLU GLU A . n A 1 175 HIS 175 981 981 HIS HIS A . n A 1 176 LYS 176 982 982 LYS LYS A . n A 1 177 ILE 177 983 983 ILE ILE A . n A 1 178 PHE 178 984 984 PHE PHE A . n A 1 179 PRO 179 985 985 PRO PRO A . n A 1 180 ALA 180 986 986 ALA ALA A . n A 1 181 ALA 181 987 987 ALA ALA A . n A 1 182 LEU 182 988 988 LEU LEU A . n A 1 183 GLN 183 989 989 GLN GLN A . n A 1 184 LEU 184 990 990 LEU LEU A . n A 1 185 VAL 185 991 991 VAL VAL A . n A 1 186 ALA 186 992 992 ALA ALA A . n A 1 187 SER 187 993 993 SER SER A . n A 1 188 GLY 188 994 994 GLY GLY A . n A 1 189 THR 189 995 995 THR THR A . n A 1 190 VAL 190 996 996 VAL VAL A . n A 1 191 GLN 191 997 997 GLN GLN A . n A 1 192 LEU 192 998 998 LEU LEU A . n A 1 193 GLY 193 999 999 GLY GLY A . n A 1 194 GLU 194 1000 1000 GLU GLU A . n A 1 195 ASN 195 1001 1001 ASN ASN A . n A 1 196 GLY 196 1002 1002 GLY GLY A . n A 1 197 LYS 197 1003 1003 LYS LYS A . n A 1 198 ILE 198 1004 1004 ILE ILE A . n A 1 199 CYS 199 1005 1005 CYS CYS A . n A 1 200 TRP 200 1006 1006 TRP TRP A . n A 1 201 VAL 201 1007 1007 VAL VAL A . n A 1 202 LYS 202 1008 ? ? ? A . n A 1 203 GLU 203 1009 ? ? ? A . n A 1 204 GLU 204 1010 ? ? ? A . n A 1 205 HIS 205 1011 ? ? ? A . n A 1 206 HIS 206 1012 ? ? ? A . n A 1 207 HIS 207 1013 ? ? ? A . n A 1 208 HIS 208 1014 ? ? ? A . n A 1 209 HIS 209 1015 ? ? ? A . n A 1 210 HIS 210 1016 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email cedann@indiana.edu _pdbx_contact_author.name_first Charles _pdbx_contact_author.name_last 'Dann III' _pdbx_contact_author.name_mi E. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0117-9474 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GAR 1 1101 1101 GAR GAR A . C 3 Y6U 1 1102 1201 Y6U G29 A . D 4 HOH 1 1201 15 HOH HOH A . D 4 HOH 2 1202 11 HOH HOH A . D 4 HOH 3 1203 7 HOH HOH A . D 4 HOH 4 1204 8 HOH HOH A . D 4 HOH 5 1205 6 HOH HOH A . D 4 HOH 6 1206 9 HOH HOH A . D 4 HOH 7 1207 5 HOH HOH A . D 4 HOH 8 1208 2 HOH HOH A . D 4 HOH 9 1209 1 HOH HOH A . D 4 HOH 10 1210 13 HOH HOH A . D 4 HOH 11 1211 3 HOH HOH A . D 4 HOH 12 1212 10 HOH HOH A . D 4 HOH 13 1213 4 HOH HOH A . D 4 HOH 14 1214 14 HOH HOH A . D 4 HOH 15 1215 12 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-09-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13-2998 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 8FJY _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 819 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O18 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GAR _pdbx_validate_close_contact.auth_seq_id_2 1101 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.12 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OG _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 SER _pdbx_validate_symm_contact.auth_seq_id_1 921 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OG _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 SER _pdbx_validate_symm_contact.auth_seq_id_2 921 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 6_555 _pdbx_validate_symm_contact.dist 2.04 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 815 ? ? -152.27 -14.62 2 1 LYS A 923 ? ? -65.56 -179.49 3 1 THR A 939 ? ? -121.05 -166.59 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 844 ? CG ? A LYS 38 CG 2 1 Y 1 A LYS 844 ? CD ? A LYS 38 CD 3 1 Y 1 A LYS 844 ? CE ? A LYS 38 CE 4 1 Y 1 A LYS 844 ? NZ ? A LYS 38 NZ 5 1 Y 1 A GLN 905 ? CG ? A GLN 99 CG 6 1 Y 1 A GLN 905 ? CD ? A GLN 99 CD 7 1 Y 1 A GLN 905 ? OE1 ? A GLN 99 OE1 8 1 Y 1 A GLN 905 ? NE2 ? A GLN 99 NE2 9 1 Y 1 A ARG 965 ? CG ? A ARG 159 CG 10 1 Y 1 A ARG 965 ? CD ? A ARG 159 CD 11 1 Y 1 A ARG 965 ? NE ? A ARG 159 NE 12 1 Y 1 A ARG 965 ? CZ ? A ARG 159 CZ 13 1 Y 1 A ARG 965 ? NH1 ? A ARG 159 NH1 14 1 Y 1 A ARG 965 ? NH2 ? A ARG 159 NH2 15 1 Y 1 A LYS 1003 ? CG ? A LYS 197 CG 16 1 Y 1 A LYS 1003 ? CD ? A LYS 197 CD 17 1 Y 1 A LYS 1003 ? CE ? A LYS 197 CE 18 1 Y 1 A LYS 1003 ? NZ ? A LYS 197 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 807 ? A MET 1 2 1 Y 1 A LYS 1008 ? A LYS 202 3 1 Y 1 A GLU 1009 ? A GLU 203 4 1 Y 1 A GLU 1010 ? A GLU 204 5 1 Y 1 A HIS 1011 ? A HIS 205 6 1 Y 1 A HIS 1012 ? A HIS 206 7 1 Y 1 A HIS 1013 ? A HIS 207 8 1 Y 1 A HIS 1014 ? A HIS 208 9 1 Y 1 A HIS 1015 ? A HIS 209 10 1 Y 1 A HIS 1016 ? A HIS 210 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GAR C1 C N S 88 GAR O6 O N N 89 GAR C2 C N R 90 GAR O8 O N N 91 GAR C3 C N R 92 GAR O4 O N N 93 GAR C5 C N R 94 GAR C10 C N N 95 GAR O12 O N N 96 GAR N19 N N N 97 GAR C21 C N N 98 GAR O22 O N N 99 GAR C23 C N N 100 GAR N24 N N N 101 GAR P15 P N N 102 GAR O16 O N N 103 GAR O17 O N N 104 GAR O18 O N N 105 GAR H1 H N N 106 GAR HO6 H N N 107 GAR H2 H N N 108 GAR HO8 H N N 109 GAR H3 H N N 110 GAR H5 H N N 111 GAR H101 H N N 112 GAR H102 H N N 113 GAR H19 H N N 114 GAR H231 H N N 115 GAR H232 H N N 116 GAR H241 H N N 117 GAR H242 H N N 118 GLN N N N N 119 GLN CA C N S 120 GLN C C N N 121 GLN O O N N 122 GLN CB C N N 123 GLN CG C N N 124 GLN CD C N N 125 GLN OE1 O N N 126 GLN NE2 N N N 127 GLN OXT O N N 128 GLN H H N N 129 GLN H2 H N N 130 GLN HA H N N 131 GLN HB2 H N N 132 GLN HB3 H N N 133 GLN HG2 H N N 134 GLN HG3 H N N 135 GLN HE21 H N N 136 GLN HE22 H N N 137 GLN HXT H N N 138 GLU N N N N 139 GLU CA C N S 140 GLU C C N N 141 GLU O O N N 142 GLU CB C N N 143 GLU CG C N N 144 GLU CD C N N 145 GLU OE1 O N N 146 GLU OE2 O N N 147 GLU OXT O N N 148 GLU H H N N 149 GLU H2 H N N 150 GLU HA H N N 151 GLU HB2 H N N 152 GLU HB3 H N N 153 GLU HG2 H N N 154 GLU HG3 H N N 155 GLU HE2 H N N 156 GLU HXT H N N 157 GLY N N N N 158 GLY CA C N N 159 GLY C C N N 160 GLY O O N N 161 GLY OXT O N N 162 GLY H H N N 163 GLY H2 H N N 164 GLY HA2 H N N 165 GLY HA3 H N N 166 GLY HXT H N N 167 HIS N N N N 168 HIS CA C N S 169 HIS C C N N 170 HIS O O N N 171 HIS CB C N N 172 HIS CG C Y N 173 HIS ND1 N Y N 174 HIS CD2 C Y N 175 HIS CE1 C Y N 176 HIS NE2 N Y N 177 HIS OXT O N N 178 HIS H H N N 179 HIS H2 H N N 180 HIS HA H N N 181 HIS HB2 H N N 182 HIS HB3 H N N 183 HIS HD1 H N N 184 HIS HD2 H N N 185 HIS HE1 H N N 186 HIS HE2 H N N 187 HIS HXT H N N 188 HOH O O N N 189 HOH H1 H N N 190 HOH H2 H N N 191 ILE N N N N 192 ILE CA C N S 193 ILE C C N N 194 ILE O O N N 195 ILE CB C N S 196 ILE CG1 C N N 197 ILE CG2 C N N 198 ILE CD1 C N N 199 ILE OXT O N N 200 ILE H H N N 201 ILE H2 H N N 202 ILE HA H N N 203 ILE HB H N N 204 ILE HG12 H N N 205 ILE HG13 H N N 206 ILE HG21 H N N 207 ILE HG22 H N N 208 ILE HG23 H N N 209 ILE HD11 H N N 210 ILE HD12 H N N 211 ILE HD13 H N N 212 ILE HXT H N N 213 LEU N N N N 214 LEU CA C N S 215 LEU C C N N 216 LEU O O N N 217 LEU CB C N N 218 LEU CG C N N 219 LEU CD1 C N N 220 LEU CD2 C N N 221 LEU OXT O N N 222 LEU H H N N 223 LEU H2 H N N 224 LEU HA H N N 225 LEU HB2 H N N 226 LEU HB3 H N N 227 LEU HG H N N 228 LEU HD11 H N N 229 LEU HD12 H N N 230 LEU HD13 H N N 231 LEU HD21 H N N 232 LEU HD22 H N N 233 LEU HD23 H N N 234 LEU HXT H N N 235 LYS N N N N 236 LYS CA C N S 237 LYS C C N N 238 LYS O O N N 239 LYS CB C N N 240 LYS CG C N N 241 LYS CD C N N 242 LYS CE C N N 243 LYS NZ N N N 244 LYS OXT O N N 245 LYS H H N N 246 LYS H2 H N N 247 LYS HA H N N 248 LYS HB2 H N N 249 LYS HB3 H N N 250 LYS HG2 H N N 251 LYS HG3 H N N 252 LYS HD2 H N N 253 LYS HD3 H N N 254 LYS HE2 H N N 255 LYS HE3 H N N 256 LYS HZ1 H N N 257 LYS HZ2 H N N 258 LYS HZ3 H N N 259 LYS HXT H N N 260 MET N N N N 261 MET CA C N S 262 MET C C N N 263 MET O O N N 264 MET CB C N N 265 MET CG C N N 266 MET SD S N N 267 MET CE C N N 268 MET OXT O N N 269 MET H H N N 270 MET H2 H N N 271 MET HA H N N 272 MET HB2 H N N 273 MET HB3 H N N 274 MET HG2 H N N 275 MET HG3 H N N 276 MET HE1 H N N 277 MET HE2 H N N 278 MET HE3 H N N 279 MET HXT H N N 280 PHE N N N N 281 PHE CA C N S 282 PHE C C N N 283 PHE O O N N 284 PHE CB C N N 285 PHE CG C Y N 286 PHE CD1 C Y N 287 PHE CD2 C Y N 288 PHE CE1 C Y N 289 PHE CE2 C Y N 290 PHE CZ C Y N 291 PHE OXT O N N 292 PHE H H N N 293 PHE H2 H N N 294 PHE HA H N N 295 PHE HB2 H N N 296 PHE HB3 H N N 297 PHE HD1 H N N 298 PHE HD2 H N N 299 PHE HE1 H N N 300 PHE HE2 H N N 301 PHE HZ H N N 302 PHE HXT H N N 303 PRO N N N N 304 PRO CA C N S 305 PRO C C N N 306 PRO O O N N 307 PRO CB C N N 308 PRO CG C N N 309 PRO CD C N N 310 PRO OXT O N N 311 PRO H H N N 312 PRO HA H N N 313 PRO HB2 H N N 314 PRO HB3 H N N 315 PRO HG2 H N N 316 PRO HG3 H N N 317 PRO HD2 H N N 318 PRO HD3 H N N 319 PRO HXT H N N 320 SER N N N N 321 SER CA C N S 322 SER C C N N 323 SER O O N N 324 SER CB C N N 325 SER OG O N N 326 SER OXT O N N 327 SER H H N N 328 SER H2 H N N 329 SER HA H N N 330 SER HB2 H N N 331 SER HB3 H N N 332 SER HG H N N 333 SER HXT H N N 334 THR N N N N 335 THR CA C N S 336 THR C C N N 337 THR O O N N 338 THR CB C N R 339 THR OG1 O N N 340 THR CG2 C N N 341 THR OXT O N N 342 THR H H N N 343 THR H2 H N N 344 THR HA H N N 345 THR HB H N N 346 THR HG1 H N N 347 THR HG21 H N N 348 THR HG22 H N N 349 THR HG23 H N N 350 THR HXT H N N 351 TRP N N N N 352 TRP CA C N S 353 TRP C C N N 354 TRP O O N N 355 TRP CB C N N 356 TRP CG C Y N 357 TRP CD1 C Y N 358 TRP CD2 C Y N 359 TRP NE1 N Y N 360 TRP CE2 C Y N 361 TRP CE3 C Y N 362 TRP CZ2 C Y N 363 TRP CZ3 C Y N 364 TRP CH2 C Y N 365 TRP OXT O N N 366 TRP H H N N 367 TRP H2 H N N 368 TRP HA H N N 369 TRP HB2 H N N 370 TRP HB3 H N N 371 TRP HD1 H N N 372 TRP HE1 H N N 373 TRP HE3 H N N 374 TRP HZ2 H N N 375 TRP HZ3 H N N 376 TRP HH2 H N N 377 TRP HXT H N N 378 TYR N N N N 379 TYR CA C N S 380 TYR C C N N 381 TYR O O N N 382 TYR CB C N N 383 TYR CG C Y N 384 TYR CD1 C Y N 385 TYR CD2 C Y N 386 TYR CE1 C Y N 387 TYR CE2 C Y N 388 TYR CZ C Y N 389 TYR OH O N N 390 TYR OXT O N N 391 TYR H H N N 392 TYR H2 H N N 393 TYR HA H N N 394 TYR HB2 H N N 395 TYR HB3 H N N 396 TYR HD1 H N N 397 TYR HD2 H N N 398 TYR HE1 H N N 399 TYR HE2 H N N 400 TYR HH H N N 401 TYR HXT H N N 402 VAL N N N N 403 VAL CA C N S 404 VAL C C N N 405 VAL O O N N 406 VAL CB C N N 407 VAL CG1 C N N 408 VAL CG2 C N N 409 VAL OXT O N N 410 VAL H H N N 411 VAL H2 H N N 412 VAL HA H N N 413 VAL HB H N N 414 VAL HG11 H N N 415 VAL HG12 H N N 416 VAL HG13 H N N 417 VAL HG21 H N N 418 VAL HG22 H N N 419 VAL HG23 H N N 420 VAL HXT H N N 421 Y6U C2 C N N 422 Y6U C9 C Y N 423 Y6U C12 C Y N 424 Y6U C4 C N N 425 Y6U C5 C Y N 426 Y6U C6 C Y N 427 Y6U C23 C N N 428 Y6U C26 C N N 429 Y6U C8 C Y N 430 Y6U C14 C Y N 431 Y6U C13 C Y N 432 Y6U C15 C Y N 433 Y6U C16 C Y N 434 Y6U C17 C N N 435 Y6U C20 C N S 436 Y6U C21 C N N 437 Y6U C22 C N N 438 Y6U C29 C N N 439 Y6U C30 C N N 440 Y6U C31 C N N 441 Y6U C32 C Y N 442 Y6U N1 N N N 443 Y6U N11 N N N 444 Y6U N19 N N N 445 Y6U N3 N N N 446 Y6U N7 N Y N 447 Y6U O10 O N N 448 Y6U O18 O N N 449 Y6U O24 O N N 450 Y6U O25 O N N 451 Y6U O27 O N N 452 Y6U O28 O N N 453 Y6U H1 H N N 454 Y6U H2 H N N 455 Y6U H3 H N N 456 Y6U H4 H N N 457 Y6U H5 H N N 458 Y6U H6 H N N 459 Y6U H7 H N N 460 Y6U H8 H N N 461 Y6U H9 H N N 462 Y6U H10 H N N 463 Y6U H11 H N N 464 Y6U H12 H N N 465 Y6U H13 H N N 466 Y6U H14 H N N 467 Y6U H15 H N N 468 Y6U H16 H N N 469 Y6U H17 H N N 470 Y6U H18 H N N 471 Y6U H19 H N N 472 Y6U H20 H N N 473 Y6U H21 H N N 474 Y6U H22 H N N 475 Y6U H23 H N N 476 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GAR C1 O6 sing N N 83 GAR C1 C2 sing N N 84 GAR C1 C5 sing N N 85 GAR C1 H1 sing N N 86 GAR O6 HO6 sing N N 87 GAR C2 O8 sing N N 88 GAR C2 C3 sing N N 89 GAR C2 H2 sing N N 90 GAR O8 HO8 sing N N 91 GAR C3 O4 sing N N 92 GAR C3 N19 sing N N 93 GAR C3 H3 sing N N 94 GAR O4 C5 sing N N 95 GAR C5 C10 sing N N 96 GAR C5 H5 sing N N 97 GAR C10 O12 sing N N 98 GAR C10 H101 sing N N 99 GAR C10 H102 sing N N 100 GAR O12 P15 sing N N 101 GAR N19 C21 sing N N 102 GAR N19 H19 sing N N 103 GAR C21 O22 doub N N 104 GAR C21 C23 sing N N 105 GAR C23 N24 sing N N 106 GAR C23 H231 sing N N 107 GAR C23 H232 sing N N 108 GAR N24 H241 sing N N 109 GAR N24 H242 sing N N 110 GAR P15 O16 doub N N 111 GAR P15 O17 sing N N 112 GAR P15 O18 sing N N 113 GLN N CA sing N N 114 GLN N H sing N N 115 GLN N H2 sing N N 116 GLN CA C sing N N 117 GLN CA CB sing N N 118 GLN CA HA sing N N 119 GLN C O doub N N 120 GLN C OXT sing N N 121 GLN CB CG sing N N 122 GLN CB HB2 sing N N 123 GLN CB HB3 sing N N 124 GLN CG CD sing N N 125 GLN CG HG2 sing N N 126 GLN CG HG3 sing N N 127 GLN CD OE1 doub N N 128 GLN CD NE2 sing N N 129 GLN NE2 HE21 sing N N 130 GLN NE2 HE22 sing N N 131 GLN OXT HXT sing N N 132 GLU N CA sing N N 133 GLU N H sing N N 134 GLU N H2 sing N N 135 GLU CA C sing N N 136 GLU CA CB sing N N 137 GLU CA HA sing N N 138 GLU C O doub N N 139 GLU C OXT sing N N 140 GLU CB CG sing N N 141 GLU CB HB2 sing N N 142 GLU CB HB3 sing N N 143 GLU CG CD sing N N 144 GLU CG HG2 sing N N 145 GLU CG HG3 sing N N 146 GLU CD OE1 doub N N 147 GLU CD OE2 sing N N 148 GLU OE2 HE2 sing N N 149 GLU OXT HXT sing N N 150 GLY N CA sing N N 151 GLY N H sing N N 152 GLY N H2 sing N N 153 GLY CA C sing N N 154 GLY CA HA2 sing N N 155 GLY CA HA3 sing N N 156 GLY C O doub N N 157 GLY C OXT sing N N 158 GLY OXT HXT sing N N 159 HIS N CA sing N N 160 HIS N H sing N N 161 HIS N H2 sing N N 162 HIS CA C sing N N 163 HIS CA CB sing N N 164 HIS CA HA sing N N 165 HIS C O doub N N 166 HIS C OXT sing N N 167 HIS CB CG sing N N 168 HIS CB HB2 sing N N 169 HIS CB HB3 sing N N 170 HIS CG ND1 sing Y N 171 HIS CG CD2 doub Y N 172 HIS ND1 CE1 doub Y N 173 HIS ND1 HD1 sing N N 174 HIS CD2 NE2 sing Y N 175 HIS CD2 HD2 sing N N 176 HIS CE1 NE2 sing Y N 177 HIS CE1 HE1 sing N N 178 HIS NE2 HE2 sing N N 179 HIS OXT HXT sing N N 180 HOH O H1 sing N N 181 HOH O H2 sing N N 182 ILE N CA sing N N 183 ILE N H sing N N 184 ILE N H2 sing N N 185 ILE CA C sing N N 186 ILE CA CB sing N N 187 ILE CA HA sing N N 188 ILE C O doub N N 189 ILE C OXT sing N N 190 ILE CB CG1 sing N N 191 ILE CB CG2 sing N N 192 ILE CB HB sing N N 193 ILE CG1 CD1 sing N N 194 ILE CG1 HG12 sing N N 195 ILE CG1 HG13 sing N N 196 ILE CG2 HG21 sing N N 197 ILE CG2 HG22 sing N N 198 ILE CG2 HG23 sing N N 199 ILE CD1 HD11 sing N N 200 ILE CD1 HD12 sing N N 201 ILE CD1 HD13 sing N N 202 ILE OXT HXT sing N N 203 LEU N CA sing N N 204 LEU N H sing N N 205 LEU N H2 sing N N 206 LEU CA C sing N N 207 LEU CA CB sing N N 208 LEU CA HA sing N N 209 LEU C O doub N N 210 LEU C OXT sing N N 211 LEU CB CG sing N N 212 LEU CB HB2 sing N N 213 LEU CB HB3 sing N N 214 LEU CG CD1 sing N N 215 LEU CG CD2 sing N N 216 LEU CG HG sing N N 217 LEU CD1 HD11 sing N N 218 LEU CD1 HD12 sing N N 219 LEU CD1 HD13 sing N N 220 LEU CD2 HD21 sing N N 221 LEU CD2 HD22 sing N N 222 LEU CD2 HD23 sing N N 223 LEU OXT HXT sing N N 224 LYS N CA sing N N 225 LYS N H sing N N 226 LYS N H2 sing N N 227 LYS CA C sing N N 228 LYS CA CB sing N N 229 LYS CA HA sing N N 230 LYS C O doub N N 231 LYS C OXT sing N N 232 LYS CB CG sing N N 233 LYS CB HB2 sing N N 234 LYS CB HB3 sing N N 235 LYS CG CD sing N N 236 LYS CG HG2 sing N N 237 LYS CG HG3 sing N N 238 LYS CD CE sing N N 239 LYS CD HD2 sing N N 240 LYS CD HD3 sing N N 241 LYS CE NZ sing N N 242 LYS CE HE2 sing N N 243 LYS CE HE3 sing N N 244 LYS NZ HZ1 sing N N 245 LYS NZ HZ2 sing N N 246 LYS NZ HZ3 sing N N 247 LYS OXT HXT sing N N 248 MET N CA sing N N 249 MET N H sing N N 250 MET N H2 sing N N 251 MET CA C sing N N 252 MET CA CB sing N N 253 MET CA HA sing N N 254 MET C O doub N N 255 MET C OXT sing N N 256 MET CB CG sing N N 257 MET CB HB2 sing N N 258 MET CB HB3 sing N N 259 MET CG SD sing N N 260 MET CG HG2 sing N N 261 MET CG HG3 sing N N 262 MET SD CE sing N N 263 MET CE HE1 sing N N 264 MET CE HE2 sing N N 265 MET CE HE3 sing N N 266 MET OXT HXT sing N N 267 PHE N CA sing N N 268 PHE N H sing N N 269 PHE N H2 sing N N 270 PHE CA C sing N N 271 PHE CA CB sing N N 272 PHE CA HA sing N N 273 PHE C O doub N N 274 PHE C OXT sing N N 275 PHE CB CG sing N N 276 PHE CB HB2 sing N N 277 PHE CB HB3 sing N N 278 PHE CG CD1 doub Y N 279 PHE CG CD2 sing Y N 280 PHE CD1 CE1 sing Y N 281 PHE CD1 HD1 sing N N 282 PHE CD2 CE2 doub Y N 283 PHE CD2 HD2 sing N N 284 PHE CE1 CZ doub Y N 285 PHE CE1 HE1 sing N N 286 PHE CE2 CZ sing Y N 287 PHE CE2 HE2 sing N N 288 PHE CZ HZ sing N N 289 PHE OXT HXT sing N N 290 PRO N CA sing N N 291 PRO N CD sing N N 292 PRO N H sing N N 293 PRO CA C sing N N 294 PRO CA CB sing N N 295 PRO CA HA sing N N 296 PRO C O doub N N 297 PRO C OXT sing N N 298 PRO CB CG sing N N 299 PRO CB HB2 sing N N 300 PRO CB HB3 sing N N 301 PRO CG CD sing N N 302 PRO CG HG2 sing N N 303 PRO CG HG3 sing N N 304 PRO CD HD2 sing N N 305 PRO CD HD3 sing N N 306 PRO OXT HXT sing N N 307 SER N CA sing N N 308 SER N H sing N N 309 SER N H2 sing N N 310 SER CA C sing N N 311 SER CA CB sing N N 312 SER CA HA sing N N 313 SER C O doub N N 314 SER C OXT sing N N 315 SER CB OG sing N N 316 SER CB HB2 sing N N 317 SER CB HB3 sing N N 318 SER OG HG sing N N 319 SER OXT HXT sing N N 320 THR N CA sing N N 321 THR N H sing N N 322 THR N H2 sing N N 323 THR CA C sing N N 324 THR CA CB sing N N 325 THR CA HA sing N N 326 THR C O doub N N 327 THR C OXT sing N N 328 THR CB OG1 sing N N 329 THR CB CG2 sing N N 330 THR CB HB sing N N 331 THR OG1 HG1 sing N N 332 THR CG2 HG21 sing N N 333 THR CG2 HG22 sing N N 334 THR CG2 HG23 sing N N 335 THR OXT HXT sing N N 336 TRP N CA sing N N 337 TRP N H sing N N 338 TRP N H2 sing N N 339 TRP CA C sing N N 340 TRP CA CB sing N N 341 TRP CA HA sing N N 342 TRP C O doub N N 343 TRP C OXT sing N N 344 TRP CB CG sing N N 345 TRP CB HB2 sing N N 346 TRP CB HB3 sing N N 347 TRP CG CD1 doub Y N 348 TRP CG CD2 sing Y N 349 TRP CD1 NE1 sing Y N 350 TRP CD1 HD1 sing N N 351 TRP CD2 CE2 doub Y N 352 TRP CD2 CE3 sing Y N 353 TRP NE1 CE2 sing Y N 354 TRP NE1 HE1 sing N N 355 TRP CE2 CZ2 sing Y N 356 TRP CE3 CZ3 doub Y N 357 TRP CE3 HE3 sing N N 358 TRP CZ2 CH2 doub Y N 359 TRP CZ2 HZ2 sing N N 360 TRP CZ3 CH2 sing Y N 361 TRP CZ3 HZ3 sing N N 362 TRP CH2 HH2 sing N N 363 TRP OXT HXT sing N N 364 TYR N CA sing N N 365 TYR N H sing N N 366 TYR N H2 sing N N 367 TYR CA C sing N N 368 TYR CA CB sing N N 369 TYR CA HA sing N N 370 TYR C O doub N N 371 TYR C OXT sing N N 372 TYR CB CG sing N N 373 TYR CB HB2 sing N N 374 TYR CB HB3 sing N N 375 TYR CG CD1 doub Y N 376 TYR CG CD2 sing Y N 377 TYR CD1 CE1 sing Y N 378 TYR CD1 HD1 sing N N 379 TYR CD2 CE2 doub Y N 380 TYR CD2 HD2 sing N N 381 TYR CE1 CZ doub Y N 382 TYR CE1 HE1 sing N N 383 TYR CE2 CZ sing Y N 384 TYR CE2 HE2 sing N N 385 TYR CZ OH sing N N 386 TYR OH HH sing N N 387 TYR OXT HXT sing N N 388 VAL N CA sing N N 389 VAL N H sing N N 390 VAL N H2 sing N N 391 VAL CA C sing N N 392 VAL CA CB sing N N 393 VAL CA HA sing N N 394 VAL C O doub N N 395 VAL C OXT sing N N 396 VAL CB CG1 sing N N 397 VAL CB CG2 sing N N 398 VAL CB HB sing N N 399 VAL CG1 HG11 sing N N 400 VAL CG1 HG12 sing N N 401 VAL CG1 HG13 sing N N 402 VAL CG2 HG21 sing N N 403 VAL CG2 HG22 sing N N 404 VAL CG2 HG23 sing N N 405 VAL OXT HXT sing N N 406 Y6U N11 C2 sing N N 407 Y6U N3 C2 sing N N 408 Y6U N3 C4 sing N N 409 Y6U C2 N1 doub N N 410 Y6U O10 C4 doub N N 411 Y6U C4 C8 sing N N 412 Y6U N1 C9 sing N N 413 Y6U C8 C9 doub Y N 414 Y6U C8 N7 sing Y N 415 Y6U C9 C5 sing Y N 416 Y6U N7 C29 sing N N 417 Y6U N7 C6 sing Y N 418 Y6U C5 C6 doub Y N 419 Y6U C29 C30 sing N N 420 Y6U C30 C31 sing N N 421 Y6U C31 C32 sing N N 422 Y6U C15 C32 doub Y N 423 Y6U C15 C13 sing Y N 424 Y6U C32 C16 sing Y N 425 Y6U C13 C12 doub Y N 426 Y6U C16 C14 doub Y N 427 Y6U O27 C26 doub N N 428 Y6U C12 C14 sing Y N 429 Y6U C12 C17 sing N N 430 Y6U N19 C17 sing N N 431 Y6U N19 C20 sing N N 432 Y6U C26 O28 sing N N 433 Y6U C26 C20 sing N N 434 Y6U C17 O18 doub N N 435 Y6U C20 C21 sing N N 436 Y6U C21 C22 sing N N 437 Y6U C22 C23 sing N N 438 Y6U C23 O24 doub N N 439 Y6U C23 O25 sing N N 440 Y6U C5 H1 sing N N 441 Y6U C6 H2 sing N N 442 Y6U C14 H3 sing N N 443 Y6U C13 H4 sing N N 444 Y6U C15 H5 sing N N 445 Y6U C16 H6 sing N N 446 Y6U C20 H7 sing N N 447 Y6U C21 H8 sing N N 448 Y6U C21 H9 sing N N 449 Y6U C22 H10 sing N N 450 Y6U C22 H11 sing N N 451 Y6U C29 H12 sing N N 452 Y6U C29 H13 sing N N 453 Y6U C30 H14 sing N N 454 Y6U C30 H15 sing N N 455 Y6U C31 H16 sing N N 456 Y6U C31 H17 sing N N 457 Y6U N11 H18 sing N N 458 Y6U N11 H19 sing N N 459 Y6U N19 H20 sing N N 460 Y6U N3 H21 sing N N 461 Y6U O25 H22 sing N N 462 Y6U O28 H23 sing N N 463 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Cancer Institute (NIH/NCI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R01 CA250469' _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id Y6U _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id Y6U _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'GLYCINAMIDE RIBONUCLEOTIDE' GAR 3 'N-{4-[3-(2-amino-4-oxo-3,4-dihydro-5H-pyrrolo[3,2-d]pyrimidin-5-yl)propyl]benzoyl}-L-glutamic acid' Y6U 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5j9F _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #