data_8G0P # _entry.id 8G0P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.368 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8G0P pdb_00008g0p 10.2210/pdb8g0p/pdb WWPDB D_1000271067 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8G0P _pdbx_database_status.recvd_initial_deposition_date 2023-02-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zahm, J.A.' 1 0000-0002-9600-5433 'Jenni, S.' 2 0000-0001-5722-5890 'Harrison, S.C.' 3 0000-0001-7215-9393 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Open Biology' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2046-2441 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 220378 _citation.page_last 220378 _citation.title 'Structure of the Ndc80 complex and its interactions at the yeast kinetochore-microtubule interface.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1098/rsob.220378 _citation.pdbx_database_id_PubMed 36883282 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zahm, J.A.' 1 0000-0002-9600-5433 primary 'Jenni, S.' 2 0000-0001-5722-5890 primary 'Harrison, S.C.' 3 0000-0001-7215-9393 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 98.560 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8G0P _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.903 _cell.length_a_esd ? _cell.length_b 72.259 _cell.length_b_esd ? _cell.length_c 80.065 _cell.length_c_esd ? _cell.volume 285493.585 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8G0P _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Kinetochore protein NDC80 homolog' 16652.008 1 ? ? ? ? 2 polymer man 'Kinetochore protein Nuf2' 11567.251 1 ? ? ? ? 3 water nat water 18.015 13 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;Highly expressed in cancer protein,Kinetochore protein Hec1,HsHec1,Kinetochore-associated protein 2,Retinoblastoma-associated protein HEC ; 2 'hNuf2,hNuf2R,hsNuf2,Cell division cycle-associated protein 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SCNHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGA NCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTLKEEVQKC ; ;SCNHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGA NCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTLKEEVQKC ; A ? 2 'polypeptide(L)' no no ;CKNYKEKMKDTVQKLKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESE LKKLKTEENSFKRLMIVC ; ;CKNYKEKMKDTVQKLKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESE LKKLKTEENSFKRLMIVC ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 CYS n 1 3 ASN n 1 4 HIS n 1 5 GLU n 1 6 ARG n 1 7 ASN n 1 8 GLU n 1 9 LEU n 1 10 GLN n 1 11 GLN n 1 12 THR n 1 13 ILE n 1 14 ASN n 1 15 LYS n 1 16 LEU n 1 17 THR n 1 18 LYS n 1 19 ASP n 1 20 LEU n 1 21 GLU n 1 22 ALA n 1 23 GLU n 1 24 GLN n 1 25 GLN n 1 26 LYS n 1 27 LEU n 1 28 TRP n 1 29 ASN n 1 30 GLU n 1 31 GLU n 1 32 LEU n 1 33 LYS n 1 34 TYR n 1 35 ALA n 1 36 ARG n 1 37 GLY n 1 38 LYS n 1 39 GLU n 1 40 ALA n 1 41 ILE n 1 42 GLU n 1 43 THR n 1 44 GLN n 1 45 LEU n 1 46 ALA n 1 47 GLU n 1 48 TYR n 1 49 HIS n 1 50 LYS n 1 51 LEU n 1 52 ALA n 1 53 ARG n 1 54 LYS n 1 55 LEU n 1 56 LYS n 1 57 LEU n 1 58 ILE n 1 59 PRO n 1 60 LYS n 1 61 GLY n 1 62 ALA n 1 63 GLU n 1 64 ASN n 1 65 SER n 1 66 LYS n 1 67 GLY n 1 68 TYR n 1 69 ASP n 1 70 PHE n 1 71 GLU n 1 72 ILE n 1 73 LYS n 1 74 PHE n 1 75 ASN n 1 76 PRO n 1 77 GLU n 1 78 ALA n 1 79 GLY n 1 80 ALA n 1 81 ASN n 1 82 CYS n 1 83 LEU n 1 84 VAL n 1 85 LYS n 1 86 TYR n 1 87 ARG n 1 88 ALA n 1 89 GLN n 1 90 VAL n 1 91 TYR n 1 92 VAL n 1 93 PRO n 1 94 LEU n 1 95 LYS n 1 96 GLU n 1 97 LEU n 1 98 LEU n 1 99 ASN n 1 100 GLU n 1 101 THR n 1 102 GLU n 1 103 GLU n 1 104 GLU n 1 105 ILE n 1 106 ASN n 1 107 LYS n 1 108 ALA n 1 109 LEU n 1 110 ASN n 1 111 LYS n 1 112 LYS n 1 113 MET n 1 114 GLY n 1 115 LEU n 1 116 GLU n 1 117 ASP n 1 118 THR n 1 119 LEU n 1 120 GLU n 1 121 GLN n 1 122 LEU n 1 123 ASN n 1 124 ALA n 1 125 MET n 1 126 ILE n 1 127 THR n 1 128 GLU n 1 129 SER n 1 130 LYS n 1 131 ARG n 1 132 SER n 1 133 VAL n 1 134 ARG n 1 135 THR n 1 136 LEU n 1 137 LYS n 1 138 GLU n 1 139 GLU n 1 140 VAL n 1 141 GLN n 1 142 LYS n 1 143 CYS n 2 1 CYS n 2 2 LYS n 2 3 ASN n 2 4 TYR n 2 5 LYS n 2 6 GLU n 2 7 LYS n 2 8 MET n 2 9 LYS n 2 10 ASP n 2 11 THR n 2 12 VAL n 2 13 GLN n 2 14 LYS n 2 15 LEU n 2 16 LYS n 2 17 ASN n 2 18 ALA n 2 19 ARG n 2 20 GLN n 2 21 GLU n 2 22 VAL n 2 23 VAL n 2 24 GLU n 2 25 LYS n 2 26 TYR n 2 27 GLU n 2 28 ILE n 2 29 TYR n 2 30 GLY n 2 31 ASP n 2 32 SER n 2 33 VAL n 2 34 ASP n 2 35 CYS n 2 36 LEU n 2 37 PRO n 2 38 SER n 2 39 CYS n 2 40 GLN n 2 41 LEU n 2 42 GLU n 2 43 VAL n 2 44 GLN n 2 45 LEU n 2 46 TYR n 2 47 GLN n 2 48 LYS n 2 49 LYS n 2 50 ILE n 2 51 GLN n 2 52 ASP n 2 53 LEU n 2 54 SER n 2 55 ASP n 2 56 ASN n 2 57 ARG n 2 58 GLU n 2 59 LYS n 2 60 LEU n 2 61 ALA n 2 62 SER n 2 63 ILE n 2 64 LEU n 2 65 LYS n 2 66 GLU n 2 67 SER n 2 68 LEU n 2 69 ASN n 2 70 LEU n 2 71 GLU n 2 72 ASP n 2 73 GLN n 2 74 ILE n 2 75 GLU n 2 76 SER n 2 77 ASP n 2 78 GLU n 2 79 SER n 2 80 GLU n 2 81 LEU n 2 82 LYS n 2 83 LYS n 2 84 LEU n 2 85 LYS n 2 86 THR n 2 87 GLU n 2 88 GLU n 2 89 ASN n 2 90 SER n 2 91 PHE n 2 92 LYS n 2 93 ARG n 2 94 LEU n 2 95 MET n 2 96 ILE n 2 97 VAL n 2 98 CYS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 143 human ? 'NDC80, HEC, HEC1, KNTC2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 98 human ? 'NUF2, CDCA1, NUF2R' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP NDC80_HUMAN O14777 ? 1 ;NHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANC LVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTLKEEVQK ; 370 2 UNP NUF2_HUMAN Q9BZD4 ? 2 ;KNYKEKMKDTVQKLKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESEL KKLKTEENSFKRLMIV ; 252 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8G0P A 3 ? 142 ? O14777 370 ? 509 ? 3 142 2 2 8G0P B 2 ? 97 ? Q9BZD4 252 ? 347 ? 2 97 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8G0P SER A 1 ? UNP O14777 ? ? 'expression tag' 1 1 1 8G0P CYS A 2 ? UNP O14777 ? ? 'expression tag' 2 2 1 8G0P CYS A 143 ? UNP O14777 ? ? 'cloning artifact' 143 3 2 8G0P CYS B 1 ? UNP Q9BZD4 ? ? 'expression tag' 1 4 2 8G0P CYS B 98 ? UNP Q9BZD4 ? ? 'cloning artifact' 98 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8G0P _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.53 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.37 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% (w/v) polyethylene glycol 4000, 0.1 M TRIS pH 8.6, and 0.2 M magnesium chloride' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-06-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97910 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97910 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 47.10 _reflns.entry_id 8G0P _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.84 _reflns.d_resolution_low 40.75 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 36742 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.132 _reflns.pdbx_Rpim_I_all 0.050 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.122 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.84 _reflns_shell.d_res_low 1.87 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1005 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.7 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 4.44 _reflns_shell.pdbx_Rpim_I_all 1.82 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.33 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 84.5 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 4.03 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 70.66 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8G0P _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 40.75 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 36742 _refine.ls_number_reflns_R_free 1836 _refine.ls_number_reflns_R_work 34906 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.42 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2620 _refine.ls_R_factor_R_free 0.2968 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2600 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 39.4717 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3084 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 40.75 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1983 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1970 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0026 ? 1995 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.4562 ? 2668 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0277 ? 297 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0033 ? 346 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 3.6001 ? 260 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.00 2.05 . . 128 2440 91.39 . . . . 0.5149 . . . . . . . . . . . 0.4990 'X-RAY DIFFRACTION' 2.05 2.11 . . 131 2657 97.76 . . . . 0.4823 . . . . . . . . . . . 0.4424 'X-RAY DIFFRACTION' 2.11 2.18 . . 178 2723 99.18 . . . . 0.4476 . . . . . . . . . . . 0.4289 'X-RAY DIFFRACTION' 2.18 2.26 . . 139 2664 98.94 . . . . 0.3819 . . . . . . . . . . . 0.4039 'X-RAY DIFFRACTION' 2.26 2.35 . . 164 2655 98.22 . . . . 0.3297 . . . . . . . . . . . 0.3701 'X-RAY DIFFRACTION' 2.35 2.46 . . 155 2716 98.59 . . . . 0.3010 . . . . . . . . . . . 0.3309 'X-RAY DIFFRACTION' 2.46 2.59 . . 123 2763 99.38 . . . . 0.2836 . . . . . . . . . . . 0.3310 'X-RAY DIFFRACTION' 2.59 2.75 . . 151 2712 99.51 . . . . 0.2888 . . . . . . . . . . . 0.3623 'X-RAY DIFFRACTION' 2.75 2.96 . . 142 2686 99.40 . . . . 0.2560 . . . . . . . . . . . 0.3520 'X-RAY DIFFRACTION' 2.96 3.26 . . 111 2740 99.41 . . . . 0.2709 . . . . . . . . . . . 0.2778 'X-RAY DIFFRACTION' 3.26 3.73 . . 139 2704 98.96 . . . . 0.2515 . . . . . . . . . . . 0.3012 'X-RAY DIFFRACTION' 3.73 4.70 . . 127 2741 99.86 . . . . 0.2010 . . . . . . . . . . . 0.2109 'X-RAY DIFFRACTION' 4.70 40.75 . . 148 2705 98.72 . . . . 0.2266 . . . . . . . . . . . 0.2757 # _struct.entry_id 8G0P _struct.title 'Crystal structure of the human Ndc80:Nuf2 loop region' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8G0P _struct_keywords.text 'Cell division, chromosome segregation, kinetochore, Ndc80 complex, Ndc80, Nuf2, loop, hinge, human, CELL CYCLE' _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 3 ? LEU A 55 ? ASN A 3 LEU A 55 1 ? 53 HELX_P HELX_P2 AA2 LEU A 83 ? LYS A 85 ? LEU A 83 LYS A 85 5 ? 3 HELX_P HELX_P3 AA3 TYR A 86 ? CYS A 143 ? TYR A 86 CYS A 143 1 ? 58 HELX_P HELX_P4 AA4 LYS B 2 ? VAL B 97 ? LYS B 2 VAL B 97 1 ? 96 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 2 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 2 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 2 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 2 _struct_conn.ptnr2_symmetry 2_554 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.029 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 58 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 58 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 59 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 59 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.26 # _atom_sites.entry_id 8G0P _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020039 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003016 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013839 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012631 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 MET 125 125 125 MET MET A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 CYS 143 143 143 CYS CYS A . n B 2 1 CYS 1 1 1 CYS CYS B . n B 2 2 LYS 2 2 2 LYS LYS B . n B 2 3 ASN 3 3 3 ASN ASN B . n B 2 4 TYR 4 4 4 TYR TYR B . n B 2 5 LYS 5 5 5 LYS LYS B . n B 2 6 GLU 6 6 6 GLU GLU B . n B 2 7 LYS 7 7 7 LYS LYS B . n B 2 8 MET 8 8 8 MET MET B . n B 2 9 LYS 9 9 9 LYS LYS B . n B 2 10 ASP 10 10 10 ASP ASP B . n B 2 11 THR 11 11 11 THR THR B . n B 2 12 VAL 12 12 12 VAL VAL B . n B 2 13 GLN 13 13 13 GLN GLN B . n B 2 14 LYS 14 14 14 LYS LYS B . n B 2 15 LEU 15 15 15 LEU LEU B . n B 2 16 LYS 16 16 16 LYS LYS B . n B 2 17 ASN 17 17 17 ASN ASN B . n B 2 18 ALA 18 18 18 ALA ALA B . n B 2 19 ARG 19 19 19 ARG ARG B . n B 2 20 GLN 20 20 20 GLN GLN B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 VAL 22 22 22 VAL VAL B . n B 2 23 VAL 23 23 23 VAL VAL B . n B 2 24 GLU 24 24 24 GLU GLU B . n B 2 25 LYS 25 25 25 LYS LYS B . n B 2 26 TYR 26 26 26 TYR TYR B . n B 2 27 GLU 27 27 27 GLU GLU B . n B 2 28 ILE 28 28 28 ILE ILE B . n B 2 29 TYR 29 29 29 TYR TYR B . n B 2 30 GLY 30 30 30 GLY GLY B . n B 2 31 ASP 31 31 31 ASP ASP B . n B 2 32 SER 32 32 32 SER SER B . n B 2 33 VAL 33 33 33 VAL VAL B . n B 2 34 ASP 34 34 34 ASP ASP B . n B 2 35 CYS 35 35 35 CYS CYS B . n B 2 36 LEU 36 36 36 LEU LEU B . n B 2 37 PRO 37 37 37 PRO PRO B . n B 2 38 SER 38 38 38 SER SER B . n B 2 39 CYS 39 39 39 CYS CYS B . n B 2 40 GLN 40 40 40 GLN GLN B . n B 2 41 LEU 41 41 41 LEU LEU B . n B 2 42 GLU 42 42 42 GLU GLU B . n B 2 43 VAL 43 43 43 VAL VAL B . n B 2 44 GLN 44 44 44 GLN GLN B . n B 2 45 LEU 45 45 45 LEU LEU B . n B 2 46 TYR 46 46 46 TYR TYR B . n B 2 47 GLN 47 47 47 GLN GLN B . n B 2 48 LYS 48 48 48 LYS LYS B . n B 2 49 LYS 49 49 49 LYS LYS B . n B 2 50 ILE 50 50 50 ILE ILE B . n B 2 51 GLN 51 51 51 GLN GLN B . n B 2 52 ASP 52 52 52 ASP ASP B . n B 2 53 LEU 53 53 53 LEU LEU B . n B 2 54 SER 54 54 54 SER SER B . n B 2 55 ASP 55 55 55 ASP ASP B . n B 2 56 ASN 56 56 56 ASN ASN B . n B 2 57 ARG 57 57 57 ARG ARG B . n B 2 58 GLU 58 58 58 GLU GLU B . n B 2 59 LYS 59 59 59 LYS LYS B . n B 2 60 LEU 60 60 60 LEU LEU B . n B 2 61 ALA 61 61 61 ALA ALA B . n B 2 62 SER 62 62 62 SER SER B . n B 2 63 ILE 63 63 63 ILE ILE B . n B 2 64 LEU 64 64 64 LEU LEU B . n B 2 65 LYS 65 65 65 LYS LYS B . n B 2 66 GLU 66 66 66 GLU GLU B . n B 2 67 SER 67 67 67 SER SER B . n B 2 68 LEU 68 68 68 LEU LEU B . n B 2 69 ASN 69 69 69 ASN ASN B . n B 2 70 LEU 70 70 70 LEU LEU B . n B 2 71 GLU 71 71 71 GLU GLU B . n B 2 72 ASP 72 72 72 ASP ASP B . n B 2 73 GLN 73 73 73 GLN GLN B . n B 2 74 ILE 74 74 74 ILE ILE B . n B 2 75 GLU 75 75 75 GLU GLU B . n B 2 76 SER 76 76 76 SER SER B . n B 2 77 ASP 77 77 77 ASP ASP B . n B 2 78 GLU 78 78 78 GLU GLU B . n B 2 79 SER 79 79 79 SER SER B . n B 2 80 GLU 80 80 80 GLU GLU B . n B 2 81 LEU 81 81 81 LEU LEU B . n B 2 82 LYS 82 82 82 LYS LYS B . n B 2 83 LYS 83 83 83 LYS LYS B . n B 2 84 LEU 84 84 84 LEU LEU B . n B 2 85 LYS 85 85 85 LYS LYS B . n B 2 86 THR 86 86 86 THR THR B . n B 2 87 GLU 87 87 87 GLU GLU B . n B 2 88 GLU 88 88 88 GLU GLU B . n B 2 89 ASN 89 89 89 ASN ASN B . n B 2 90 SER 90 90 90 SER SER B . n B 2 91 PHE 91 91 91 PHE PHE B . n B 2 92 LYS 92 92 92 LYS LYS B . n B 2 93 ARG 93 93 93 ARG ARG B . n B 2 94 LEU 94 94 94 LEU LEU B . n B 2 95 MET 95 95 95 MET MET B . n B 2 96 ILE 96 96 96 ILE ILE B . n B 2 97 VAL 97 97 97 VAL VAL B . n B 2 98 CYS 98 98 98 CYS CYS B . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email harrison@crystal.harvard.edu _pdbx_contact_author.name_first Stephen _pdbx_contact_author.name_last Harrison _pdbx_contact_author.name_mi C. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7215-9393 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 201 2 HOH HOH A . C 3 HOH 2 202 5 HOH HOH A . C 3 HOH 3 203 8 HOH HOH A . C 3 HOH 4 204 7 HOH HOH A . C 3 HOH 5 205 1 HOH HOH A . C 3 HOH 6 206 3 HOH HOH A . C 3 HOH 7 207 11 HOH HOH A . C 3 HOH 8 208 9 HOH HOH A . D 3 HOH 1 101 12 HOH HOH B . D 3 HOH 2 102 13 HOH HOH B . D 3 HOH 3 103 6 HOH HOH B . D 3 HOH 4 104 4 HOH HOH B . D 3 HOH 5 105 10 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6150 ? 1 MORE -67 ? 1 'SSA (A^2)' 16120 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-03-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -15.5160948454 _pdbx_refine_tls.origin_y 3.20932480929 _pdbx_refine_tls.origin_z 29.4258775818 _pdbx_refine_tls.T[1][1] 0.673901053404 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0321103241127 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0158146086533 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.687879151338 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0450110512032 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.558401897984 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] -0.0061328170901 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.314891142814 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.787308253579 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.287526116768 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.979972770059 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.84164670038 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.166046357282 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.026156265894 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0729343219773 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.184470327445 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0145180593242 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0810856715833 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.614391857945 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0566112890914 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0153445629062 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id B _pdbx_refine_tls_group.end_label_seq_id 98 _pdbx_refine_tls_group.end_auth_asym_id B _pdbx_refine_tls_group.end_auth_seq_id 98 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 B ASP 55 ? ? O B HOH 101 ? ? 2.05 2 1 O A GLU 31 ? ? O A HOH 201 ? ? 2.13 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 23 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NZ _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 LYS _pdbx_validate_symm_contact.auth_seq_id_2 33 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_555 _pdbx_validate_symm_contact.dist 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 3 ? ? -128.30 -51.97 2 1 GLU A 5 ? ? -57.98 -70.56 3 1 PRO A 59 ? ? -78.46 -166.03 4 1 GLU A 77 ? ? 54.08 97.84 5 1 ASN A 81 ? ? 65.69 74.40 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' GM124165 1 'Department of Energy (DOE, United States)' 'United States' DE-AC02-06CH11357 2 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 #