data_8FYR # _entry.id 8FYR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.366 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8FYR pdb_00008fyr 10.2210/pdb8fyr/pdb WWPDB D_1000271832 ? ? EMDB EMD-29595 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'MicroED structure of Proteinase K from oxygen milled lamellae' _pdbx_database_related.db_id EMD-29595 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8FYR _pdbx_database_status.recvd_initial_deposition_date 2023-01-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Martynowycz, M.W.' 1 0000-0003-0055-230X 'Shiriaeva, A.' 2 0000-0002-4082-7884 'Clabbers, M.T.B.' 3 0000-0002-5466-6508 'Nicolas, W.J.' 4 0000-0001-5970-8626 'Weaver, S.J.' 5 0000-0001-7753-6215 'Hattne, J.' 6 0000-0002-8936-0912 'Gonen, T.' 7 0000-0002-9254-4069 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 1086 _citation.page_last 1086 _citation.title 'A robust approach for MicroED sample preparation of lipidic cubic phase embedded membrane protein crystals.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-023-36733-4 _citation.pdbx_database_id_PubMed 36841804 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Martynowycz, M.W.' 1 ? primary 'Shiriaeva, A.' 2 0000-0002-4082-7884 primary 'Clabbers, M.T.B.' 3 0000-0002-5466-6508 primary 'Nicolas, W.J.' 4 ? primary 'Weaver, S.J.' 5 ? primary 'Hattne, J.' 6 0000-0002-8936-0912 primary 'Gonen, T.' 7 0000-0002-9254-4069 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8FYR _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.260 _cell.length_a_esd ? _cell.length_b 67.260 _cell.length_b_esd ? _cell.length_c 106.810 _cell.length_c_esd ? _cell.volume 483198.571 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8FYR _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Proteinase K' 28958.791 1 3.4.21.64 ? ? ? 2 non-polymer syn 'NITRATE ION' 62.005 2 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 4 water nat water 18.015 344 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Endopeptidase K,Tritirachium alkaline proteinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSR TYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAG NNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTL GKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA ; _entity_poly.pdbx_seq_one_letter_code_can ;AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSR TYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAG NNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTL GKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ALA n 1 3 GLN n 1 4 THR n 1 5 ASN n 1 6 ALA n 1 7 PRO n 1 8 TRP n 1 9 GLY n 1 10 LEU n 1 11 ALA n 1 12 ARG n 1 13 ILE n 1 14 SER n 1 15 SER n 1 16 THR n 1 17 SER n 1 18 PRO n 1 19 GLY n 1 20 THR n 1 21 SER n 1 22 THR n 1 23 TYR n 1 24 TYR n 1 25 TYR n 1 26 ASP n 1 27 GLU n 1 28 SER n 1 29 ALA n 1 30 GLY n 1 31 GLN n 1 32 GLY n 1 33 SER n 1 34 CYS n 1 35 VAL n 1 36 TYR n 1 37 VAL n 1 38 ILE n 1 39 ASP n 1 40 THR n 1 41 GLY n 1 42 ILE n 1 43 GLU n 1 44 ALA n 1 45 SER n 1 46 HIS n 1 47 PRO n 1 48 GLU n 1 49 PHE n 1 50 GLU n 1 51 GLY n 1 52 ARG n 1 53 ALA n 1 54 GLN n 1 55 MET n 1 56 VAL n 1 57 LYS n 1 58 THR n 1 59 TYR n 1 60 TYR n 1 61 TYR n 1 62 SER n 1 63 SER n 1 64 ARG n 1 65 ASP n 1 66 GLY n 1 67 ASN n 1 68 GLY n 1 69 HIS n 1 70 GLY n 1 71 THR n 1 72 HIS n 1 73 CYS n 1 74 ALA n 1 75 GLY n 1 76 THR n 1 77 VAL n 1 78 GLY n 1 79 SER n 1 80 ARG n 1 81 THR n 1 82 TYR n 1 83 GLY n 1 84 VAL n 1 85 ALA n 1 86 LYS n 1 87 LYS n 1 88 THR n 1 89 GLN n 1 90 LEU n 1 91 PHE n 1 92 GLY n 1 93 VAL n 1 94 LYS n 1 95 VAL n 1 96 LEU n 1 97 ASP n 1 98 ASP n 1 99 ASN n 1 100 GLY n 1 101 SER n 1 102 GLY n 1 103 GLN n 1 104 TYR n 1 105 SER n 1 106 THR n 1 107 ILE n 1 108 ILE n 1 109 ALA n 1 110 GLY n 1 111 MET n 1 112 ASP n 1 113 PHE n 1 114 VAL n 1 115 ALA n 1 116 SER n 1 117 ASP n 1 118 LYS n 1 119 ASN n 1 120 ASN n 1 121 ARG n 1 122 ASN n 1 123 CYS n 1 124 PRO n 1 125 LYS n 1 126 GLY n 1 127 VAL n 1 128 VAL n 1 129 ALA n 1 130 SER n 1 131 LEU n 1 132 SER n 1 133 LEU n 1 134 GLY n 1 135 GLY n 1 136 GLY n 1 137 TYR n 1 138 SER n 1 139 SER n 1 140 SER n 1 141 VAL n 1 142 ASN n 1 143 SER n 1 144 ALA n 1 145 ALA n 1 146 ALA n 1 147 ARG n 1 148 LEU n 1 149 GLN n 1 150 SER n 1 151 SER n 1 152 GLY n 1 153 VAL n 1 154 MET n 1 155 VAL n 1 156 ALA n 1 157 VAL n 1 158 ALA n 1 159 ALA n 1 160 GLY n 1 161 ASN n 1 162 ASN n 1 163 ASN n 1 164 ALA n 1 165 ASP n 1 166 ALA n 1 167 ARG n 1 168 ASN n 1 169 TYR n 1 170 SER n 1 171 PRO n 1 172 ALA n 1 173 SER n 1 174 GLU n 1 175 PRO n 1 176 SER n 1 177 VAL n 1 178 CYS n 1 179 THR n 1 180 VAL n 1 181 GLY n 1 182 ALA n 1 183 SER n 1 184 ASP n 1 185 ARG n 1 186 TYR n 1 187 ASP n 1 188 ARG n 1 189 ARG n 1 190 SER n 1 191 SER n 1 192 PHE n 1 193 SER n 1 194 ASN n 1 195 TYR n 1 196 GLY n 1 197 SER n 1 198 VAL n 1 199 LEU n 1 200 ASP n 1 201 ILE n 1 202 PHE n 1 203 GLY n 1 204 PRO n 1 205 GLY n 1 206 THR n 1 207 ASP n 1 208 ILE n 1 209 LEU n 1 210 SER n 1 211 THR n 1 212 TRP n 1 213 ILE n 1 214 GLY n 1 215 GLY n 1 216 SER n 1 217 THR n 1 218 ARG n 1 219 SER n 1 220 ILE n 1 221 SER n 1 222 GLY n 1 223 THR n 1 224 SER n 1 225 MET n 1 226 ALA n 1 227 THR n 1 228 PRO n 1 229 HIS n 1 230 VAL n 1 231 ALA n 1 232 GLY n 1 233 LEU n 1 234 ALA n 1 235 ALA n 1 236 TYR n 1 237 LEU n 1 238 MET n 1 239 THR n 1 240 LEU n 1 241 GLY n 1 242 LYS n 1 243 THR n 1 244 THR n 1 245 ALA n 1 246 ALA n 1 247 SER n 1 248 ALA n 1 249 CYS n 1 250 ARG n 1 251 TYR n 1 252 ILE n 1 253 ALA n 1 254 ASP n 1 255 THR n 1 256 ALA n 1 257 ASN n 1 258 LYS n 1 259 GLY n 1 260 ASP n 1 261 LEU n 1 262 SER n 1 263 ASN n 1 264 ILE n 1 265 PRO n 1 266 PHE n 1 267 GLY n 1 268 THR n 1 269 VAL n 1 270 ASN n 1 271 LEU n 1 272 LEU n 1 273 ALA n 1 274 TYR n 1 275 ASN n 1 276 ASN n 1 277 TYR n 1 278 GLN n 1 279 ALA n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 279 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Parengyodontium album' _entity_src_nat.pdbx_ncbi_taxonomy_id 37998 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRTK_PARAQ _struct_ref.pdbx_db_accession P06873 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSR TYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAG NNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTL GKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA ; _struct_ref.pdbx_align_begin 106 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8FYR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 279 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06873 _struct_ref_seq.db_align_beg 106 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 384 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 106 _struct_ref_seq.pdbx_auth_seq_align_end 384 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8FYR _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 207 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P06873 _struct_ref_seq_dif.db_mon_id SER _struct_ref_seq_dif.pdbx_seq_db_seq_num 312 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 312 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NO3 non-polymer . 'NITRATE ION' ? 'N O3 -1' 62.005 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8FYR _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON CRYSTALLOGRAPHY' _exptl.method_details ? # _reflns.B_iso_Wilson_estimate 9.69 _reflns.entry_id 8FYR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high ? _reflns.d_resolution_low ? _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs ? _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs ? _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI ? _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 12.16 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8FYR _refine.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.500 _refine.ls_d_res_low 20.36 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 38465 _refine.ls_number_reflns_R_free 1966 _refine.ls_number_reflns_R_work 36499 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.25 _refine.ls_percent_reflns_R_free 5.11 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1659 _refine.ls_R_factor_R_free 0.2138 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1634 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 0.9000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.8238 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1803 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.50 _refine_hist.d_res_low 20.36 _refine_hist.number_atoms_solvent 344 _refine_hist.number_atoms_total 2385 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2031 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON CRYSTALLOGRAPHY' ? 0.0018 ? 2096 ? f_bond_d ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.4835 ? 2851 ? f_angle_d ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.0543 ? 316 ? f_chiral_restr ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.0030 ? 377 ? f_plane_restr ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 4.7510 ? 313 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'ELECTRON CRYSTALLOGRAPHY' 1.50 1.54 . . 160 2509 95.15 . . . . 0.2528 . . . . . . . . . . . 0.3102 'ELECTRON CRYSTALLOGRAPHY' 1.54 1.58 . . 117 2562 96.26 . . . . 0.2433 . . . . . . . . . . . 0.3182 'ELECTRON CRYSTALLOGRAPHY' 1.58 1.63 . . 145 2562 96.40 . . . . 0.2342 . . . . . . . . . . . 0.3425 'ELECTRON CRYSTALLOGRAPHY' 1.63 1.68 . . 113 2602 96.38 . . . . 0.2174 . . . . . . . . . . . 0.2887 'ELECTRON CRYSTALLOGRAPHY' 1.68 1.74 . . 151 2548 96.46 . . . . 0.1987 . . . . . . . . . . . 0.2606 'ELECTRON CRYSTALLOGRAPHY' 1.74 1.81 . . 138 2596 96.61 . . . . 0.1867 . . . . . . . . . . . 0.2501 'ELECTRON CRYSTALLOGRAPHY' 1.81 1.89 . . 149 2564 96.27 . . . . 0.1680 . . . . . . . . . . . 0.2277 'ELECTRON CRYSTALLOGRAPHY' 1.89 1.99 . . 145 2598 96.52 . . . . 0.1544 . . . . . . . . . . . 0.2343 'ELECTRON CRYSTALLOGRAPHY' 1.99 2.11 . . 139 2600 96.55 . . . . 0.1448 . . . . . . . . . . . 0.2054 'ELECTRON CRYSTALLOGRAPHY' 2.11 2.28 . . 131 2630 96.67 . . . . 0.1346 . . . . . . . . . . . 0.1876 'ELECTRON CRYSTALLOGRAPHY' 2.28 2.51 . . 126 2635 96.34 . . . . 0.1420 . . . . . . . . . . . 0.2110 'ELECTRON CRYSTALLOGRAPHY' 2.51 2.87 . . 146 2636 96.43 . . . . 0.1416 . . . . . . . . . . . 0.1769 'ELECTRON CRYSTALLOGRAPHY' 2.87 3.61 . . 145 2666 96.17 . . . . 0.1393 . . . . . . . . . . . 0.1715 'ELECTRON CRYSTALLOGRAPHY' 3.61 20.36 . . 161 2791 95.38 . . . . 0.1565 . . . . . . . . . . . 0.1721 # _struct.entry_id 8FYR _struct.title 'MicroED structure of Proteinase K from oxygen milled lamellae' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8FYR _struct_keywords.text Hydrolase _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 7 ? SER A 14 ? PRO A 112 SER A 119 1 ? 8 HELX_P HELX_P2 AA2 HIS A 46 ? GLU A 50 ? HIS A 151 GLU A 155 5 ? 5 HELX_P HELX_P3 AA3 GLY A 68 ? SER A 79 ? GLY A 173 SER A 184 1 ? 12 HELX_P HELX_P4 AA4 GLN A 103 ? LYS A 118 ? GLN A 208 LYS A 223 1 ? 16 HELX_P HELX_P5 AA5 ASN A 119 ? ARG A 121 ? ASN A 224 ARG A 226 5 ? 3 HELX_P HELX_P6 AA6 SER A 138 ? SER A 151 ? SER A 243 SER A 256 1 ? 14 HELX_P HELX_P7 AA7 ASP A 165 ? ARG A 167 ? ASP A 270 ARG A 272 5 ? 3 HELX_P HELX_P8 AA8 GLY A 222 ? LEU A 240 ? GLY A 327 LEU A 345 1 ? 19 HELX_P HELX_P9 AA9 SER A 247 ? THR A 255 ? SER A 352 THR A 360 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 123 SG ? ? A CYS 139 A CYS 228 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 178 SG ? ? ? 1_555 A CYS 249 SG ? ? A CYS 283 A CYS 354 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc1 metalc ? ? A THR 16 O ? ? ? 1_555 E CA . CA ? ? A THR 121 A CA 404 1_555 ? ? ? ? ? ? ? 2.207 ? ? metalc2 metalc ? ? A PRO 175 O ? ? ? 1_555 D CA . CA ? ? A PRO 280 A CA 403 1_555 ? ? ? ? ? ? ? 2.366 ? ? metalc3 metalc ? ? A VAL 177 O ? ? ? 1_555 D CA . CA ? ? A VAL 282 A CA 403 1_555 ? ? ? ? ? ? ? 2.361 ? ? metalc4 metalc ? ? A ASP 200 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 305 A CA 403 1_555 ? ? ? ? ? ? ? 2.635 ? ? metalc5 metalc ? ? A ASP 200 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 305 A CA 403 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc6 metalc ? ? A ASP 260 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 365 A CA 404 1_555 ? ? ? ? ? ? ? 2.372 ? ? metalc7 metalc ? ? A ASP 260 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 365 A CA 404 1_555 ? ? ? ? ? ? ? 2.386 ? ? metalc8 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 403 A HOH 558 1_555 ? ? ? ? ? ? ? 2.477 ? ? metalc9 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 403 A HOH 592 1_555 ? ? ? ? ? ? ? 2.495 ? ? metalc10 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 403 A HOH 648 1_555 ? ? ? ? ? ? ? 2.402 ? ? metalc11 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 403 A HOH 651 1_555 ? ? ? ? ? ? ? 2.460 ? ? metalc12 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 404 A HOH 625 1_555 ? ? ? ? ? ? ? 2.567 ? ? metalc13 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 404 A HOH 662 1_555 ? ? ? ? ? ? ? 2.407 ? ? metalc14 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 404 A HOH 675 1_555 ? ? ? ? ? ? ? 2.243 ? ? metalc15 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 404 A HOH 713 1_555 ? ? ? ? ? ? ? 2.638 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 170 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 275 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 171 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 276 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.77 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 7 ? AA3 ? 2 ? AA4 ? 2 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? parallel AA2 6 7 ? parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 2 ? GLN A 3 ? ALA A 107 GLN A 108 AA1 2 TYR A 23 ? TYR A 24 ? TYR A 128 TYR A 129 AA2 1 ALA A 53 ? THR A 58 ? ALA A 158 THR A 163 AA2 2 GLN A 89 ? LYS A 94 ? GLN A 194 LYS A 199 AA2 3 SER A 33 ? ASP A 39 ? SER A 138 ASP A 144 AA2 4 GLY A 126 ? LEU A 131 ? GLY A 231 LEU A 236 AA2 5 VAL A 153 ? ALA A 158 ? VAL A 258 ALA A 263 AA2 6 CYS A 178 ? SER A 183 ? CYS A 283 SER A 288 AA2 7 ILE A 201 ? PRO A 204 ? ILE A 306 PRO A 309 AA3 1 GLY A 135 ? GLY A 136 ? GLY A 240 GLY A 241 AA3 2 TYR A 169 ? SER A 170 ? TYR A 274 SER A 275 AA4 1 ILE A 208 ? TRP A 212 ? ILE A 313 TRP A 317 AA4 2 SER A 216 ? ILE A 220 ? SER A 321 ILE A 325 AA5 1 ASN A 257 ? LYS A 258 ? ASN A 362 LYS A 363 AA5 2 LEU A 271 ? LEU A 272 ? LEU A 376 LEU A 377 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 3 ? N GLN A 108 O TYR A 23 ? O TYR A 128 AA2 1 2 N LYS A 57 ? N LYS A 162 O LYS A 94 ? O LYS A 199 AA2 2 3 O PHE A 91 ? O PHE A 196 N VAL A 37 ? N VAL A 142 AA2 3 4 N TYR A 36 ? N TYR A 141 O VAL A 128 ? O VAL A 233 AA2 4 5 N LEU A 131 ? N LEU A 236 O ALA A 156 ? O ALA A 261 AA2 5 6 N VAL A 157 ? N VAL A 262 O CYS A 178 ? O CYS A 283 AA2 6 7 N GLY A 181 ? N GLY A 286 O ILE A 201 ? O ILE A 306 AA3 1 2 N GLY A 135 ? N GLY A 240 O SER A 170 ? O SER A 275 AA4 1 2 N TRP A 212 ? N TRP A 317 O SER A 216 ? O SER A 321 AA5 1 2 N ASN A 257 ? N ASN A 362 O LEU A 272 ? O LEU A 377 # _atom_sites.entry_id 8FYR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014868 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014868 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009362 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.pdbx_scat_Cromer_Mann_a5 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.pdbx_scat_Cromer_Mann_b5 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 0.08930 0.25630 0.75700 1.04870 0.35750 0.24650 1.71000 6.40940 18.61130 50.25230 0.0 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CA ? ? 0.40540 1.38800 2.16020 3.75320 2.20630 0.34990 3.09910 11.96080 53.93530 142.38920 0.0 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.03490 0.12010 0.19700 0.05730 0.11950 0.53470 3.58670 12.34710 18.95250 38.62690 0.0 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 0.10220 0.32190 0.79820 0.81970 0.17150 0.24510 1.74810 6.19250 17.38940 48.14310 0.0 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 0.09740 0.29210 0.69100 0.69900 0.20390 0.20670 1.38150 4.69430 12.71050 32.47260 0.0 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 0.24970 0.56280 1.38990 2.18650 0.77150 0.26810 1.67110 7.02670 19.53770 50.38880 0.0 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 106 106 ALA ALA A . n A 1 2 ALA 2 107 107 ALA ALA A . n A 1 3 GLN 3 108 108 GLN GLN A . n A 1 4 THR 4 109 109 THR THR A . n A 1 5 ASN 5 110 110 ASN ASN A . n A 1 6 ALA 6 111 111 ALA ALA A . n A 1 7 PRO 7 112 112 PRO PRO A . n A 1 8 TRP 8 113 113 TRP TRP A . n A 1 9 GLY 9 114 114 GLY GLY A . n A 1 10 LEU 10 115 115 LEU LEU A . n A 1 11 ALA 11 116 116 ALA ALA A . n A 1 12 ARG 12 117 117 ARG ARG A . n A 1 13 ILE 13 118 118 ILE ILE A . n A 1 14 SER 14 119 119 SER SER A . n A 1 15 SER 15 120 120 SER SER A . n A 1 16 THR 16 121 121 THR THR A . n A 1 17 SER 17 122 122 SER SER A . n A 1 18 PRO 18 123 123 PRO PRO A . n A 1 19 GLY 19 124 124 GLY GLY A . n A 1 20 THR 20 125 125 THR THR A . n A 1 21 SER 21 126 126 SER SER A . n A 1 22 THR 22 127 127 THR THR A . n A 1 23 TYR 23 128 128 TYR TYR A . n A 1 24 TYR 24 129 129 TYR TYR A . n A 1 25 TYR 25 130 130 TYR TYR A . n A 1 26 ASP 26 131 131 ASP ASP A . n A 1 27 GLU 27 132 132 GLU GLU A . n A 1 28 SER 28 133 133 SER SER A . n A 1 29 ALA 29 134 134 ALA ALA A . n A 1 30 GLY 30 135 135 GLY GLY A . n A 1 31 GLN 31 136 136 GLN GLN A . n A 1 32 GLY 32 137 137 GLY GLY A . n A 1 33 SER 33 138 138 SER SER A . n A 1 34 CYS 34 139 139 CYS CYS A . n A 1 35 VAL 35 140 140 VAL VAL A . n A 1 36 TYR 36 141 141 TYR TYR A . n A 1 37 VAL 37 142 142 VAL VAL A . n A 1 38 ILE 38 143 143 ILE ILE A . n A 1 39 ASP 39 144 144 ASP ASP A . n A 1 40 THR 40 145 145 THR THR A . n A 1 41 GLY 41 146 146 GLY GLY A . n A 1 42 ILE 42 147 147 ILE ILE A . n A 1 43 GLU 43 148 148 GLU GLU A . n A 1 44 ALA 44 149 149 ALA ALA A . n A 1 45 SER 45 150 150 SER SER A . n A 1 46 HIS 46 151 151 HIS HIS A . n A 1 47 PRO 47 152 152 PRO PRO A . n A 1 48 GLU 48 153 153 GLU GLU A . n A 1 49 PHE 49 154 154 PHE PHE A . n A 1 50 GLU 50 155 155 GLU GLU A . n A 1 51 GLY 51 156 156 GLY GLY A . n A 1 52 ARG 52 157 157 ARG ARG A . n A 1 53 ALA 53 158 158 ALA ALA A . n A 1 54 GLN 54 159 159 GLN GLN A . n A 1 55 MET 55 160 160 MET MET A . n A 1 56 VAL 56 161 161 VAL VAL A . n A 1 57 LYS 57 162 162 LYS LYS A . n A 1 58 THR 58 163 163 THR THR A . n A 1 59 TYR 59 164 164 TYR TYR A . n A 1 60 TYR 60 165 165 TYR TYR A . n A 1 61 TYR 61 166 166 TYR TYR A . n A 1 62 SER 62 167 167 SER SER A . n A 1 63 SER 63 168 168 SER SER A . n A 1 64 ARG 64 169 169 ARG ARG A . n A 1 65 ASP 65 170 170 ASP ASP A . n A 1 66 GLY 66 171 171 GLY GLY A . n A 1 67 ASN 67 172 172 ASN ASN A . n A 1 68 GLY 68 173 173 GLY GLY A . n A 1 69 HIS 69 174 174 HIS HIS A . n A 1 70 GLY 70 175 175 GLY GLY A . n A 1 71 THR 71 176 176 THR THR A . n A 1 72 HIS 72 177 177 HIS HIS A . n A 1 73 CYS 73 178 178 CYS CYS A . n A 1 74 ALA 74 179 179 ALA ALA A . n A 1 75 GLY 75 180 180 GLY GLY A . n A 1 76 THR 76 181 181 THR THR A . n A 1 77 VAL 77 182 182 VAL VAL A . n A 1 78 GLY 78 183 183 GLY GLY A . n A 1 79 SER 79 184 184 SER SER A . n A 1 80 ARG 80 185 185 ARG ARG A . n A 1 81 THR 81 186 186 THR THR A . n A 1 82 TYR 82 187 187 TYR TYR A . n A 1 83 GLY 83 188 188 GLY GLY A . n A 1 84 VAL 84 189 189 VAL VAL A . n A 1 85 ALA 85 190 190 ALA ALA A . n A 1 86 LYS 86 191 191 LYS LYS A . n A 1 87 LYS 87 192 192 LYS LYS A . n A 1 88 THR 88 193 193 THR THR A . n A 1 89 GLN 89 194 194 GLN GLN A . n A 1 90 LEU 90 195 195 LEU LEU A . n A 1 91 PHE 91 196 196 PHE PHE A . n A 1 92 GLY 92 197 197 GLY GLY A . n A 1 93 VAL 93 198 198 VAL VAL A . n A 1 94 LYS 94 199 199 LYS LYS A . n A 1 95 VAL 95 200 200 VAL VAL A . n A 1 96 LEU 96 201 201 LEU LEU A . n A 1 97 ASP 97 202 202 ASP ASP A . n A 1 98 ASP 98 203 203 ASP ASP A . n A 1 99 ASN 99 204 204 ASN ASN A . n A 1 100 GLY 100 205 205 GLY GLY A . n A 1 101 SER 101 206 206 SER SER A . n A 1 102 GLY 102 207 207 GLY GLY A . n A 1 103 GLN 103 208 208 GLN GLN A . n A 1 104 TYR 104 209 209 TYR TYR A . n A 1 105 SER 105 210 210 SER SER A . n A 1 106 THR 106 211 211 THR THR A . n A 1 107 ILE 107 212 212 ILE ILE A . n A 1 108 ILE 108 213 213 ILE ILE A . n A 1 109 ALA 109 214 214 ALA ALA A . n A 1 110 GLY 110 215 215 GLY GLY A . n A 1 111 MET 111 216 216 MET MET A . n A 1 112 ASP 112 217 217 ASP ASP A . n A 1 113 PHE 113 218 218 PHE PHE A . n A 1 114 VAL 114 219 219 VAL VAL A . n A 1 115 ALA 115 220 220 ALA ALA A . n A 1 116 SER 116 221 221 SER SER A . n A 1 117 ASP 117 222 222 ASP ASP A . n A 1 118 LYS 118 223 223 LYS LYS A . n A 1 119 ASN 119 224 224 ASN ASN A . n A 1 120 ASN 120 225 225 ASN ASN A . n A 1 121 ARG 121 226 226 ARG ARG A . n A 1 122 ASN 122 227 227 ASN ASN A . n A 1 123 CYS 123 228 228 CYS CYS A . n A 1 124 PRO 124 229 229 PRO PRO A . n A 1 125 LYS 125 230 230 LYS LYS A . n A 1 126 GLY 126 231 231 GLY GLY A . n A 1 127 VAL 127 232 232 VAL VAL A . n A 1 128 VAL 128 233 233 VAL VAL A . n A 1 129 ALA 129 234 234 ALA ALA A . n A 1 130 SER 130 235 235 SER SER A . n A 1 131 LEU 131 236 236 LEU LEU A . n A 1 132 SER 132 237 237 SER SER A . n A 1 133 LEU 133 238 238 LEU LEU A . n A 1 134 GLY 134 239 239 GLY GLY A . n A 1 135 GLY 135 240 240 GLY GLY A . n A 1 136 GLY 136 241 241 GLY GLY A . n A 1 137 TYR 137 242 242 TYR TYR A . n A 1 138 SER 138 243 243 SER SER A . n A 1 139 SER 139 244 244 SER SER A . n A 1 140 SER 140 245 245 SER SER A . n A 1 141 VAL 141 246 246 VAL VAL A . n A 1 142 ASN 142 247 247 ASN ASN A . n A 1 143 SER 143 248 248 SER SER A . n A 1 144 ALA 144 249 249 ALA ALA A . n A 1 145 ALA 145 250 250 ALA ALA A . n A 1 146 ALA 146 251 251 ALA ALA A . n A 1 147 ARG 147 252 252 ARG ARG A . n A 1 148 LEU 148 253 253 LEU LEU A . n A 1 149 GLN 149 254 254 GLN GLN A . n A 1 150 SER 150 255 255 SER SER A . n A 1 151 SER 151 256 256 SER SER A . n A 1 152 GLY 152 257 257 GLY GLY A . n A 1 153 VAL 153 258 258 VAL VAL A . n A 1 154 MET 154 259 259 MET MET A . n A 1 155 VAL 155 260 260 VAL VAL A . n A 1 156 ALA 156 261 261 ALA ALA A . n A 1 157 VAL 157 262 262 VAL VAL A . n A 1 158 ALA 158 263 263 ALA ALA A . n A 1 159 ALA 159 264 264 ALA ALA A . n A 1 160 GLY 160 265 265 GLY GLY A . n A 1 161 ASN 161 266 266 ASN ASN A . n A 1 162 ASN 162 267 267 ASN ASN A . n A 1 163 ASN 163 268 268 ASN ASN A . n A 1 164 ALA 164 269 269 ALA ALA A . n A 1 165 ASP 165 270 270 ASP ASP A . n A 1 166 ALA 166 271 271 ALA ALA A . n A 1 167 ARG 167 272 272 ARG ARG A . n A 1 168 ASN 168 273 273 ASN ASN A . n A 1 169 TYR 169 274 274 TYR TYR A . n A 1 170 SER 170 275 275 SER SER A . n A 1 171 PRO 171 276 276 PRO PRO A . n A 1 172 ALA 172 277 277 ALA ALA A . n A 1 173 SER 173 278 278 SER SER A . n A 1 174 GLU 174 279 279 GLU GLU A . n A 1 175 PRO 175 280 280 PRO PRO A . n A 1 176 SER 176 281 281 SER SER A . n A 1 177 VAL 177 282 282 VAL VAL A . n A 1 178 CYS 178 283 283 CYS CYS A . n A 1 179 THR 179 284 284 THR THR A . n A 1 180 VAL 180 285 285 VAL VAL A . n A 1 181 GLY 181 286 286 GLY GLY A . n A 1 182 ALA 182 287 287 ALA ALA A . n A 1 183 SER 183 288 288 SER SER A . n A 1 184 ASP 184 289 289 ASP ASP A . n A 1 185 ARG 185 290 290 ARG ARG A . n A 1 186 TYR 186 291 291 TYR TYR A . n A 1 187 ASP 187 292 292 ASP ASP A . n A 1 188 ARG 188 293 293 ARG ARG A . n A 1 189 ARG 189 294 294 ARG ARG A . n A 1 190 SER 190 295 295 SER SER A . n A 1 191 SER 191 296 296 SER SER A . n A 1 192 PHE 192 297 297 PHE PHE A . n A 1 193 SER 193 298 298 SER SER A . n A 1 194 ASN 194 299 299 ASN ASN A . n A 1 195 TYR 195 300 300 TYR TYR A . n A 1 196 GLY 196 301 301 GLY GLY A . n A 1 197 SER 197 302 302 SER SER A . n A 1 198 VAL 198 303 303 VAL VAL A . n A 1 199 LEU 199 304 304 LEU LEU A . n A 1 200 ASP 200 305 305 ASP ASP A . n A 1 201 ILE 201 306 306 ILE ILE A . n A 1 202 PHE 202 307 307 PHE PHE A . n A 1 203 GLY 203 308 308 GLY GLY A . n A 1 204 PRO 204 309 309 PRO PRO A . n A 1 205 GLY 205 310 310 GLY GLY A . n A 1 206 THR 206 311 311 THR THR A . n A 1 207 ASP 207 312 312 ASP ASP A . n A 1 208 ILE 208 313 313 ILE ILE A . n A 1 209 LEU 209 314 314 LEU LEU A . n A 1 210 SER 210 315 315 SER SER A . n A 1 211 THR 211 316 316 THR THR A . n A 1 212 TRP 212 317 317 TRP TRP A . n A 1 213 ILE 213 318 318 ILE ILE A . n A 1 214 GLY 214 319 319 GLY GLY A . n A 1 215 GLY 215 320 320 GLY GLY A . n A 1 216 SER 216 321 321 SER SER A . n A 1 217 THR 217 322 322 THR THR A . n A 1 218 ARG 218 323 323 ARG ARG A . n A 1 219 SER 219 324 324 SER SER A . n A 1 220 ILE 220 325 325 ILE ILE A . n A 1 221 SER 221 326 326 SER SER A . n A 1 222 GLY 222 327 327 GLY GLY A . n A 1 223 THR 223 328 328 THR THR A . n A 1 224 SER 224 329 329 SER SER A . n A 1 225 MET 225 330 330 MET MET A . n A 1 226 ALA 226 331 331 ALA ALA A . n A 1 227 THR 227 332 332 THR THR A . n A 1 228 PRO 228 333 333 PRO PRO A . n A 1 229 HIS 229 334 334 HIS HIS A . n A 1 230 VAL 230 335 335 VAL VAL A . n A 1 231 ALA 231 336 336 ALA ALA A . n A 1 232 GLY 232 337 337 GLY GLY A . n A 1 233 LEU 233 338 338 LEU LEU A . n A 1 234 ALA 234 339 339 ALA ALA A . n A 1 235 ALA 235 340 340 ALA ALA A . n A 1 236 TYR 236 341 341 TYR TYR A . n A 1 237 LEU 237 342 342 LEU LEU A . n A 1 238 MET 238 343 343 MET MET A . n A 1 239 THR 239 344 344 THR THR A . n A 1 240 LEU 240 345 345 LEU LEU A . n A 1 241 GLY 241 346 346 GLY GLY A . n A 1 242 LYS 242 347 347 LYS LYS A . n A 1 243 THR 243 348 348 THR THR A . n A 1 244 THR 244 349 349 THR THR A . n A 1 245 ALA 245 350 350 ALA ALA A . n A 1 246 ALA 246 351 351 ALA ALA A . n A 1 247 SER 247 352 352 SER SER A . n A 1 248 ALA 248 353 353 ALA ALA A . n A 1 249 CYS 249 354 354 CYS CYS A . n A 1 250 ARG 250 355 355 ARG ARG A . n A 1 251 TYR 251 356 356 TYR TYR A . n A 1 252 ILE 252 357 357 ILE ILE A . n A 1 253 ALA 253 358 358 ALA ALA A . n A 1 254 ASP 254 359 359 ASP ASP A . n A 1 255 THR 255 360 360 THR THR A . n A 1 256 ALA 256 361 361 ALA ALA A . n A 1 257 ASN 257 362 362 ASN ASN A . n A 1 258 LYS 258 363 363 LYS LYS A . n A 1 259 GLY 259 364 364 GLY GLY A . n A 1 260 ASP 260 365 365 ASP ASP A . n A 1 261 LEU 261 366 366 LEU LEU A . n A 1 262 SER 262 367 367 SER SER A . n A 1 263 ASN 263 368 368 ASN ASN A . n A 1 264 ILE 264 369 369 ILE ILE A . n A 1 265 PRO 265 370 370 PRO PRO A . n A 1 266 PHE 266 371 371 PHE PHE A . n A 1 267 GLY 267 372 372 GLY GLY A . n A 1 268 THR 268 373 373 THR THR A . n A 1 269 VAL 269 374 374 VAL VAL A . n A 1 270 ASN 270 375 375 ASN ASN A . n A 1 271 LEU 271 376 376 LEU LEU A . n A 1 272 LEU 272 377 377 LEU LEU A . n A 1 273 ALA 273 378 378 ALA ALA A . n A 1 274 TYR 274 379 379 TYR TYR A . n A 1 275 ASN 275 380 380 ASN ASN A . n A 1 276 ASN 276 381 381 ASN ASN A . n A 1 277 TYR 277 382 382 TYR TYR A . n A 1 278 GLN 278 383 383 GLN GLN A . n A 1 279 ALA 279 384 384 ALA ALA A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email tgonen@ucla.edu _pdbx_contact_author.name_first Tamir _pdbx_contact_author.name_last Gonen _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9254-4069 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NO3 1 401 401 NO3 NO3 A . C 2 NO3 1 402 402 NO3 NO3 A . D 3 CA 1 403 1 CA CA A . E 3 CA 1 404 2 CA CA A . F 4 HOH 1 501 292 HOH HOH A . F 4 HOH 2 502 264 HOH HOH A . F 4 HOH 3 503 209 HOH HOH A . F 4 HOH 4 504 254 HOH HOH A . F 4 HOH 5 505 174 HOH HOH A . F 4 HOH 6 506 219 HOH HOH A . F 4 HOH 7 507 250 HOH HOH A . F 4 HOH 8 508 168 HOH HOH A . F 4 HOH 9 509 49 HOH HOH A . F 4 HOH 10 510 187 HOH HOH A . F 4 HOH 11 511 136 HOH HOH A . F 4 HOH 12 512 181 HOH HOH A . F 4 HOH 13 513 173 HOH HOH A . F 4 HOH 14 514 239 HOH HOH A . F 4 HOH 15 515 249 HOH HOH A . F 4 HOH 16 516 283 HOH HOH A . F 4 HOH 17 517 176 HOH HOH A . F 4 HOH 18 518 207 HOH HOH A . F 4 HOH 19 519 161 HOH HOH A . F 4 HOH 20 520 163 HOH HOH A . F 4 HOH 21 521 218 HOH HOH A . F 4 HOH 22 522 186 HOH HOH A . F 4 HOH 23 523 16 HOH HOH A . F 4 HOH 24 524 76 HOH HOH A . F 4 HOH 25 525 203 HOH HOH A . F 4 HOH 26 526 221 HOH HOH A . F 4 HOH 27 527 305 HOH HOH A . F 4 HOH 28 528 87 HOH HOH A . F 4 HOH 29 529 322 HOH HOH A . F 4 HOH 30 530 56 HOH HOH A . F 4 HOH 31 531 51 HOH HOH A . F 4 HOH 32 532 229 HOH HOH A . F 4 HOH 33 533 201 HOH HOH A . F 4 HOH 34 534 212 HOH HOH A . F 4 HOH 35 535 121 HOH HOH A . F 4 HOH 36 536 114 HOH HOH A . F 4 HOH 37 537 312 HOH HOH A . F 4 HOH 38 538 108 HOH HOH A . F 4 HOH 39 539 171 HOH HOH A . F 4 HOH 40 540 167 HOH HOH A . F 4 HOH 41 541 278 HOH HOH A . F 4 HOH 42 542 217 HOH HOH A . F 4 HOH 43 543 111 HOH HOH A . F 4 HOH 44 544 99 HOH HOH A . F 4 HOH 45 545 35 HOH HOH A . F 4 HOH 46 546 316 HOH HOH A . F 4 HOH 47 547 24 HOH HOH A . F 4 HOH 48 548 118 HOH HOH A . F 4 HOH 49 549 165 HOH HOH A . F 4 HOH 50 550 228 HOH HOH A . F 4 HOH 51 551 280 HOH HOH A . F 4 HOH 52 552 116 HOH HOH A . F 4 HOH 53 553 253 HOH HOH A . F 4 HOH 54 554 237 HOH HOH A . F 4 HOH 55 555 12 HOH HOH A . F 4 HOH 56 556 315 HOH HOH A . F 4 HOH 57 557 75 HOH HOH A . F 4 HOH 58 558 157 HOH HOH A . F 4 HOH 59 559 279 HOH HOH A . F 4 HOH 60 560 338 HOH HOH A . F 4 HOH 61 561 191 HOH HOH A . F 4 HOH 62 562 258 HOH HOH A . F 4 HOH 63 563 47 HOH HOH A . F 4 HOH 64 564 326 HOH HOH A . F 4 HOH 65 565 98 HOH HOH A . F 4 HOH 66 566 236 HOH HOH A . F 4 HOH 67 567 235 HOH HOH A . F 4 HOH 68 568 154 HOH HOH A . F 4 HOH 69 569 232 HOH HOH A . F 4 HOH 70 570 178 HOH HOH A . F 4 HOH 71 571 184 HOH HOH A . F 4 HOH 72 572 70 HOH HOH A . F 4 HOH 73 573 85 HOH HOH A . F 4 HOH 74 574 226 HOH HOH A . F 4 HOH 75 575 158 HOH HOH A . F 4 HOH 76 576 162 HOH HOH A . F 4 HOH 77 577 3 HOH HOH A . F 4 HOH 78 578 227 HOH HOH A . F 4 HOH 79 579 92 HOH HOH A . F 4 HOH 80 580 247 HOH HOH A . F 4 HOH 81 581 175 HOH HOH A . F 4 HOH 82 582 77 HOH HOH A . F 4 HOH 83 583 179 HOH HOH A . F 4 HOH 84 584 109 HOH HOH A . F 4 HOH 85 585 281 HOH HOH A . F 4 HOH 86 586 159 HOH HOH A . F 4 HOH 87 587 46 HOH HOH A . F 4 HOH 88 588 177 HOH HOH A . F 4 HOH 89 589 263 HOH HOH A . F 4 HOH 90 590 282 HOH HOH A . F 4 HOH 91 591 112 HOH HOH A . F 4 HOH 92 592 153 HOH HOH A . F 4 HOH 93 593 8 HOH HOH A . F 4 HOH 94 594 132 HOH HOH A . F 4 HOH 95 595 182 HOH HOH A . F 4 HOH 96 596 7 HOH HOH A . F 4 HOH 97 597 172 HOH HOH A . F 4 HOH 98 598 13 HOH HOH A . F 4 HOH 99 599 183 HOH HOH A . F 4 HOH 100 600 160 HOH HOH A . F 4 HOH 101 601 78 HOH HOH A . F 4 HOH 102 602 50 HOH HOH A . F 4 HOH 103 603 211 HOH HOH A . F 4 HOH 104 604 195 HOH HOH A . F 4 HOH 105 605 42 HOH HOH A . F 4 HOH 106 606 66 HOH HOH A . F 4 HOH 107 607 337 HOH HOH A . F 4 HOH 108 608 1 HOH HOH A . F 4 HOH 109 609 139 HOH HOH A . F 4 HOH 110 610 115 HOH HOH A . F 4 HOH 111 611 223 HOH HOH A . F 4 HOH 112 612 9 HOH HOH A . F 4 HOH 113 613 37 HOH HOH A . F 4 HOH 114 614 192 HOH HOH A . F 4 HOH 115 615 102 HOH HOH A . F 4 HOH 116 616 18 HOH HOH A . F 4 HOH 117 617 93 HOH HOH A . F 4 HOH 118 618 58 HOH HOH A . F 4 HOH 119 619 155 HOH HOH A . F 4 HOH 120 620 29 HOH HOH A . F 4 HOH 121 621 241 HOH HOH A . F 4 HOH 122 622 32 HOH HOH A . F 4 HOH 123 623 308 HOH HOH A . F 4 HOH 124 624 330 HOH HOH A . F 4 HOH 125 625 67 HOH HOH A . F 4 HOH 126 626 166 HOH HOH A . F 4 HOH 127 627 10 HOH HOH A . F 4 HOH 128 628 14 HOH HOH A . F 4 HOH 129 629 113 HOH HOH A . F 4 HOH 130 630 266 HOH HOH A . F 4 HOH 131 631 69 HOH HOH A . F 4 HOH 132 632 120 HOH HOH A . F 4 HOH 133 633 265 HOH HOH A . F 4 HOH 134 634 156 HOH HOH A . F 4 HOH 135 635 20 HOH HOH A . F 4 HOH 136 636 289 HOH HOH A . F 4 HOH 137 637 23 HOH HOH A . F 4 HOH 138 638 200 HOH HOH A . F 4 HOH 139 639 19 HOH HOH A . F 4 HOH 140 640 40 HOH HOH A . F 4 HOH 141 641 257 HOH HOH A . F 4 HOH 142 642 11 HOH HOH A . F 4 HOH 143 643 246 HOH HOH A . F 4 HOH 144 644 27 HOH HOH A . F 4 HOH 145 645 197 HOH HOH A . F 4 HOH 146 646 48 HOH HOH A . F 4 HOH 147 647 170 HOH HOH A . F 4 HOH 148 648 6 HOH HOH A . F 4 HOH 149 649 79 HOH HOH A . F 4 HOH 150 650 45 HOH HOH A . F 4 HOH 151 651 5 HOH HOH A . F 4 HOH 152 652 44 HOH HOH A . F 4 HOH 153 653 34 HOH HOH A . F 4 HOH 154 654 83 HOH HOH A . F 4 HOH 155 655 68 HOH HOH A . F 4 HOH 156 656 180 HOH HOH A . F 4 HOH 157 657 15 HOH HOH A . F 4 HOH 158 658 285 HOH HOH A . F 4 HOH 159 659 317 HOH HOH A . F 4 HOH 160 660 2 HOH HOH A . F 4 HOH 161 661 135 HOH HOH A . F 4 HOH 162 662 105 HOH HOH A . F 4 HOH 163 663 25 HOH HOH A . F 4 HOH 164 664 193 HOH HOH A . F 4 HOH 165 665 271 HOH HOH A . F 4 HOH 166 666 164 HOH HOH A . F 4 HOH 167 667 336 HOH HOH A . F 4 HOH 168 668 206 HOH HOH A . F 4 HOH 169 669 60 HOH HOH A . F 4 HOH 170 670 59 HOH HOH A . F 4 HOH 171 671 130 HOH HOH A . F 4 HOH 172 672 243 HOH HOH A . F 4 HOH 173 673 30 HOH HOH A . F 4 HOH 174 674 286 HOH HOH A . F 4 HOH 175 675 131 HOH HOH A . F 4 HOH 176 676 88 HOH HOH A . F 4 HOH 177 677 231 HOH HOH A . F 4 HOH 178 678 205 HOH HOH A . F 4 HOH 179 679 273 HOH HOH A . F 4 HOH 180 680 55 HOH HOH A . F 4 HOH 181 681 103 HOH HOH A . F 4 HOH 182 682 41 HOH HOH A . F 4 HOH 183 683 288 HOH HOH A . F 4 HOH 184 684 329 HOH HOH A . F 4 HOH 185 685 294 HOH HOH A . F 4 HOH 186 686 341 HOH HOH A . F 4 HOH 187 687 169 HOH HOH A . F 4 HOH 188 688 189 HOH HOH A . F 4 HOH 189 689 321 HOH HOH A . F 4 HOH 190 690 21 HOH HOH A . F 4 HOH 191 691 124 HOH HOH A . F 4 HOH 192 692 202 HOH HOH A . F 4 HOH 193 693 198 HOH HOH A . F 4 HOH 194 694 100 HOH HOH A . F 4 HOH 195 695 52 HOH HOH A . F 4 HOH 196 696 260 HOH HOH A . F 4 HOH 197 697 134 HOH HOH A . F 4 HOH 198 698 17 HOH HOH A . F 4 HOH 199 699 332 HOH HOH A . F 4 HOH 200 700 147 HOH HOH A . F 4 HOH 201 701 199 HOH HOH A . F 4 HOH 202 702 259 HOH HOH A . F 4 HOH 203 703 119 HOH HOH A . F 4 HOH 204 704 125 HOH HOH A . F 4 HOH 205 705 96 HOH HOH A . F 4 HOH 206 706 86 HOH HOH A . F 4 HOH 207 707 4 HOH HOH A . F 4 HOH 208 708 22 HOH HOH A . F 4 HOH 209 709 148 HOH HOH A . F 4 HOH 210 710 65 HOH HOH A . F 4 HOH 211 711 242 HOH HOH A . F 4 HOH 212 712 252 HOH HOH A . F 4 HOH 213 713 127 HOH HOH A . F 4 HOH 214 714 204 HOH HOH A . F 4 HOH 215 715 94 HOH HOH A . F 4 HOH 216 716 33 HOH HOH A . F 4 HOH 217 717 295 HOH HOH A . F 4 HOH 218 718 261 HOH HOH A . F 4 HOH 219 719 300 HOH HOH A . F 4 HOH 220 720 323 HOH HOH A . F 4 HOH 221 721 62 HOH HOH A . F 4 HOH 222 722 123 HOH HOH A . F 4 HOH 223 723 54 HOH HOH A . F 4 HOH 224 724 143 HOH HOH A . F 4 HOH 225 725 84 HOH HOH A . F 4 HOH 226 726 210 HOH HOH A . F 4 HOH 227 727 334 HOH HOH A . F 4 HOH 228 728 72 HOH HOH A . F 4 HOH 229 729 140 HOH HOH A . F 4 HOH 230 730 301 HOH HOH A . F 4 HOH 231 731 71 HOH HOH A . F 4 HOH 232 732 268 HOH HOH A . F 4 HOH 233 733 314 HOH HOH A . F 4 HOH 234 734 262 HOH HOH A . F 4 HOH 235 735 38 HOH HOH A . F 4 HOH 236 736 144 HOH HOH A . F 4 HOH 237 737 287 HOH HOH A . F 4 HOH 238 738 64 HOH HOH A . F 4 HOH 239 739 39 HOH HOH A . F 4 HOH 240 740 122 HOH HOH A . F 4 HOH 241 741 302 HOH HOH A . F 4 HOH 242 742 248 HOH HOH A . F 4 HOH 243 743 74 HOH HOH A . F 4 HOH 244 744 230 HOH HOH A . F 4 HOH 245 745 117 HOH HOH A . F 4 HOH 246 746 213 HOH HOH A . F 4 HOH 247 747 270 HOH HOH A . F 4 HOH 248 748 149 HOH HOH A . F 4 HOH 249 749 304 HOH HOH A . F 4 HOH 250 750 150 HOH HOH A . F 4 HOH 251 751 97 HOH HOH A . F 4 HOH 252 752 146 HOH HOH A . F 4 HOH 253 753 142 HOH HOH A . F 4 HOH 254 754 344 HOH HOH A . F 4 HOH 255 755 267 HOH HOH A . F 4 HOH 256 756 80 HOH HOH A . F 4 HOH 257 757 313 HOH HOH A . F 4 HOH 258 758 240 HOH HOH A . F 4 HOH 259 759 215 HOH HOH A . F 4 HOH 260 760 224 HOH HOH A . F 4 HOH 261 761 244 HOH HOH A . F 4 HOH 262 762 138 HOH HOH A . F 4 HOH 263 763 106 HOH HOH A . F 4 HOH 264 764 89 HOH HOH A . F 4 HOH 265 765 133 HOH HOH A . F 4 HOH 266 766 81 HOH HOH A . F 4 HOH 267 767 293 HOH HOH A . F 4 HOH 268 768 238 HOH HOH A . F 4 HOH 269 769 327 HOH HOH A . F 4 HOH 270 770 277 HOH HOH A . F 4 HOH 271 771 290 HOH HOH A . F 4 HOH 272 772 36 HOH HOH A . F 4 HOH 273 773 310 HOH HOH A . F 4 HOH 274 774 107 HOH HOH A . F 4 HOH 275 775 245 HOH HOH A . F 4 HOH 276 776 328 HOH HOH A . F 4 HOH 277 777 137 HOH HOH A . F 4 HOH 278 778 342 HOH HOH A . F 4 HOH 279 779 225 HOH HOH A . F 4 HOH 280 780 307 HOH HOH A . F 4 HOH 281 781 216 HOH HOH A . F 4 HOH 282 782 151 HOH HOH A . F 4 HOH 283 783 269 HOH HOH A . F 4 HOH 284 784 91 HOH HOH A . F 4 HOH 285 785 318 HOH HOH A . F 4 HOH 286 786 73 HOH HOH A . F 4 HOH 287 787 61 HOH HOH A . F 4 HOH 288 788 110 HOH HOH A . F 4 HOH 289 789 95 HOH HOH A . F 4 HOH 290 790 234 HOH HOH A . F 4 HOH 291 791 306 HOH HOH A . F 4 HOH 292 792 53 HOH HOH A . F 4 HOH 293 793 43 HOH HOH A . F 4 HOH 294 794 196 HOH HOH A . F 4 HOH 295 795 340 HOH HOH A . F 4 HOH 296 796 331 HOH HOH A . F 4 HOH 297 797 284 HOH HOH A . F 4 HOH 298 798 57 HOH HOH A . F 4 HOH 299 799 233 HOH HOH A . F 4 HOH 300 800 190 HOH HOH A . F 4 HOH 301 801 101 HOH HOH A . F 4 HOH 302 802 272 HOH HOH A . F 4 HOH 303 803 141 HOH HOH A . F 4 HOH 304 804 31 HOH HOH A . F 4 HOH 305 805 333 HOH HOH A . F 4 HOH 306 806 188 HOH HOH A . F 4 HOH 307 807 26 HOH HOH A . F 4 HOH 308 808 129 HOH HOH A . F 4 HOH 309 809 82 HOH HOH A . F 4 HOH 310 810 256 HOH HOH A . F 4 HOH 311 811 255 HOH HOH A . F 4 HOH 312 812 194 HOH HOH A . F 4 HOH 313 813 296 HOH HOH A . F 4 HOH 314 814 298 HOH HOH A . F 4 HOH 315 815 311 HOH HOH A . F 4 HOH 316 816 126 HOH HOH A . F 4 HOH 317 817 276 HOH HOH A . F 4 HOH 318 818 222 HOH HOH A . F 4 HOH 319 819 90 HOH HOH A . F 4 HOH 320 820 145 HOH HOH A . F 4 HOH 321 821 274 HOH HOH A . F 4 HOH 322 822 339 HOH HOH A . F 4 HOH 323 823 104 HOH HOH A . F 4 HOH 324 824 63 HOH HOH A . F 4 HOH 325 825 324 HOH HOH A . F 4 HOH 326 826 28 HOH HOH A . F 4 HOH 327 827 309 HOH HOH A . F 4 HOH 328 828 128 HOH HOH A . F 4 HOH 329 829 335 HOH HOH A . F 4 HOH 330 830 303 HOH HOH A . F 4 HOH 331 831 251 HOH HOH A . F 4 HOH 332 832 208 HOH HOH A . F 4 HOH 333 833 325 HOH HOH A . F 4 HOH 334 834 320 HOH HOH A . F 4 HOH 335 835 299 HOH HOH A . F 4 HOH 336 836 275 HOH HOH A . F 4 HOH 337 837 185 HOH HOH A . F 4 HOH 338 838 220 HOH HOH A . F 4 HOH 339 839 214 HOH HOH A . F 4 HOH 340 840 291 HOH HOH A . F 4 HOH 341 841 319 HOH HOH A . F 4 HOH 342 842 343 HOH HOH A . F 4 HOH 343 843 152 HOH HOH A . F 4 HOH 344 844 297 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 567 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A THR 16 ? A THR 121 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 OD1 ? A ASP 260 ? A ASP 365 ? 1_555 80.5 ? 2 O ? A THR 16 ? A THR 121 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 OD2 ? A ASP 260 ? A ASP 365 ? 1_555 127.9 ? 3 OD1 ? A ASP 260 ? A ASP 365 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 OD2 ? A ASP 260 ? A ASP 365 ? 1_555 54.9 ? 4 O ? A THR 16 ? A THR 121 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 625 ? 1_555 89.0 ? 5 OD1 ? A ASP 260 ? A ASP 365 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 625 ? 1_555 88.3 ? 6 OD2 ? A ASP 260 ? A ASP 365 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 625 ? 1_555 66.5 ? 7 O ? A THR 16 ? A THR 121 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 662 ? 1_555 157.9 ? 8 OD1 ? A ASP 260 ? A ASP 365 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 662 ? 1_555 121.6 ? 9 OD2 ? A ASP 260 ? A ASP 365 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 662 ? 1_555 72.0 ? 10 O ? F HOH . ? A HOH 625 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 662 ? 1_555 91.9 ? 11 O ? A THR 16 ? A THR 121 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 675 ? 1_555 97.6 ? 12 OD1 ? A ASP 260 ? A ASP 365 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 675 ? 1_555 76.4 ? 13 OD2 ? A ASP 260 ? A ASP 365 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 675 ? 1_555 96.6 ? 14 O ? F HOH . ? A HOH 625 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 675 ? 1_555 162.1 ? 15 O ? F HOH . ? A HOH 662 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 675 ? 1_555 88.3 ? 16 O ? A THR 16 ? A THR 121 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 713 ? 1_555 78.3 ? 17 OD1 ? A ASP 260 ? A ASP 365 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 713 ? 1_555 158.8 ? 18 OD2 ? A ASP 260 ? A ASP 365 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 713 ? 1_555 143.5 ? 19 O ? F HOH . ? A HOH 625 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 713 ? 1_555 92.4 ? 20 O ? F HOH . ? A HOH 662 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 713 ? 1_555 79.6 ? 21 O ? F HOH . ? A HOH 675 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 713 ? 1_555 105.2 ? 22 O ? A PRO 175 ? A PRO 280 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? A VAL 177 ? A VAL 282 ? 1_555 87.6 ? 23 O ? A PRO 175 ? A PRO 280 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD1 ? A ASP 200 ? A ASP 305 ? 1_555 147.8 ? 24 O ? A VAL 177 ? A VAL 282 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD1 ? A ASP 200 ? A ASP 305 ? 1_555 115.0 ? 25 O ? A PRO 175 ? A PRO 280 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD2 ? A ASP 200 ? A ASP 305 ? 1_555 159.3 ? 26 O ? A VAL 177 ? A VAL 282 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD2 ? A ASP 200 ? A ASP 305 ? 1_555 83.0 ? 27 OD1 ? A ASP 200 ? A ASP 305 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD2 ? A ASP 200 ? A ASP 305 ? 1_555 52.1 ? 28 O ? A PRO 175 ? A PRO 280 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 558 ? 1_555 97.2 ? 29 O ? A VAL 177 ? A VAL 282 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 558 ? 1_555 143.2 ? 30 OD1 ? A ASP 200 ? A ASP 305 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 558 ? 1_555 78.5 ? 31 OD2 ? A ASP 200 ? A ASP 305 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 558 ? 1_555 80.0 ? 32 O ? A PRO 175 ? A PRO 280 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 592 ? 1_555 82.3 ? 33 O ? A VAL 177 ? A VAL 282 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 592 ? 1_555 71.6 ? 34 OD1 ? A ASP 200 ? A ASP 305 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 592 ? 1_555 125.3 ? 35 OD2 ? A ASP 200 ? A ASP 305 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 592 ? 1_555 77.3 ? 36 O ? F HOH . ? A HOH 558 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 592 ? 1_555 73.0 ? 37 O ? A PRO 175 ? A PRO 280 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 648 ? 1_555 71.7 ? 38 O ? A VAL 177 ? A VAL 282 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 648 ? 1_555 139.9 ? 39 OD1 ? A ASP 200 ? A ASP 305 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 648 ? 1_555 76.4 ? 40 OD2 ? A ASP 200 ? A ASP 305 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 648 ? 1_555 126.2 ? 41 O ? F HOH . ? A HOH 558 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 648 ? 1_555 74.9 ? 42 O ? F HOH . ? A HOH 592 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 648 ? 1_555 135.2 ? 43 O ? A PRO 175 ? A PRO 280 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 651 ? 1_555 91.2 ? 44 O ? A VAL 177 ? A VAL 282 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 651 ? 1_555 71.0 ? 45 OD1 ? A ASP 200 ? A ASP 305 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 651 ? 1_555 76.3 ? 46 OD2 ? A ASP 200 ? A ASP 305 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 651 ? 1_555 102.9 ? 47 O ? F HOH . ? A HOH 558 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 651 ? 1_555 144.8 ? 48 O ? F HOH . ? A HOH 592 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 651 ? 1_555 142.2 ? 49 O ? F HOH . ? A HOH 648 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O ? F HOH . ? A HOH 651 ? 1_555 75.4 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-03-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? 'Paul D. Adams' pdadams@lbl.gov ? ? ? ? Python/C++ https://www.phenix-online.org/ ? phenix.refine ? ? program 1.20.1_4487 1 ? refinement ? ? 'Paul D. Adams' pdadams@lbl.gov ? ? ? ? Python/C++ https://www.phenix-online.org/ ? PHENIX ? ? program 1.20.1_4487 2 # _pdbx_entry_details.entry_id 8FYR _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 8FYR _em_3d_fitting.method ? _em_3d_fitting.target_criteria 'Maximum likelihood' _em_3d_fitting.details ? _em_3d_fitting.overall_b_value 9.69 _em_3d_fitting.ref_space RECIPROCAL _em_3d_fitting.ref_protocol 'AB INITIO MODEL' # _em_3d_reconstruction.entry_id 8FYR _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm 'FOURIER SPACE' _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 1.5 _em_3d_reconstruction.resolution_method 'DIFFRACTION PATTERN/LAYERLINES' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles ? _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type '3D CRYSTAL' # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details ? _em_buffer.pH 7.5 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source NATURAL _em_entity_assembly.type COMPLEX _em_entity_assembly.name 'Proteinase K' _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_image_scans.entry_id 8FYR _em_image_scans.id 1 _em_image_scans.number_digital_images ? _em_image_scans.details ? _em_image_scans.scanner_model ? _em_image_scans.sampling_size 28 _em_image_scans.od_range ? _em_image_scans.quant_bit_size ? _em_image_scans.citation_id ? _em_image_scans.dimension_height 2048 _em_image_scans.dimension_width 2048 _em_image_scans.frames_per_image ? _em_image_scans.image_recording_id 1 _em_image_scans.used_frames_per_image ? # _em_imaging.entry_id 8FYR _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 300 _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.mode DIFFRACTION _em_imaging.nominal_cs 2.7 _em_imaging.nominal_defocus_min 0 _em_imaging.nominal_defocus_max 0 _em_imaging.calibrated_defocus_min 0 _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum 77 _em_imaging.recording_temperature_maximum 90 _em_imaging.alignment_procedure BASIC _em_imaging.c2_aperture_diameter 50.0 _em_imaging.specimen_id 1 _em_imaging.cryogen NITROGEN # _em_sample_support.id 1 _em_sample_support.film_material ? _em_sample_support.method ? _em_sample_support.grid_material ? _em_sample_support.grid_mesh_size ? _em_sample_support.grid_type 'Quantifoil R2/2' _em_sample_support.details ? _em_sample_support.specimen_id 1 _em_sample_support.citation_id ? # _em_vitrification.entry_id 8FYR _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity 95 _em_vitrification.temp ? _em_vitrification.chamber_temperature 277 _em_vitrification.instrument 'LEICA PLUNGER' _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 8FYR _em_experiment.id 1 _em_experiment.reconstruction_method CRYSTALLOGRAPHY _em_experiment.aggregation_state '3D ARRAY' _em_experiment.entity_assembly_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 727 ? ? O A HOH 780 ? ? 1.88 2 1 O A HOH 746 ? ? O A HOH 794 ? ? 1.88 3 1 O A HOH 829 ? ? O A HOH 834 ? ? 1.93 4 1 O A HOH 607 ? ? O A HOH 730 ? ? 1.97 5 1 O A HOH 834 ? ? O A HOH 841 ? ? 2.02 6 1 O A HOH 818 ? ? O A HOH 832 ? ? 2.03 7 1 O A HOH 677 ? ? O A HOH 757 ? ? 2.03 8 1 O A HOH 645 ? ? O A HOH 689 ? ? 2.03 9 1 O A HOH 670 ? ? O A HOH 779 ? ? 2.06 10 1 O A HOH 585 ? ? O A HOH 733 ? ? 2.07 11 1 O A HOH 827 ? ? O A HOH 833 ? ? 2.16 12 1 NH1 A ARG 290 ? ? O A HOH 501 ? ? 2.16 13 1 O A HOH 527 ? ? O A HOH 672 ? ? 2.18 14 1 O A HOH 661 ? ? O A HOH 729 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 719 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 844 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_444 _pdbx_validate_symm_contact.dist 1.88 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 144 ? ? -163.33 -145.60 2 1 ASN A 375 ? ? -106.27 72.54 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 838 ? 5.86 . 2 1 O ? A HOH 839 ? 5.87 . 3 1 O ? A HOH 840 ? 6.14 . 4 1 O ? A HOH 841 ? 6.15 . 5 1 O ? A HOH 842 ? 6.30 . 6 1 O ? A HOH 843 ? 6.51 . 7 1 O ? A HOH 844 ? 7.70 . # _em_3d_crystal_entity.angle_alpha 90 _em_3d_crystal_entity.angle_beta 90 _em_3d_crystal_entity.angle_gamma 90 _em_3d_crystal_entity.image_processing_id 1 _em_3d_crystal_entity.id 1 _em_3d_crystal_entity.length_a 67.26 _em_3d_crystal_entity.length_b 67.26 _em_3d_crystal_entity.length_c 106.81 _em_3d_crystal_entity.space_group_name 96 _em_3d_crystal_entity.space_group_num 96 # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type NONE # _em_diffraction.camera_length 1202 _em_diffraction.id 1 _em_diffraction.imaging_id 1 _em_diffraction.tilt_angle_list -30,30 # _em_diffraction_shell.em_diffraction_stats_id 1 _em_diffraction_shell.fourier_space_coverage 37.64 _em_diffraction_shell.high_resolution 0.87 _em_diffraction_shell.id 1 _em_diffraction_shell.low_resolution 0.90 _em_diffraction_shell.multiplicity 2.1 _em_diffraction_shell.num_structure_factors 2783 _em_diffraction_shell.phase_residual 30 # _em_diffraction_stats.details ? _em_diffraction_stats.fourier_space_coverage 87.58 _em_diffraction_stats.high_resolution 0.87 _em_diffraction_stats.id 1 _em_diffraction_stats.image_processing_id 1 _em_diffraction_stats.num_intensities_measured 569407 _em_diffraction_stats.num_structure_factors 64974 _em_diffraction_stats.overall_phase_error 30 _em_diffraction_stats.overall_phase_residual ? _em_diffraction_stats.phase_error_rejection_criteria None _em_diffraction_stats.r_merge 0.236 _em_diffraction_stats.r_sym 0.073 # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.units MEGADALTONS _em_entity_assembly_molwt.value 0.0289 # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 37998 _em_entity_assembly_naturalsource.organism 'Parengyodontium album' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_image_processing.details 'Binned by 2' _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time 0.5 _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 0.001 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'FEI FALCON IV (4k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images 840 _em_image_recording.num_grids_imaged 1 _em_image_recording.num_real_images 1 # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version 'IMAGE ACQUISITION' ? 1 ? ? 1 ? ? MASKING ? 2 ? ? ? ? ? 'CTF CORRECTION' ? 3 1 ? ? ? ? 'LAYERLINE INDEXING' ? 4 ? ? ? ? ? 'DIFFRACTION INDEXING' ? 5 ? ? ? ? ? 'MODEL FITTING' ? 6 ? 1 ? ? ? OTHER ? 7 ? ? ? ? ? 'MOLECULAR REPLACEMENT' ? 8 1 ? ? ? ? 'LATTICE DISTORTION CORRECTION' ? 9 1 ? ? ? ? 'SYMMETRY DETERMINATION' ? 10 1 ? ? ? ? 'CRYSTALLOGRAPHY MERGING' ? 11 1 ? ? AIMLESS ? RECONSTRUCTION ? 12 1 ? ? ? ? 'MODEL REFINEMENT' ? 13 ? 1 ? ? ? # _em_specimen.concentration 5 _em_specimen.details 'Milled microcrystals' _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Howard Hughes Medical Institute (HHMI)' 'United States' ? 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' P41GM136508 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NITRATE ION' NO3 3 'CALCIUM ION' CA 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 #