data_8GQO # _entry.id 8GQO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8GQO pdb_00008gqo 10.2210/pdb8gqo/pdb WWPDB D_1300030242 ? ? BMRB 50469 ? 10.13018/BMR50469 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-09-06 2 'Structure model' 1 1 2023-09-20 3 'Structure model' 1 2 2023-11-22 4 'Structure model' 1 3 2024-02-14 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Source and taxonomy' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' struct 4 3 'Structure model' citation 5 3 'Structure model' citation_author 6 4 'Structure model' entity_src_gen 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation.year' 7 2 'Structure model' '_struct.title' 8 3 'Structure model' '_citation.journal_volume' 9 3 'Structure model' '_citation.page_first' 10 3 'Structure model' '_citation.page_last' 11 3 'Structure model' '_citation.pdbx_database_id_DOI' 12 3 'Structure model' '_citation.pdbx_database_id_PubMed' 13 3 'Structure model' '_citation_author.identifier_ORCID' 14 3 'Structure model' '_citation_author.name' 15 4 'Structure model' '_entity_src_gen.gene_src_common_name' 16 4 'Structure model' '_entity_src_gen.gene_src_strain' 17 4 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 18 4 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 19 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8GQO _pdbx_database_status.recvd_initial_deposition_date 2022-08-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category CASD-NMR _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 50469 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email tzougate@gate.sinica.edu.tw _pdbx_contact_author.name_first Der-Lii _pdbx_contact_author.name_last Tzou _pdbx_contact_author.name_mi M. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3755-8230 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tsai, M.H.' 1 0000-0002-4123-209X 'Wu, D.N.' 2 0000-0003-3834-8937 'Tzou, D.L.M.' 3 0000-0002-3755-8230 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos Pathog.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1553-7374 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 19 _citation.language ? _citation.page_first e1011500 _citation.page_last e1011500 _citation.title ;Structural and functional analysis of vaccinia viral fusion complex component protein A28 through NMR and molecular dynamic simulations. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1011500 _citation.pdbx_database_id_PubMed 37948471 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kao, C.F.' 1 ? primary 'Tsai, M.H.' 2 ? primary 'Carillo, K.J.' 3 ? primary 'Tzou, D.L.' 4 ? primary 'Chang, W.' 5 0000-0003-3369-083X # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Envelope protein A28' _entity.formula_weight 13724.424 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;IMV MP/virus entry protein,IMV membrane protein,Integral component of the virus entry-fusion complex,Integral component of the virus entry/fusion complex,Integral component of virus entry/fusion complex protein,Putative signal peptide ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSGIEGRATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIR KFNTMQQCIDFTFSDVININIYNPCVVPNINNAECQFLKSVL ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSGIEGRATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIR KFNTMQQCIDFTFSDVININIYNPCVVPNINNAECQFLKSVL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 GLY n 1 10 ILE n 1 11 GLU n 1 12 GLY n 1 13 ARG n 1 14 ALA n 1 15 THR n 1 16 HIS n 1 17 ALA n 1 18 ALA n 1 19 PHE n 1 20 GLU n 1 21 TYR n 1 22 SER n 1 23 LYS n 1 24 SER n 1 25 ILE n 1 26 GLY n 1 27 GLY n 1 28 THR n 1 29 PRO n 1 30 ALA n 1 31 LEU n 1 32 ASP n 1 33 ARG n 1 34 ARG n 1 35 VAL n 1 36 GLN n 1 37 ASP n 1 38 VAL n 1 39 ASN n 1 40 ASP n 1 41 THR n 1 42 ILE n 1 43 SER n 1 44 ASP n 1 45 VAL n 1 46 LYS n 1 47 GLN n 1 48 LYS n 1 49 TRP n 1 50 ARG n 1 51 CYS n 1 52 VAL n 1 53 VAL n 1 54 TYR n 1 55 PRO n 1 56 GLY n 1 57 ASN n 1 58 GLY n 1 59 PHE n 1 60 VAL n 1 61 SER n 1 62 ALA n 1 63 SER n 1 64 ILE n 1 65 PHE n 1 66 GLY n 1 67 PHE n 1 68 GLN n 1 69 ALA n 1 70 GLU n 1 71 VAL n 1 72 GLY n 1 73 PRO n 1 74 ASN n 1 75 ASN n 1 76 THR n 1 77 ARG n 1 78 SER n 1 79 ILE n 1 80 ARG n 1 81 LYS n 1 82 PHE n 1 83 ASN n 1 84 THR n 1 85 MET n 1 86 GLN n 1 87 GLN n 1 88 CYS n 1 89 ILE n 1 90 ASP n 1 91 PHE n 1 92 THR n 1 93 PHE n 1 94 SER n 1 95 ASP n 1 96 VAL n 1 97 ILE n 1 98 ASN n 1 99 ILE n 1 100 ASN n 1 101 ILE n 1 102 TYR n 1 103 ASN n 1 104 PRO n 1 105 CYS n 1 106 VAL n 1 107 VAL n 1 108 PRO n 1 109 ASN n 1 110 ILE n 1 111 ASN n 1 112 ASN n 1 113 ALA n 1 114 GLU n 1 115 CYS n 1 116 GLN n 1 117 PHE n 1 118 LEU n 1 119 LYS n 1 120 SER n 1 121 VAL n 1 122 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 122 _entity_src_gen.gene_src_common_name VACV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;A28L, VACV_BRZ_SERRO2_149, VACV_CTGV_ALEH2_151, VACV_CTGV_CG04_151, VACV_CTGV_MI233-151, VACV_CTGV_VI04_151, 44/47.1_rMVA_142, 51.1rMVA_164, 51.2rMVA_149, IKMOJFFE_00136, List144, LIVPclone14_158, VAC_IHDW1_152, VAC_TKT3_141, VAC_TKT4_141, VACV_CTGV_CM01_151, VACV_IOC_B141_176, Vv.00g001400 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'WR (western reserve)' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vaccinia virus (strain Western Reserve)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10254 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-21a(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -12 ? ? ? A . n A 1 2 HIS 2 -11 ? ? ? A . n A 1 3 HIS 3 -10 ? ? ? A . n A 1 4 HIS 4 -9 ? ? ? A . n A 1 5 HIS 5 -8 ? ? ? A . n A 1 6 HIS 6 -7 ? ? ? A . n A 1 7 HIS 7 -6 ? ? ? A . n A 1 8 SER 8 -5 ? ? ? A . n A 1 9 GLY 9 -4 ? ? ? A . n A 1 10 ILE 10 -3 ? ? ? A . n A 1 11 GLU 11 -2 ? ? ? A . n A 1 12 GLY 12 -1 ? ? ? A . n A 1 13 ARG 13 0 ? ? ? A . n A 1 14 ALA 14 1 1 ALA ALA A . n A 1 15 THR 15 2 2 THR THR A . n A 1 16 HIS 16 3 3 HIS HIS A . n A 1 17 ALA 17 4 4 ALA ALA A . n A 1 18 ALA 18 5 5 ALA ALA A . n A 1 19 PHE 19 6 6 PHE PHE A . n A 1 20 GLU 20 7 7 GLU GLU A . n A 1 21 TYR 21 8 8 TYR TYR A . n A 1 22 SER 22 9 9 SER SER A . n A 1 23 LYS 23 10 10 LYS LYS A . n A 1 24 SER 24 11 11 SER SER A . n A 1 25 ILE 25 12 12 ILE ILE A . n A 1 26 GLY 26 13 13 GLY GLY A . n A 1 27 GLY 27 14 14 GLY GLY A . n A 1 28 THR 28 15 15 THR THR A . n A 1 29 PRO 29 16 16 PRO PRO A . n A 1 30 ALA 30 17 17 ALA ALA A . n A 1 31 LEU 31 18 18 LEU LEU A . n A 1 32 ASP 32 19 19 ASP ASP A . n A 1 33 ARG 33 20 20 ARG ARG A . n A 1 34 ARG 34 21 21 ARG ARG A . n A 1 35 VAL 35 22 22 VAL VAL A . n A 1 36 GLN 36 23 23 GLN GLN A . n A 1 37 ASP 37 24 24 ASP ASP A . n A 1 38 VAL 38 25 25 VAL VAL A . n A 1 39 ASN 39 26 26 ASN ASN A . n A 1 40 ASP 40 27 27 ASP ASP A . n A 1 41 THR 41 28 28 THR THR A . n A 1 42 ILE 42 29 29 ILE ILE A . n A 1 43 SER 43 30 30 SER SER A . n A 1 44 ASP 44 31 31 ASP ASP A . n A 1 45 VAL 45 32 32 VAL VAL A . n A 1 46 LYS 46 33 33 LYS LYS A . n A 1 47 GLN 47 34 34 GLN GLN A . n A 1 48 LYS 48 35 35 LYS LYS A . n A 1 49 TRP 49 36 36 TRP TRP A . n A 1 50 ARG 50 37 37 ARG ARG A . n A 1 51 CYS 51 38 38 CYS CYS A . n A 1 52 VAL 52 39 39 VAL VAL A . n A 1 53 VAL 53 40 40 VAL VAL A . n A 1 54 TYR 54 41 41 TYR TYR A . n A 1 55 PRO 55 42 42 PRO PRO A . n A 1 56 GLY 56 43 43 GLY GLY A . n A 1 57 ASN 57 44 44 ASN ASN A . n A 1 58 GLY 58 45 45 GLY GLY A . n A 1 59 PHE 59 46 46 PHE PHE A . n A 1 60 VAL 60 47 47 VAL VAL A . n A 1 61 SER 61 48 48 SER SER A . n A 1 62 ALA 62 49 49 ALA ALA A . n A 1 63 SER 63 50 50 SER SER A . n A 1 64 ILE 64 51 51 ILE ILE A . n A 1 65 PHE 65 52 52 PHE PHE A . n A 1 66 GLY 66 53 53 GLY GLY A . n A 1 67 PHE 67 54 54 PHE PHE A . n A 1 68 GLN 68 55 55 GLN GLN A . n A 1 69 ALA 69 56 56 ALA ALA A . n A 1 70 GLU 70 57 57 GLU GLU A . n A 1 71 VAL 71 58 58 VAL VAL A . n A 1 72 GLY 72 59 59 GLY GLY A . n A 1 73 PRO 73 60 60 PRO PRO A . n A 1 74 ASN 74 61 61 ASN ASN A . n A 1 75 ASN 75 62 62 ASN ASN A . n A 1 76 THR 76 63 63 THR THR A . n A 1 77 ARG 77 64 64 ARG ARG A . n A 1 78 SER 78 65 65 SER SER A . n A 1 79 ILE 79 66 66 ILE ILE A . n A 1 80 ARG 80 67 67 ARG ARG A . n A 1 81 LYS 81 68 68 LYS LYS A . n A 1 82 PHE 82 69 69 PHE PHE A . n A 1 83 ASN 83 70 70 ASN ASN A . n A 1 84 THR 84 71 71 THR THR A . n A 1 85 MET 85 72 72 MET MET A . n A 1 86 GLN 86 73 73 GLN GLN A . n A 1 87 GLN 87 74 74 GLN GLN A . n A 1 88 CYS 88 75 75 CYS CYS A . n A 1 89 ILE 89 76 76 ILE ILE A . n A 1 90 ASP 90 77 77 ASP ASP A . n A 1 91 PHE 91 78 78 PHE PHE A . n A 1 92 THR 92 79 79 THR THR A . n A 1 93 PHE 93 80 80 PHE PHE A . n A 1 94 SER 94 81 81 SER SER A . n A 1 95 ASP 95 82 82 ASP ASP A . n A 1 96 VAL 96 83 83 VAL VAL A . n A 1 97 ILE 97 84 84 ILE ILE A . n A 1 98 ASN 98 85 85 ASN ASN A . n A 1 99 ILE 99 86 86 ILE ILE A . n A 1 100 ASN 100 87 87 ASN ASN A . n A 1 101 ILE 101 88 88 ILE ILE A . n A 1 102 TYR 102 89 89 TYR TYR A . n A 1 103 ASN 103 90 90 ASN ASN A . n A 1 104 PRO 104 91 91 PRO PRO A . n A 1 105 CYS 105 92 92 CYS CYS A . n A 1 106 VAL 106 93 93 VAL VAL A . n A 1 107 VAL 107 94 94 VAL VAL A . n A 1 108 PRO 108 95 95 PRO PRO A . n A 1 109 ASN 109 96 96 ASN ASN A . n A 1 110 ILE 110 97 97 ILE ILE A . n A 1 111 ASN 111 98 98 ASN ASN A . n A 1 112 ASN 112 99 99 ASN ASN A . n A 1 113 ALA 113 100 100 ALA ALA A . n A 1 114 GLU 114 101 101 GLU GLU A . n A 1 115 CYS 115 102 102 CYS CYS A . n A 1 116 GLN 116 103 103 GLN GLN A . n A 1 117 PHE 117 104 104 PHE PHE A . n A 1 118 LEU 118 105 105 LEU LEU A . n A 1 119 LYS 119 106 106 LYS LYS A . n A 1 120 SER 120 107 107 SER SER A . n A 1 121 VAL 121 108 108 VAL VAL A . n A 1 122 LEU 122 109 109 LEU LEU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8GQO _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8GQO _struct.title 'Solution NMR structure of vaccinia virus protein A28: an entry-fusion complex component' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8GQO _struct_keywords.text 'Entry-fusion Complex, Cell Membrane Fusion, Vaccinia Virus, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A4GDK2_9POXV _struct_ref.pdbx_db_accession A4GDK2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMQQCIDFTF SDVININIYNPCVVPNINNAECQFLKSVL ; _struct_ref.pdbx_align_begin 38 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8GQO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 14 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 122 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A4GDK2 _struct_ref_seq.db_align_beg 38 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 109 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8GQO MET A 1 ? UNP A4GDK2 ? ? 'initiating methionine' -12 1 1 8GQO HIS A 2 ? UNP A4GDK2 ? ? 'expression tag' -11 2 1 8GQO HIS A 3 ? UNP A4GDK2 ? ? 'expression tag' -10 3 1 8GQO HIS A 4 ? UNP A4GDK2 ? ? 'expression tag' -9 4 1 8GQO HIS A 5 ? UNP A4GDK2 ? ? 'expression tag' -8 5 1 8GQO HIS A 6 ? UNP A4GDK2 ? ? 'expression tag' -7 6 1 8GQO HIS A 7 ? UNP A4GDK2 ? ? 'expression tag' -6 7 1 8GQO SER A 8 ? UNP A4GDK2 ? ? 'expression tag' -5 8 1 8GQO GLY A 9 ? UNP A4GDK2 ? ? 'expression tag' -4 9 1 8GQO ILE A 10 ? UNP A4GDK2 ? ? 'expression tag' -3 10 1 8GQO GLU A 11 ? UNP A4GDK2 ? ? 'expression tag' -2 11 1 8GQO GLY A 12 ? UNP A4GDK2 ? ? 'expression tag' -1 12 1 8GQO ARG A 13 ? UNP A4GDK2 ? ? 'expression tag' 0 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 43 ? LYS A 48 ? SER A 30 LYS A 35 1 ? 6 HELX_P HELX_P2 AA2 THR A 84 ? SER A 94 ? THR A 71 SER A 81 1 ? 11 HELX_P HELX_P3 AA3 ASP A 95 ? ASN A 98 ? ASP A 82 ASN A 85 5 ? 4 HELX_P HELX_P4 AA4 ASN A 111 ? LEU A 122 ? ASN A 98 LEU A 109 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 51 SG ? ? ? 1_555 A CYS 88 SG ? ? A CYS 38 A CYS 75 1_555 ? ? ? ? ? ? ? 2.041 ? ? disulf2 disulf ? ? A CYS 105 SG ? ? ? 1_555 A CYS 115 SG ? ? A CYS 92 A CYS 102 1_555 ? ? ? ? ? ? ? 2.035 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 51 ? CYS A 88 ? CYS A 38 ? 1_555 CYS A 75 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 105 ? CYS A 115 ? CYS A 92 ? 1_555 CYS A 102 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 50 ? TYR A 54 ? ARG A 37 TYR A 41 AA1 2 GLY A 58 ? SER A 63 ? GLY A 45 SER A 50 AA1 3 GLY A 66 ? GLY A 72 ? GLY A 53 GLY A 59 AA1 4 LYS A 81 ? PHE A 82 ? LYS A 68 PHE A 69 AA2 1 THR A 76 ? ILE A 79 ? THR A 63 ILE A 66 AA2 2 GLY A 66 ? GLY A 72 ? GLY A 53 GLY A 59 AA2 3 GLY A 58 ? SER A 63 ? GLY A 45 SER A 50 AA2 4 ILE A 101 ? TYR A 102 ? ILE A 88 TYR A 89 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 50 ? N ARG A 37 O ALA A 62 ? O ALA A 49 AA1 2 3 N SER A 61 ? N SER A 48 O GLN A 68 ? O GLN A 55 AA2 1 2 O SER A 78 ? O SER A 65 N GLU A 70 ? N GLU A 57 AA2 2 3 O GLN A 68 ? O GLN A 55 N SER A 61 ? N SER A 48 # _pdbx_entry_details.entry_id 8GQO _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 6 ? ? -150.97 -4.78 2 1 GLU A 7 ? ? 59.37 -66.59 3 1 LEU A 18 ? ? -138.59 -35.69 4 1 VAL A 25 ? ? -135.16 -41.48 5 1 ASN A 26 ? ? -151.92 -50.68 6 1 ASP A 27 ? ? 56.03 -48.46 7 1 THR A 28 ? ? -154.46 10.85 8 1 TRP A 36 ? ? 71.58 135.84 9 1 SER A 81 ? ? -84.89 44.53 10 1 ASN A 85 ? ? 53.97 80.35 11 1 CYS A 92 ? ? 49.72 79.18 12 2 ALA A 5 ? ? -78.92 30.52 13 2 PHE A 6 ? ? -145.20 23.26 14 2 GLU A 7 ? ? 56.87 -138.69 15 2 LYS A 10 ? ? 48.83 -110.78 16 2 ILE A 12 ? ? -144.89 18.69 17 2 ALA A 17 ? ? -148.79 -14.71 18 2 ARG A 20 ? ? 59.52 -27.69 19 2 VAL A 22 ? ? -49.60 153.83 20 2 SER A 30 ? ? -151.19 -3.51 21 2 TRP A 36 ? ? 57.86 159.30 22 2 ASN A 85 ? ? -149.15 56.37 23 2 ASN A 96 ? ? -69.07 96.25 24 3 PHE A 6 ? ? -144.25 31.91 25 3 GLU A 7 ? ? 49.08 -152.37 26 3 ALA A 17 ? ? -148.71 -156.33 27 3 ASN A 26 ? ? -92.62 41.21 28 3 TRP A 36 ? ? 60.87 167.37 29 3 SER A 81 ? ? -97.61 30.94 30 3 ASN A 85 ? ? 69.92 108.31 31 3 CYS A 92 ? ? 58.38 74.61 32 4 PHE A 6 ? ? -148.66 13.97 33 4 SER A 9 ? ? 48.04 -100.05 34 4 ARG A 21 ? ? 52.59 172.67 35 4 ASN A 26 ? ? -136.74 -121.88 36 4 ASP A 27 ? ? 56.36 -46.64 37 4 SER A 30 ? ? -167.41 -30.79 38 4 TRP A 36 ? ? 64.60 148.33 39 4 SER A 81 ? ? -76.80 43.74 40 4 ASN A 85 ? ? 53.95 74.81 41 4 CYS A 92 ? ? 57.58 19.96 42 5 PHE A 6 ? ? -161.08 -2.04 43 5 ASP A 19 ? ? 73.81 134.66 44 5 THR A 28 ? ? -146.14 -11.08 45 5 SER A 30 ? ? -150.99 42.88 46 5 TRP A 36 ? ? 61.51 155.97 47 5 ASN A 61 ? ? 39.58 50.59 48 5 SER A 81 ? ? -75.01 44.33 49 5 ASN A 85 ? ? 52.59 83.91 50 6 HIS A 3 ? ? -150.04 -12.73 51 6 ALA A 5 ? ? 62.88 167.24 52 6 PHE A 6 ? ? -149.79 -7.25 53 6 TYR A 8 ? ? 56.75 -163.20 54 6 SER A 9 ? ? 45.51 88.99 55 6 VAL A 25 ? ? -137.42 -45.33 56 6 ASP A 27 ? ? 63.20 -35.33 57 6 TRP A 36 ? ? 72.99 142.24 58 6 THR A 63 ? ? -78.30 -166.71 59 6 SER A 81 ? ? -94.11 39.52 60 7 ALA A 5 ? ? -147.02 -2.96 61 7 PHE A 6 ? ? -160.98 114.92 62 7 SER A 9 ? ? 61.30 178.32 63 7 LYS A 10 ? ? 57.04 71.46 64 7 ASP A 24 ? ? -150.30 4.24 65 7 THR A 28 ? ? -144.32 -23.33 66 7 SER A 30 ? ? -141.82 28.00 67 7 TRP A 36 ? ? 61.29 138.09 68 8 THR A 2 ? ? -149.88 -20.02 69 8 PHE A 6 ? ? -141.02 -36.57 70 8 GLU A 7 ? ? 62.63 -177.55 71 8 TYR A 8 ? ? 57.87 13.23 72 8 THR A 28 ? ? -143.91 -39.21 73 8 ILE A 29 ? ? 35.69 -112.36 74 8 LYS A 35 ? ? -75.59 25.56 75 8 TRP A 36 ? ? 61.71 157.81 76 8 SER A 81 ? ? -77.81 47.36 77 8 ASN A 85 ? ? 62.49 111.73 78 8 VAL A 94 ? ? 61.57 -89.02 79 9 THR A 2 ? ? 58.68 -69.76 80 9 HIS A 3 ? ? -140.14 24.89 81 9 PHE A 6 ? ? -141.25 12.80 82 9 GLU A 7 ? ? 47.94 29.35 83 9 TYR A 8 ? ? 46.07 74.03 84 9 SER A 9 ? ? 57.89 -80.12 85 9 LYS A 10 ? ? -152.48 66.35 86 9 SER A 11 ? ? 63.99 -23.53 87 9 ARG A 20 ? ? 52.80 -4.57 88 9 ASP A 27 ? ? -137.95 -36.29 89 9 ILE A 29 ? ? 58.63 145.80 90 9 ASP A 31 ? ? -68.96 3.78 91 9 TRP A 36 ? ? 54.07 135.59 92 9 ASN A 61 ? ? -88.90 30.63 93 9 SER A 81 ? ? -90.43 43.24 94 10 PHE A 6 ? ? -153.28 3.02 95 10 TYR A 8 ? ? 51.18 -97.29 96 10 ASP A 19 ? ? 50.03 -93.31 97 10 ARG A 20 ? ? 59.66 16.74 98 10 ASN A 26 ? ? -145.30 -25.34 99 10 TRP A 36 ? ? 64.38 153.82 100 10 SER A 81 ? ? -75.66 40.00 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 4 ASN A 96 ? ? ILE A 97 ? ? 142.74 2 5 PHE A 6 ? ? GLU A 7 ? ? -148.61 # _pdbx_nmr_ensemble.entry_id 8GQO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8GQO _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50 mM sodium chloride, 50 mM MES, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N_13C_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium chloride' 50 ? mM 'natural abundance' 1 MES 50 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 NaCl' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '3D HNCO' 1 isotropic 6 1 1 '3D HN(CA)CO' 1 isotropic 7 1 1 '3D HCCH-TOCSY' 1 isotropic 8 1 1 '3D C(CO)NH' 1 isotropic 9 1 1 '3D H(CCO)NH' 1 isotropic 10 1 1 '3D HBHA(CO)NH' 1 isotropic 11 1 1 '3D 1H-15N NOESY' 1 isotropic 12 1 1 '3D 1H-13C NOESY' 1 isotropic 13 1 1 '3D 1H-15N TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 8GQO _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 2 'structure calculation' 'X-PLOR NIH' 3.4 'Schwieters, Kuszewski, Tjandra and Clore' 3 'chemical shift assignment' NMRViewJ 9.2.0 'One Moon Scientific Incorporation' 4 'peak picking' NMRViewJ 9.2.0 'One Moon Scientific Incorporation' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -12 ? A MET 1 2 1 Y 1 A HIS -11 ? A HIS 2 3 1 Y 1 A HIS -10 ? A HIS 3 4 1 Y 1 A HIS -9 ? A HIS 4 5 1 Y 1 A HIS -8 ? A HIS 5 6 1 Y 1 A HIS -7 ? A HIS 6 7 1 Y 1 A HIS -6 ? A HIS 7 8 1 Y 1 A SER -5 ? A SER 8 9 1 Y 1 A GLY -4 ? A GLY 9 10 1 Y 1 A ILE -3 ? A ILE 10 11 1 Y 1 A GLU -2 ? A GLU 11 12 1 Y 1 A GLY -1 ? A GLY 12 13 1 Y 1 A ARG 0 ? A ARG 13 14 2 Y 1 A MET -12 ? A MET 1 15 2 Y 1 A HIS -11 ? A HIS 2 16 2 Y 1 A HIS -10 ? A HIS 3 17 2 Y 1 A HIS -9 ? A HIS 4 18 2 Y 1 A HIS -8 ? A HIS 5 19 2 Y 1 A HIS -7 ? A HIS 6 20 2 Y 1 A HIS -6 ? A HIS 7 21 2 Y 1 A SER -5 ? A SER 8 22 2 Y 1 A GLY -4 ? A GLY 9 23 2 Y 1 A ILE -3 ? A ILE 10 24 2 Y 1 A GLU -2 ? A GLU 11 25 2 Y 1 A GLY -1 ? A GLY 12 26 2 Y 1 A ARG 0 ? A ARG 13 27 3 Y 1 A MET -12 ? A MET 1 28 3 Y 1 A HIS -11 ? A HIS 2 29 3 Y 1 A HIS -10 ? A HIS 3 30 3 Y 1 A HIS -9 ? A HIS 4 31 3 Y 1 A HIS -8 ? A HIS 5 32 3 Y 1 A HIS -7 ? A HIS 6 33 3 Y 1 A HIS -6 ? A HIS 7 34 3 Y 1 A SER -5 ? A SER 8 35 3 Y 1 A GLY -4 ? A GLY 9 36 3 Y 1 A ILE -3 ? A ILE 10 37 3 Y 1 A GLU -2 ? A GLU 11 38 3 Y 1 A GLY -1 ? A GLY 12 39 3 Y 1 A ARG 0 ? A ARG 13 40 4 Y 1 A MET -12 ? A MET 1 41 4 Y 1 A HIS -11 ? A HIS 2 42 4 Y 1 A HIS -10 ? A HIS 3 43 4 Y 1 A HIS -9 ? A HIS 4 44 4 Y 1 A HIS -8 ? A HIS 5 45 4 Y 1 A HIS -7 ? A HIS 6 46 4 Y 1 A HIS -6 ? A HIS 7 47 4 Y 1 A SER -5 ? A SER 8 48 4 Y 1 A GLY -4 ? A GLY 9 49 4 Y 1 A ILE -3 ? A ILE 10 50 4 Y 1 A GLU -2 ? A GLU 11 51 4 Y 1 A GLY -1 ? A GLY 12 52 4 Y 1 A ARG 0 ? A ARG 13 53 5 Y 1 A MET -12 ? A MET 1 54 5 Y 1 A HIS -11 ? A HIS 2 55 5 Y 1 A HIS -10 ? A HIS 3 56 5 Y 1 A HIS -9 ? A HIS 4 57 5 Y 1 A HIS -8 ? A HIS 5 58 5 Y 1 A HIS -7 ? A HIS 6 59 5 Y 1 A HIS -6 ? A HIS 7 60 5 Y 1 A SER -5 ? A SER 8 61 5 Y 1 A GLY -4 ? A GLY 9 62 5 Y 1 A ILE -3 ? A ILE 10 63 5 Y 1 A GLU -2 ? A GLU 11 64 5 Y 1 A GLY -1 ? A GLY 12 65 5 Y 1 A ARG 0 ? A ARG 13 66 6 Y 1 A MET -12 ? A MET 1 67 6 Y 1 A HIS -11 ? A HIS 2 68 6 Y 1 A HIS -10 ? A HIS 3 69 6 Y 1 A HIS -9 ? A HIS 4 70 6 Y 1 A HIS -8 ? A HIS 5 71 6 Y 1 A HIS -7 ? A HIS 6 72 6 Y 1 A HIS -6 ? A HIS 7 73 6 Y 1 A SER -5 ? A SER 8 74 6 Y 1 A GLY -4 ? A GLY 9 75 6 Y 1 A ILE -3 ? A ILE 10 76 6 Y 1 A GLU -2 ? A GLU 11 77 6 Y 1 A GLY -1 ? A GLY 12 78 6 Y 1 A ARG 0 ? A ARG 13 79 7 Y 1 A MET -12 ? A MET 1 80 7 Y 1 A HIS -11 ? A HIS 2 81 7 Y 1 A HIS -10 ? A HIS 3 82 7 Y 1 A HIS -9 ? A HIS 4 83 7 Y 1 A HIS -8 ? A HIS 5 84 7 Y 1 A HIS -7 ? A HIS 6 85 7 Y 1 A HIS -6 ? A HIS 7 86 7 Y 1 A SER -5 ? A SER 8 87 7 Y 1 A GLY -4 ? A GLY 9 88 7 Y 1 A ILE -3 ? A ILE 10 89 7 Y 1 A GLU -2 ? A GLU 11 90 7 Y 1 A GLY -1 ? A GLY 12 91 7 Y 1 A ARG 0 ? A ARG 13 92 8 Y 1 A MET -12 ? A MET 1 93 8 Y 1 A HIS -11 ? A HIS 2 94 8 Y 1 A HIS -10 ? A HIS 3 95 8 Y 1 A HIS -9 ? A HIS 4 96 8 Y 1 A HIS -8 ? A HIS 5 97 8 Y 1 A HIS -7 ? A HIS 6 98 8 Y 1 A HIS -6 ? A HIS 7 99 8 Y 1 A SER -5 ? A SER 8 100 8 Y 1 A GLY -4 ? A GLY 9 101 8 Y 1 A ILE -3 ? A ILE 10 102 8 Y 1 A GLU -2 ? A GLU 11 103 8 Y 1 A GLY -1 ? A GLY 12 104 8 Y 1 A ARG 0 ? A ARG 13 105 9 Y 1 A MET -12 ? A MET 1 106 9 Y 1 A HIS -11 ? A HIS 2 107 9 Y 1 A HIS -10 ? A HIS 3 108 9 Y 1 A HIS -9 ? A HIS 4 109 9 Y 1 A HIS -8 ? A HIS 5 110 9 Y 1 A HIS -7 ? A HIS 6 111 9 Y 1 A HIS -6 ? A HIS 7 112 9 Y 1 A SER -5 ? A SER 8 113 9 Y 1 A GLY -4 ? A GLY 9 114 9 Y 1 A ILE -3 ? A ILE 10 115 9 Y 1 A GLU -2 ? A GLU 11 116 9 Y 1 A GLY -1 ? A GLY 12 117 9 Y 1 A ARG 0 ? A ARG 13 118 10 Y 1 A MET -12 ? A MET 1 119 10 Y 1 A HIS -11 ? A HIS 2 120 10 Y 1 A HIS -10 ? A HIS 3 121 10 Y 1 A HIS -9 ? A HIS 4 122 10 Y 1 A HIS -8 ? A HIS 5 123 10 Y 1 A HIS -7 ? A HIS 6 124 10 Y 1 A HIS -6 ? A HIS 7 125 10 Y 1 A SER -5 ? A SER 8 126 10 Y 1 A GLY -4 ? A GLY 9 127 10 Y 1 A ILE -3 ? A ILE 10 128 10 Y 1 A GLU -2 ? A GLU 11 129 10 Y 1 A GLY -1 ? A GLY 12 130 10 Y 1 A ARG 0 ? A ARG 13 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Ministry of Science and Technology (MoST, Taiwan)' _pdbx_audit_support.country Taiwan _pdbx_audit_support.grant_number 'MOST 111-2113-M-001-014' _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8GQO _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #