data_8GSK # _entry.id 8GSK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8GSK pdb_00008gsk 10.2210/pdb8gsk/pdb WWPDB D_1300031772 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8GSK _pdbx_database_status.recvd_initial_deposition_date 2022-09-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kumar, N.' 1 0000-0002-5086-0928 'Mahajan, A.S.' 2 0000-0002-2474-5520 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;S302G Crystal Structure of S302G single mutant of O-acetyl-L-serine sulfhydrylase from Haemophilus influenzae at 2.2 A ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumar, N.' 1 0000-0002-5086-0928 primary 'Mahajan, A.S.' 2 0000-0002-2474-5520 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8GSK _cell.details ? _cell.formula_units_Z ? _cell.length_a 112.600 _cell.length_a_esd ? _cell.length_b 112.600 _cell.length_b_esd ? _cell.length_c 45.730 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8GSK _symmetry.cell_setting ? _symmetry.Int_Tables_number 80 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cysteine synthase' 33621.438 1 2.5.1.47 S302G ? ? 2 water nat water 18.015 5 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CSase,O-acetylserine (thiol)-lyase,OAS-TL,O-acetylserine sulfhydrylase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSV(LLP)CRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIA LAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRET TGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPK NLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSAGERYLSTALFEGIEG ; _entity_poly.pdbx_seq_one_letter_code_can ;MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVKCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYV AAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPE IWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDL SIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSAGERYLSTALFEGIEG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ILE n 1 4 TYR n 1 5 ALA n 1 6 ASP n 1 7 ASN n 1 8 SER n 1 9 TYR n 1 10 SER n 1 11 ILE n 1 12 GLY n 1 13 ASN n 1 14 THR n 1 15 PRO n 1 16 LEU n 1 17 VAL n 1 18 ARG n 1 19 LEU n 1 20 LYS n 1 21 HIS n 1 22 PHE n 1 23 GLY n 1 24 HIS n 1 25 ASN n 1 26 GLY n 1 27 ASN n 1 28 VAL n 1 29 VAL n 1 30 VAL n 1 31 LYS n 1 32 ILE n 1 33 GLU n 1 34 GLY n 1 35 ARG n 1 36 ASN n 1 37 PRO n 1 38 SER n 1 39 TYR n 1 40 SER n 1 41 VAL n 1 42 LLP n 1 43 CYS n 1 44 ARG n 1 45 ILE n 1 46 GLY n 1 47 ALA n 1 48 ASN n 1 49 MET n 1 50 VAL n 1 51 TRP n 1 52 GLN n 1 53 ALA n 1 54 GLU n 1 55 LYS n 1 56 ASP n 1 57 GLY n 1 58 THR n 1 59 LEU n 1 60 THR n 1 61 LYS n 1 62 GLY n 1 63 LYS n 1 64 GLU n 1 65 ILE n 1 66 VAL n 1 67 ASP n 1 68 ALA n 1 69 THR n 1 70 SER n 1 71 GLY n 1 72 ASN n 1 73 THR n 1 74 GLY n 1 75 ILE n 1 76 ALA n 1 77 LEU n 1 78 ALA n 1 79 TYR n 1 80 VAL n 1 81 ALA n 1 82 ALA n 1 83 ALA n 1 84 ARG n 1 85 GLY n 1 86 TYR n 1 87 LYS n 1 88 ILE n 1 89 THR n 1 90 LEU n 1 91 THR n 1 92 MET n 1 93 PRO n 1 94 GLU n 1 95 THR n 1 96 MET n 1 97 SER n 1 98 LEU n 1 99 GLU n 1 100 ARG n 1 101 LYS n 1 102 ARG n 1 103 LEU n 1 104 LEU n 1 105 CYS n 1 106 GLY n 1 107 LEU n 1 108 GLY n 1 109 VAL n 1 110 ASN n 1 111 LEU n 1 112 VAL n 1 113 LEU n 1 114 THR n 1 115 GLU n 1 116 GLY n 1 117 ALA n 1 118 LYS n 1 119 GLY n 1 120 MET n 1 121 LYS n 1 122 GLY n 1 123 ALA n 1 124 ILE n 1 125 ALA n 1 126 LYS n 1 127 ALA n 1 128 GLU n 1 129 GLU n 1 130 ILE n 1 131 VAL n 1 132 ALA n 1 133 SER n 1 134 ASP n 1 135 PRO n 1 136 SER n 1 137 ARG n 1 138 TYR n 1 139 VAL n 1 140 MET n 1 141 LEU n 1 142 LYS n 1 143 GLN n 1 144 PHE n 1 145 GLU n 1 146 ASN n 1 147 PRO n 1 148 ALA n 1 149 ASN n 1 150 PRO n 1 151 GLN n 1 152 ILE n 1 153 HIS n 1 154 ARG n 1 155 GLU n 1 156 THR n 1 157 THR n 1 158 GLY n 1 159 PRO n 1 160 GLU n 1 161 ILE n 1 162 TRP n 1 163 LYS n 1 164 ASP n 1 165 THR n 1 166 ASP n 1 167 GLY n 1 168 LYS n 1 169 VAL n 1 170 ASP n 1 171 VAL n 1 172 VAL n 1 173 VAL n 1 174 ALA n 1 175 GLY n 1 176 VAL n 1 177 GLY n 1 178 THR n 1 179 GLY n 1 180 GLY n 1 181 SER n 1 182 ILE n 1 183 THR n 1 184 GLY n 1 185 ILE n 1 186 SER n 1 187 ARG n 1 188 ALA n 1 189 ILE n 1 190 LYS n 1 191 LEU n 1 192 ASP n 1 193 PHE n 1 194 GLY n 1 195 LYS n 1 196 GLN n 1 197 ILE n 1 198 THR n 1 199 SER n 1 200 VAL n 1 201 ALA n 1 202 VAL n 1 203 GLU n 1 204 PRO n 1 205 VAL n 1 206 GLU n 1 207 SER n 1 208 PRO n 1 209 VAL n 1 210 ILE n 1 211 SER n 1 212 GLN n 1 213 THR n 1 214 LEU n 1 215 ALA n 1 216 GLY n 1 217 GLU n 1 218 GLU n 1 219 VAL n 1 220 LYS n 1 221 PRO n 1 222 GLY n 1 223 PRO n 1 224 HIS n 1 225 LYS n 1 226 ILE n 1 227 GLN n 1 228 GLY n 1 229 ILE n 1 230 GLY n 1 231 ALA n 1 232 GLY n 1 233 PHE n 1 234 ILE n 1 235 PRO n 1 236 LYS n 1 237 ASN n 1 238 LEU n 1 239 ASP n 1 240 LEU n 1 241 SER n 1 242 ILE n 1 243 ILE n 1 244 ASP n 1 245 ARG n 1 246 VAL n 1 247 GLU n 1 248 THR n 1 249 VAL n 1 250 ASP n 1 251 SER n 1 252 ASP n 1 253 THR n 1 254 ALA n 1 255 LEU n 1 256 ALA n 1 257 THR n 1 258 ALA n 1 259 ARG n 1 260 ARG n 1 261 LEU n 1 262 MET n 1 263 ALA n 1 264 GLU n 1 265 GLU n 1 266 GLY n 1 267 ILE n 1 268 LEU n 1 269 ALA n 1 270 GLY n 1 271 ILE n 1 272 SER n 1 273 SER n 1 274 GLY n 1 275 ALA n 1 276 ALA n 1 277 VAL n 1 278 ALA n 1 279 ALA n 1 280 ALA n 1 281 ASP n 1 282 ARG n 1 283 LEU n 1 284 ALA n 1 285 LYS n 1 286 LEU n 1 287 PRO n 1 288 GLU n 1 289 PHE n 1 290 ALA n 1 291 ASP n 1 292 LYS n 1 293 LEU n 1 294 ILE n 1 295 VAL n 1 296 VAL n 1 297 ILE n 1 298 LEU n 1 299 PRO n 1 300 SER n 1 301 ALA n 1 302 GLY n 1 303 GLU n 1 304 ARG n 1 305 TYR n 1 306 LEU n 1 307 SER n 1 308 THR n 1 309 ALA n 1 310 LEU n 1 311 PHE n 1 312 GLU n 1 313 GLY n 1 314 ILE n 1 315 GLU n 1 316 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 316 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'cysK, HI_1103' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 51907 / DSM 11121 / KW20 / Rd' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Haemophilus influenzae Rd KW20' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 71421 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYSK_HAEIN _struct_ref.pdbx_db_accession P45040 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVKCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYV AAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPE IWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDL SIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALFEGIEG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8GSK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 316 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P45040 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 316 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 316 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8GSK _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 302 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P45040 _struct_ref_seq_dif.db_mon_id SER _struct_ref_seq_dif.pdbx_seq_db_seq_num 302 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 302 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LLP 'L-peptide linking' n '(2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid' "N'-PYRIDOXYL-LYSINE-5'-MONOPHOSPHATE" 'C14 H22 N3 O7 P' 375.314 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8GSK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.38 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES, 1.3 M Sodium Citrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR scanner 345 mm plate' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-09-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator Mirrors _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54179 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type RIGAKU _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54179 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8GSK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.271 _reflns.d_resolution_low 42.37 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12952 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.02 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 44.88 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.788 _reflns.pdbx_CC_star 0.939 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.271 _reflns_shell.d_res_low 2.352 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 18871 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.745 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -2.295 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -2.295 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 4.590 _refine.B_iso_max ? _refine.B_iso_mean 32.709 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.922 _refine.correlation_coeff_Fo_to_Fc_free 0.897 _refine.details 'Hydrogens have been used if present in the input file' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8GSK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.271 _refine.ls_d_res_low 42.37 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12916 _refine.ls_number_reflns_R_free 625 _refine.ls_number_reflns_R_work 12291 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.023 _refine.ls_percent_reflns_R_free 4.839 _refine.ls_R_factor_all 0.225 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2664 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2225 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1Y7L _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.440 _refine.pdbx_overall_ESU_R_Free 0.268 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 9.415 _refine.overall_SU_ML 0.223 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2270 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 2275 _refine_hist.d_res_high 2.271 _refine_hist.d_res_low 42.37 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.012 2303 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.565 1.631 3128 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 7.026 5.000 308 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.991 22.660 94 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.441 15.000 381 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.385 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.119 0.200 322 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1694 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.229 0.200 1046 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.301 0.200 1581 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.187 0.200 85 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.204 0.200 41 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.190 0.200 10 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 2.200 3.264 1235 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.392 4.882 1542 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.536 3.360 1068 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.701 4.956 1586 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.939 60.811 9709 ? r_lrange_it ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.271 2.330 . . 36 924 96.7742 . . . 0.475 . 0.391 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.330 2.393 . . 54 903 100.0000 . . . 0.301 . 0.301 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.393 2.463 . . 34 877 99.8904 . . . 0.411 . 0.256 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.463 2.538 . . 44 873 100.0000 . . . 0.334 . 0.226 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.538 2.622 . . 50 823 100.0000 . . . 0.239 . 0.223 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.622 2.714 . . 28 619 75.5841 . . . 0.357 . 0.238 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.714 2.816 . . 30 788 100.0000 . . . 0.326 . 0.221 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.816 2.931 . . 44 751 99.8744 . . . 0.295 . 0.233 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.931 3.061 . . 41 731 100.0000 . . . 0.308 . 0.210 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.061 3.210 . . 44 680 100.0000 . . . 0.280 . 0.206 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.210 3.383 . . 32 662 100.0000 . . . 0.255 . 0.213 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.383 3.588 . . 34 495 80.0303 . . . 0.259 . 0.223 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.588 3.835 . . 29 498 85.1373 . . . 0.237 . 0.258 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.835 4.142 . . 32 483 88.6403 . . . 0.239 . 0.213 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.142 4.536 . . 14 519 100.0000 . . . 0.232 . 0.187 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.536 5.069 . . 24 455 100.0000 . . . 0.144 . 0.181 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.069 5.849 . . 20 417 100.0000 . . . 0.280 . 0.203 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.849 7.154 . . 13 352 100.0000 . . . 0.199 . 0.222 . . . . . . . . . . . 'X-RAY DIFFRACTION' 7.154 10.077 . . 10 280 100.0000 . . . 0.176 . 0.187 . . . . . . . . . . . 'X-RAY DIFFRACTION' 10.077 42.37 . . 12 161 99.4253 . . . 0.326 . 0.183 . . . . . . . . . . . # _struct.entry_id 8GSK _struct.title 'Crystal Structure of S302G single mutant of O-acetyl-L-serine sulfhydrylase from Haemophilus influenzae at 2.2 A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8GSK _struct_keywords.text 'single mutant, O-acetyl-L-serine sulfhydrylase, Haemophilus influenzae, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 6 ? ILE A 11 ? ASP A 6 ILE A 11 5 ? 6 HELX_P HELX_P2 AA2 VAL A 41 ? ASP A 56 ? VAL A 41 ASP A 56 1 ? 16 HELX_P HELX_P3 AA3 GLY A 71 ? GLY A 85 ? GLY A 71 GLY A 85 1 ? 15 HELX_P HELX_P4 AA4 SER A 97 ? LEU A 107 ? SER A 97 LEU A 107 1 ? 11 HELX_P HELX_P5 AA5 LYS A 118 ? SER A 133 ? LYS A 118 SER A 133 1 ? 16 HELX_P HELX_P6 AA6 PRO A 147 ? THR A 156 ? PRO A 147 THR A 156 1 ? 10 HELX_P HELX_P7 AA7 THR A 156 ? ASP A 166 ? THR A 156 ASP A 166 1 ? 11 HELX_P HELX_P8 AA8 GLY A 179 ? LEU A 191 ? GLY A 179 LEU A 191 1 ? 13 HELX_P HELX_P9 AA9 PRO A 208 ? GLY A 216 ? PRO A 208 GLY A 216 1 ? 9 HELX_P HELX_P10 AB1 ASP A 239 ? ILE A 243 ? ASP A 239 ILE A 243 5 ? 5 HELX_P HELX_P11 AB2 ASP A 250 ? GLY A 266 ? ASP A 250 GLY A 266 1 ? 17 HELX_P HELX_P12 AB3 GLY A 270 ? LYS A 285 ? GLY A 270 LYS A 285 1 ? 16 HELX_P HELX_P13 AB4 LEU A 286 ? ALA A 290 ? LEU A 286 ALA A 290 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A VAL 41 C ? ? ? 1_555 A LLP 42 N ? ? A VAL 41 A LLP 42 1_555 ? ? ? ? ? ? ? 1.349 ? ? covale2 covale both ? A LLP 42 C ? ? ? 1_555 A CYS 43 N ? ? A LLP 42 A CYS 43 1_555 ? ? ? ? ? ? ? 1.341 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 16 ? ARG A 18 ? LEU A 16 ARG A 18 AA1 2 VAL A 28 ? ILE A 32 ? VAL A 28 ILE A 32 AA1 3 LEU A 293 ? LEU A 298 ? LEU A 293 LEU A 298 AA1 4 VAL A 169 ? GLY A 175 ? VAL A 169 GLY A 175 AA1 5 THR A 198 ? PRO A 204 ? THR A 198 PRO A 204 AA1 6 ARG A 245 ? VAL A 249 ? ARG A 245 VAL A 249 AA2 1 ASN A 110 ? THR A 114 ? ASN A 110 THR A 114 AA2 2 ILE A 88 ? PRO A 93 ? ILE A 88 PRO A 93 AA2 3 GLU A 64 ? ASP A 67 ? GLU A 64 ASP A 67 AA2 4 TYR A 138 ? VAL A 139 ? TYR A 138 VAL A 139 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 17 ? N VAL A 17 O VAL A 30 ? O VAL A 30 AA1 2 3 N LYS A 31 ? N LYS A 31 O VAL A 296 ? O VAL A 296 AA1 3 4 O VAL A 295 ? O VAL A 295 N VAL A 171 ? N VAL A 171 AA1 4 5 N VAL A 172 ? N VAL A 172 O VAL A 200 ? O VAL A 200 AA1 5 6 N ALA A 201 ? N ALA A 201 O GLU A 247 ? O GLU A 247 AA2 1 2 O ASN A 110 ? O ASN A 110 N ILE A 88 ? N ILE A 88 AA2 2 3 O THR A 89 ? O THR A 89 N ILE A 65 ? N ILE A 65 AA2 3 4 N GLU A 64 ? N GLU A 64 O VAL A 139 ? O VAL A 139 # _atom_sites.entry_id 8GSK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008881 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008881 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021867 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 P 15 15 6.435 1.907 4.179 27.157 1.780 0.526 1.491 68.164 1.397 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.184 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LLP 42 42 42 LLP LLP A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 MET 92 92 92 MET MET A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 TRP 162 162 162 TRP TRP A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 LYS 190 190 190 LYS LYS A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 GLN 196 196 196 GLN GLN A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 GLN 212 212 212 GLN GLN A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 GLY 216 216 216 GLY GLY A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 GLU 218 218 218 GLU GLU A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 PRO 221 221 221 PRO PRO A . n A 1 222 GLY 222 222 222 GLY GLY A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 HIS 224 224 224 HIS HIS A . n A 1 225 LYS 225 225 225 LYS LYS A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 GLN 227 227 227 GLN GLN A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 GLY 230 230 230 GLY GLY A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 PRO 235 235 235 PRO PRO A . n A 1 236 LYS 236 236 236 LYS LYS A . n A 1 237 ASN 237 237 237 ASN ASN A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 SER 241 241 241 SER SER A . n A 1 242 ILE 242 242 242 ILE ILE A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 ASP 244 244 244 ASP ASP A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 THR 248 248 248 THR THR A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 ASP 252 252 252 ASP ASP A . n A 1 253 THR 253 253 253 THR THR A . n A 1 254 ALA 254 254 254 ALA ALA A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 ALA 256 256 256 ALA ALA A . n A 1 257 THR 257 257 257 THR THR A . n A 1 258 ALA 258 258 258 ALA ALA A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 ARG 260 260 260 ARG ARG A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 MET 262 262 262 MET MET A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 GLU 265 265 265 GLU GLU A . n A 1 266 GLY 266 266 266 GLY GLY A . n A 1 267 ILE 267 267 267 ILE ILE A . n A 1 268 LEU 268 268 268 LEU LEU A . n A 1 269 ALA 269 269 269 ALA ALA A . n A 1 270 GLY 270 270 270 GLY GLY A . n A 1 271 ILE 271 271 271 ILE ILE A . n A 1 272 SER 272 272 272 SER SER A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 GLY 274 274 274 GLY GLY A . n A 1 275 ALA 275 275 275 ALA ALA A . n A 1 276 ALA 276 276 276 ALA ALA A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 ALA 279 279 279 ALA ALA A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 ASP 281 281 281 ASP ASP A . n A 1 282 ARG 282 282 282 ARG ARG A . n A 1 283 LEU 283 283 283 LEU LEU A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 LYS 285 285 285 LYS LYS A . n A 1 286 LEU 286 286 286 LEU LEU A . n A 1 287 PRO 287 287 287 PRO PRO A . n A 1 288 GLU 288 288 288 GLU GLU A . n A 1 289 PHE 289 289 289 PHE PHE A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 ASP 291 291 291 ASP ASP A . n A 1 292 LYS 292 292 292 LYS LYS A . n A 1 293 LEU 293 293 293 LEU LEU A . n A 1 294 ILE 294 294 294 ILE ILE A . n A 1 295 VAL 295 295 295 VAL VAL A . n A 1 296 VAL 296 296 296 VAL VAL A . n A 1 297 ILE 297 297 297 ILE ILE A . n A 1 298 LEU 298 298 298 LEU LEU A . n A 1 299 PRO 299 299 299 PRO PRO A . n A 1 300 SER 300 300 300 SER SER A . n A 1 301 ALA 301 301 301 ALA ALA A . n A 1 302 GLY 302 302 302 GLY GLY A . n A 1 303 GLU 303 303 303 GLU GLU A . n A 1 304 ARG 304 304 304 ARG ARG A . n A 1 305 TYR 305 305 305 TYR TYR A . n A 1 306 LEU 306 306 306 LEU LEU A . n A 1 307 SER 307 307 307 SER SER A . n A 1 308 THR 308 308 308 THR THR A . n A 1 309 ALA 309 309 309 ALA ALA A . n A 1 310 LEU 310 310 ? ? ? A . n A 1 311 PHE 311 311 ? ? ? A . n A 1 312 GLU 312 312 ? ? ? A . n A 1 313 GLY 313 313 ? ? ? A . n A 1 314 ILE 314 314 ? ? ? A . n A 1 315 GLU 315 315 ? ? ? A . n A 1 316 GLY 316 316 ? ? ? A . n # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 narender14kmr@gmail.com Narender Kumar ? 'principal investigator/group leader' 0000-0002-5086-0928 3 apurwamahajan65@gmail.com Apurwa Mahajan Subhash 'principal investigator/group leader' 0000-0002-2474-5520 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 1 HOH HOH A . B 2 HOH 2 402 2 HOH HOH A . B 2 HOH 3 403 3 HOH HOH A . B 2 HOH 4 404 4 HOH HOH A . B 2 HOH 5 405 5 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id LLP _pdbx_struct_mod_residue.label_seq_id 42 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id LLP _pdbx_struct_mod_residue.auth_seq_id 42 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4020 ? 1 MORE -19 ? 1 'SSA (A^2)' 23360 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-09-13 2 'Structure model' 1 1 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp_atom.atom_id' 2 2 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 8GSK _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? 168.52 54.04 2 1 TYR A 39 ? ? 71.59 37.60 3 1 ASP A 134 ? ? -170.68 97.05 4 1 LYS A 142 ? ? 60.41 75.49 5 1 THR A 156 ? ? -122.13 -72.36 6 1 SER A 207 ? ? -143.03 58.38 7 1 GLU A 303 ? ? -61.29 82.21 8 1 LEU A 306 ? ? 176.49 107.63 9 1 SER A 307 ? ? 52.22 108.13 10 1 THR A 308 ? ? 107.61 -163.77 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 61 ? CG ? A LYS 61 CG 2 1 Y 1 A LYS 61 ? CD ? A LYS 61 CD 3 1 Y 1 A LYS 61 ? CE ? A LYS 61 CE 4 1 Y 1 A LYS 61 ? NZ ? A LYS 61 NZ 5 1 Y 1 A LYS 87 ? CG ? A LYS 87 CG 6 1 Y 1 A LYS 87 ? CD ? A LYS 87 CD 7 1 Y 1 A LYS 87 ? CE ? A LYS 87 CE 8 1 Y 1 A LYS 87 ? NZ ? A LYS 87 NZ 9 1 Y 1 A LYS 118 ? CG ? A LYS 118 CG 10 1 Y 1 A LYS 118 ? CD ? A LYS 118 CD 11 1 Y 1 A LYS 118 ? CE ? A LYS 118 CE 12 1 Y 1 A LYS 118 ? NZ ? A LYS 118 NZ 13 1 Y 1 A LYS 121 ? CG ? A LYS 121 CG 14 1 Y 1 A LYS 121 ? CD ? A LYS 121 CD 15 1 Y 1 A LYS 121 ? CE ? A LYS 121 CE 16 1 Y 1 A LYS 121 ? NZ ? A LYS 121 NZ 17 1 Y 1 A ARG 137 ? CG ? A ARG 137 CG 18 1 Y 1 A ARG 137 ? CD ? A ARG 137 CD 19 1 Y 1 A ARG 137 ? NE ? A ARG 137 NE 20 1 Y 1 A ARG 137 ? CZ ? A ARG 137 CZ 21 1 Y 1 A ARG 137 ? NH1 ? A ARG 137 NH1 22 1 Y 1 A ARG 137 ? NH2 ? A ARG 137 NH2 23 1 Y 1 A TYR 305 ? CG ? A TYR 305 CG 24 1 Y 1 A TYR 305 ? CD1 ? A TYR 305 CD1 25 1 Y 1 A TYR 305 ? CD2 ? A TYR 305 CD2 26 1 Y 1 A TYR 305 ? CE1 ? A TYR 305 CE1 27 1 Y 1 A TYR 305 ? CE2 ? A TYR 305 CE2 28 1 Y 1 A TYR 305 ? CZ ? A TYR 305 CZ 29 1 Y 1 A TYR 305 ? OH ? A TYR 305 OH 30 1 Y 1 A LEU 306 ? CG ? A LEU 306 CG 31 1 Y 1 A LEU 306 ? CD1 ? A LEU 306 CD1 32 1 Y 1 A LEU 306 ? CD2 ? A LEU 306 CD2 33 1 Y 1 A SER 307 ? OG ? A SER 307 OG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 310 ? A LEU 310 2 1 Y 1 A PHE 311 ? A PHE 311 3 1 Y 1 A GLU 312 ? A GLU 312 4 1 Y 1 A GLY 313 ? A GLY 313 5 1 Y 1 A ILE 314 ? A ILE 314 6 1 Y 1 A GLU 315 ? A GLU 315 7 1 Y 1 A GLY 316 ? A GLY 316 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LLP N1 N Y N 205 LLP C2 C Y N 206 LLP "C2'" C N N 207 LLP C3 C Y N 208 LLP O3 O N N 209 LLP C4 C Y N 210 LLP "C4'" C N N 211 LLP C5 C Y N 212 LLP C6 C Y N 213 LLP "C5'" C N N 214 LLP OP4 O N N 215 LLP P P N N 216 LLP OP1 O N N 217 LLP OP2 O N N 218 LLP OP3 O N N 219 LLP N N N N 220 LLP CA C N S 221 LLP CB C N N 222 LLP CG C N N 223 LLP CD C N N 224 LLP CE C N N 225 LLP NZ N N N 226 LLP C C N N 227 LLP O O N N 228 LLP OXT O N N 229 LLP "H2'1" H N N 230 LLP "H2'2" H N N 231 LLP "H2'3" H N N 232 LLP HO3 H N N 233 LLP "H4'1" H N N 234 LLP H6 H N N 235 LLP "H5'1" H N N 236 LLP "H5'2" H N N 237 LLP HOP2 H N N 238 LLP HOP3 H N N 239 LLP H H N N 240 LLP H2 H N N 241 LLP HA H N N 242 LLP HB2 H N N 243 LLP HB3 H N N 244 LLP HG2 H N N 245 LLP HG3 H N N 246 LLP HD2 H N N 247 LLP HD3 H N N 248 LLP HE2 H N N 249 LLP HE3 H N N 250 LLP HXT H N N 251 LYS N N N N 252 LYS CA C N S 253 LYS C C N N 254 LYS O O N N 255 LYS CB C N N 256 LYS CG C N N 257 LYS CD C N N 258 LYS CE C N N 259 LYS NZ N N N 260 LYS OXT O N N 261 LYS H H N N 262 LYS H2 H N N 263 LYS HA H N N 264 LYS HB2 H N N 265 LYS HB3 H N N 266 LYS HG2 H N N 267 LYS HG3 H N N 268 LYS HD2 H N N 269 LYS HD3 H N N 270 LYS HE2 H N N 271 LYS HE3 H N N 272 LYS HZ1 H N N 273 LYS HZ2 H N N 274 LYS HZ3 H N N 275 LYS HXT H N N 276 MET N N N N 277 MET CA C N S 278 MET C C N N 279 MET O O N N 280 MET CB C N N 281 MET CG C N N 282 MET SD S N N 283 MET CE C N N 284 MET OXT O N N 285 MET H H N N 286 MET H2 H N N 287 MET HA H N N 288 MET HB2 H N N 289 MET HB3 H N N 290 MET HG2 H N N 291 MET HG3 H N N 292 MET HE1 H N N 293 MET HE2 H N N 294 MET HE3 H N N 295 MET HXT H N N 296 PHE N N N N 297 PHE CA C N S 298 PHE C C N N 299 PHE O O N N 300 PHE CB C N N 301 PHE CG C Y N 302 PHE CD1 C Y N 303 PHE CD2 C Y N 304 PHE CE1 C Y N 305 PHE CE2 C Y N 306 PHE CZ C Y N 307 PHE OXT O N N 308 PHE H H N N 309 PHE H2 H N N 310 PHE HA H N N 311 PHE HB2 H N N 312 PHE HB3 H N N 313 PHE HD1 H N N 314 PHE HD2 H N N 315 PHE HE1 H N N 316 PHE HE2 H N N 317 PHE HZ H N N 318 PHE HXT H N N 319 PRO N N N N 320 PRO CA C N S 321 PRO C C N N 322 PRO O O N N 323 PRO CB C N N 324 PRO CG C N N 325 PRO CD C N N 326 PRO OXT O N N 327 PRO H H N N 328 PRO HA H N N 329 PRO HB2 H N N 330 PRO HB3 H N N 331 PRO HG2 H N N 332 PRO HG3 H N N 333 PRO HD2 H N N 334 PRO HD3 H N N 335 PRO HXT H N N 336 SER N N N N 337 SER CA C N S 338 SER C C N N 339 SER O O N N 340 SER CB C N N 341 SER OG O N N 342 SER OXT O N N 343 SER H H N N 344 SER H2 H N N 345 SER HA H N N 346 SER HB2 H N N 347 SER HB3 H N N 348 SER HG H N N 349 SER HXT H N N 350 THR N N N N 351 THR CA C N S 352 THR C C N N 353 THR O O N N 354 THR CB C N R 355 THR OG1 O N N 356 THR CG2 C N N 357 THR OXT O N N 358 THR H H N N 359 THR H2 H N N 360 THR HA H N N 361 THR HB H N N 362 THR HG1 H N N 363 THR HG21 H N N 364 THR HG22 H N N 365 THR HG23 H N N 366 THR HXT H N N 367 TRP N N N N 368 TRP CA C N S 369 TRP C C N N 370 TRP O O N N 371 TRP CB C N N 372 TRP CG C Y N 373 TRP CD1 C Y N 374 TRP CD2 C Y N 375 TRP NE1 N Y N 376 TRP CE2 C Y N 377 TRP CE3 C Y N 378 TRP CZ2 C Y N 379 TRP CZ3 C Y N 380 TRP CH2 C Y N 381 TRP OXT O N N 382 TRP H H N N 383 TRP H2 H N N 384 TRP HA H N N 385 TRP HB2 H N N 386 TRP HB3 H N N 387 TRP HD1 H N N 388 TRP HE1 H N N 389 TRP HE3 H N N 390 TRP HZ2 H N N 391 TRP HZ3 H N N 392 TRP HH2 H N N 393 TRP HXT H N N 394 TYR N N N N 395 TYR CA C N S 396 TYR C C N N 397 TYR O O N N 398 TYR CB C N N 399 TYR CG C Y N 400 TYR CD1 C Y N 401 TYR CD2 C Y N 402 TYR CE1 C Y N 403 TYR CE2 C Y N 404 TYR CZ C Y N 405 TYR OH O N N 406 TYR OXT O N N 407 TYR H H N N 408 TYR H2 H N N 409 TYR HA H N N 410 TYR HB2 H N N 411 TYR HB3 H N N 412 TYR HD1 H N N 413 TYR HD2 H N N 414 TYR HE1 H N N 415 TYR HE2 H N N 416 TYR HH H N N 417 TYR HXT H N N 418 VAL N N N N 419 VAL CA C N S 420 VAL C C N N 421 VAL O O N N 422 VAL CB C N N 423 VAL CG1 C N N 424 VAL CG2 C N N 425 VAL OXT O N N 426 VAL H H N N 427 VAL H2 H N N 428 VAL HA H N N 429 VAL HB H N N 430 VAL HG11 H N N 431 VAL HG12 H N N 432 VAL HG13 H N N 433 VAL HG21 H N N 434 VAL HG22 H N N 435 VAL HG23 H N N 436 VAL HXT H N N 437 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LLP N1 C2 doub Y N 194 LLP N1 C6 sing Y N 195 LLP C2 "C2'" sing N N 196 LLP C2 C3 sing Y N 197 LLP C3 O3 sing N N 198 LLP C3 C4 doub Y N 199 LLP C4 "C4'" sing N N 200 LLP C4 C5 sing Y N 201 LLP "C4'" NZ doub N N 202 LLP C5 C6 doub Y N 203 LLP C5 "C5'" sing N N 204 LLP "C5'" OP4 sing N N 205 LLP OP4 P sing N N 206 LLP P OP1 doub N N 207 LLP P OP2 sing N N 208 LLP P OP3 sing N N 209 LLP N CA sing N N 210 LLP CA CB sing N N 211 LLP CA C sing N N 212 LLP CB CG sing N N 213 LLP CG CD sing N N 214 LLP CD CE sing N N 215 LLP CE NZ sing N N 216 LLP C O doub N N 217 LLP C OXT sing N N 218 LLP "C2'" "H2'1" sing N N 219 LLP "C2'" "H2'2" sing N N 220 LLP "C2'" "H2'3" sing N N 221 LLP O3 HO3 sing N N 222 LLP "C4'" "H4'1" sing N N 223 LLP C6 H6 sing N N 224 LLP "C5'" "H5'1" sing N N 225 LLP "C5'" "H5'2" sing N N 226 LLP OP2 HOP2 sing N N 227 LLP OP3 HOP3 sing N N 228 LLP N H sing N N 229 LLP N H2 sing N N 230 LLP CA HA sing N N 231 LLP CB HB2 sing N N 232 LLP CB HB3 sing N N 233 LLP CG HG2 sing N N 234 LLP CG HG3 sing N N 235 LLP CD HD2 sing N N 236 LLP CD HD3 sing N N 237 LLP CE HE2 sing N N 238 LLP CE HE3 sing N N 239 LLP OXT HXT sing N N 240 LYS N CA sing N N 241 LYS N H sing N N 242 LYS N H2 sing N N 243 LYS CA C sing N N 244 LYS CA CB sing N N 245 LYS CA HA sing N N 246 LYS C O doub N N 247 LYS C OXT sing N N 248 LYS CB CG sing N N 249 LYS CB HB2 sing N N 250 LYS CB HB3 sing N N 251 LYS CG CD sing N N 252 LYS CG HG2 sing N N 253 LYS CG HG3 sing N N 254 LYS CD CE sing N N 255 LYS CD HD2 sing N N 256 LYS CD HD3 sing N N 257 LYS CE NZ sing N N 258 LYS CE HE2 sing N N 259 LYS CE HE3 sing N N 260 LYS NZ HZ1 sing N N 261 LYS NZ HZ2 sing N N 262 LYS NZ HZ3 sing N N 263 LYS OXT HXT sing N N 264 MET N CA sing N N 265 MET N H sing N N 266 MET N H2 sing N N 267 MET CA C sing N N 268 MET CA CB sing N N 269 MET CA HA sing N N 270 MET C O doub N N 271 MET C OXT sing N N 272 MET CB CG sing N N 273 MET CB HB2 sing N N 274 MET CB HB3 sing N N 275 MET CG SD sing N N 276 MET CG HG2 sing N N 277 MET CG HG3 sing N N 278 MET SD CE sing N N 279 MET CE HE1 sing N N 280 MET CE HE2 sing N N 281 MET CE HE3 sing N N 282 MET OXT HXT sing N N 283 PHE N CA sing N N 284 PHE N H sing N N 285 PHE N H2 sing N N 286 PHE CA C sing N N 287 PHE CA CB sing N N 288 PHE CA HA sing N N 289 PHE C O doub N N 290 PHE C OXT sing N N 291 PHE CB CG sing N N 292 PHE CB HB2 sing N N 293 PHE CB HB3 sing N N 294 PHE CG CD1 doub Y N 295 PHE CG CD2 sing Y N 296 PHE CD1 CE1 sing Y N 297 PHE CD1 HD1 sing N N 298 PHE CD2 CE2 doub Y N 299 PHE CD2 HD2 sing N N 300 PHE CE1 CZ doub Y N 301 PHE CE1 HE1 sing N N 302 PHE CE2 CZ sing Y N 303 PHE CE2 HE2 sing N N 304 PHE CZ HZ sing N N 305 PHE OXT HXT sing N N 306 PRO N CA sing N N 307 PRO N CD sing N N 308 PRO N H sing N N 309 PRO CA C sing N N 310 PRO CA CB sing N N 311 PRO CA HA sing N N 312 PRO C O doub N N 313 PRO C OXT sing N N 314 PRO CB CG sing N N 315 PRO CB HB2 sing N N 316 PRO CB HB3 sing N N 317 PRO CG CD sing N N 318 PRO CG HG2 sing N N 319 PRO CG HG3 sing N N 320 PRO CD HD2 sing N N 321 PRO CD HD3 sing N N 322 PRO OXT HXT sing N N 323 SER N CA sing N N 324 SER N H sing N N 325 SER N H2 sing N N 326 SER CA C sing N N 327 SER CA CB sing N N 328 SER CA HA sing N N 329 SER C O doub N N 330 SER C OXT sing N N 331 SER CB OG sing N N 332 SER CB HB2 sing N N 333 SER CB HB3 sing N N 334 SER OG HG sing N N 335 SER OXT HXT sing N N 336 THR N CA sing N N 337 THR N H sing N N 338 THR N H2 sing N N 339 THR CA C sing N N 340 THR CA CB sing N N 341 THR CA HA sing N N 342 THR C O doub N N 343 THR C OXT sing N N 344 THR CB OG1 sing N N 345 THR CB CG2 sing N N 346 THR CB HB sing N N 347 THR OG1 HG1 sing N N 348 THR CG2 HG21 sing N N 349 THR CG2 HG22 sing N N 350 THR CG2 HG23 sing N N 351 THR OXT HXT sing N N 352 TRP N CA sing N N 353 TRP N H sing N N 354 TRP N H2 sing N N 355 TRP CA C sing N N 356 TRP CA CB sing N N 357 TRP CA HA sing N N 358 TRP C O doub N N 359 TRP C OXT sing N N 360 TRP CB CG sing N N 361 TRP CB HB2 sing N N 362 TRP CB HB3 sing N N 363 TRP CG CD1 doub Y N 364 TRP CG CD2 sing Y N 365 TRP CD1 NE1 sing Y N 366 TRP CD1 HD1 sing N N 367 TRP CD2 CE2 doub Y N 368 TRP CD2 CE3 sing Y N 369 TRP NE1 CE2 sing Y N 370 TRP NE1 HE1 sing N N 371 TRP CE2 CZ2 sing Y N 372 TRP CE3 CZ3 doub Y N 373 TRP CE3 HE3 sing N N 374 TRP CZ2 CH2 doub Y N 375 TRP CZ2 HZ2 sing N N 376 TRP CZ3 CH2 sing Y N 377 TRP CZ3 HZ3 sing N N 378 TRP CH2 HH2 sing N N 379 TRP OXT HXT sing N N 380 TYR N CA sing N N 381 TYR N H sing N N 382 TYR N H2 sing N N 383 TYR CA C sing N N 384 TYR CA CB sing N N 385 TYR CA HA sing N N 386 TYR C O doub N N 387 TYR C OXT sing N N 388 TYR CB CG sing N N 389 TYR CB HB2 sing N N 390 TYR CB HB3 sing N N 391 TYR CG CD1 doub Y N 392 TYR CG CD2 sing Y N 393 TYR CD1 CE1 sing Y N 394 TYR CD1 HD1 sing N N 395 TYR CD2 CE2 doub Y N 396 TYR CD2 HD2 sing N N 397 TYR CE1 CZ doub Y N 398 TYR CE1 HE1 sing N N 399 TYR CE2 CZ sing Y N 400 TYR CE2 HE2 sing N N 401 TYR CZ OH sing N N 402 TYR OH HH sing N N 403 TYR OXT HXT sing N N 404 VAL N CA sing N N 405 VAL N H sing N N 406 VAL N H2 sing N N 407 VAL CA C sing N N 408 VAL CA CB sing N N 409 VAL CA HA sing N N 410 VAL C O doub N N 411 VAL C OXT sing N N 412 VAL CB CG1 sing N N 413 VAL CB CG2 sing N N 414 VAL CB HB sing N N 415 VAL CG1 HG11 sing N N 416 VAL CG1 HG12 sing N N 417 VAL CG1 HG13 sing N N 418 VAL CG2 HG21 sing N N 419 VAL CG2 HG22 sing N N 420 VAL CG2 HG23 sing N N 421 VAL OXT HXT sing N N 422 # _pdbx_audit_support.funding_organization 'Department of Biotechnology (DBT, India)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number BT/PR5236/MED/29/504/20 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id LLP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id LLP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #