data_8HGX # _entry.id 8HGX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8HGX pdb_00008hgx 10.2210/pdb8hgx/pdb WWPDB D_1300033591 ? ? BMRB 36519 ? 10.13018/BMR36519 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-11-22 2 'Structure model' 1 1 2024-05-15 3 'Structure model' 1 2 2024-06-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 3 'Structure model' citation 3 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_ASTM' 5 3 'Structure model' '_citation.journal_id_CSD' 6 3 'Structure model' '_citation.journal_id_ISSN' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.page_first' 9 3 'Structure model' '_citation.page_last' 10 3 'Structure model' '_citation.pdbx_database_id_DOI' 11 3 'Structure model' '_citation.pdbx_database_id_PubMed' 12 3 'Structure model' '_citation.title' 13 3 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8HGX _pdbx_database_status.recvd_initial_deposition_date 2022-11-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of subunit epsilon of the Acinetobacter baumannii F-ATP synthase' _pdbx_database_related.db_id 36519 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email ggrueber@ntu.edu.sg _pdbx_contact_author.name_first Gerhard _pdbx_contact_author.name_last Grueber _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5730-8319 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Shin, J.' 1 0000-0002-8669-7034 'Grueber, G.' 2 0000-0002-5730-8319 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Faseb J.' _citation.journal_id_ASTM FAJOEC _citation.journal_id_CSD 2074 _citation.journal_id_ISSN 1530-6860 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 37 _citation.language ? _citation.page_first e23040 _citation.page_last e23040 _citation.title ;Atomic insights of an up and down conformation of the Acinetobacter baumannii F 1 -ATPase subunit epsilon and deciphering the residues critical for ATP hydrolysis inhibition and ATP synthesis. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1096/fj.202300175RR _citation.pdbx_database_id_PubMed 37318822 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Saw, W.G.' 1 0000-0002-2510-387X primary 'Le, K.C.M.' 2 0000-0003-2454-9463 primary 'Shin, J.' 3 ? primary 'Kwek, J.H.M.' 4 ? primary 'Wong, C.F.' 5 0000-0002-3330-4815 primary 'Ragunathan, P.' 6 ? primary 'Fong, T.C.' 7 ? primary 'Muller, V.' 8 0000-0001-7955-5508 primary 'Gruber, G.' 9 0000-0002-5730-8319 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ATP synthase epsilon chain' _entity.formula_weight 15511.765 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ATP synthase F1 sector epsilon subunit,F-ATPase epsilon subunit' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHMATMQCDVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTLLQPGPIRVLLENGTEEIVYVSGGVLEVQP HVVTVLADTAIRADNLDEAAILEARKNAEQLLANQKSDLDSAAALAALAETAAQLETIRKIKNRAQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHMATMQCDVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTLLQPGPIRVLLENGTEEIVYVSGGVLEVQP HVVTVLADTAIRADNLDEAAILEARKNAEQLLANQKSDLDSAAALAALAETAAQLETIRKIKNRAQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 MET n 1 9 ALA n 1 10 THR n 1 11 MET n 1 12 GLN n 1 13 CYS n 1 14 ASP n 1 15 VAL n 1 16 VAL n 1 17 SER n 1 18 VAL n 1 19 LYS n 1 20 GLU n 1 21 SER n 1 22 ILE n 1 23 TYR n 1 24 SER n 1 25 GLY n 1 26 ALA n 1 27 VAL n 1 28 THR n 1 29 MET n 1 30 LEU n 1 31 ILE n 1 32 ALA n 1 33 LYS n 1 34 GLY n 1 35 ALA n 1 36 GLY n 1 37 GLY n 1 38 GLU n 1 39 LEU n 1 40 GLY n 1 41 ILE n 1 42 LEU n 1 43 PRO n 1 44 GLY n 1 45 HIS n 1 46 ALA n 1 47 PRO n 1 48 LEU n 1 49 VAL n 1 50 THR n 1 51 LEU n 1 52 LEU n 1 53 GLN n 1 54 PRO n 1 55 GLY n 1 56 PRO n 1 57 ILE n 1 58 ARG n 1 59 VAL n 1 60 LEU n 1 61 LEU n 1 62 GLU n 1 63 ASN n 1 64 GLY n 1 65 THR n 1 66 GLU n 1 67 GLU n 1 68 ILE n 1 69 VAL n 1 70 TYR n 1 71 VAL n 1 72 SER n 1 73 GLY n 1 74 GLY n 1 75 VAL n 1 76 LEU n 1 77 GLU n 1 78 VAL n 1 79 GLN n 1 80 PRO n 1 81 HIS n 1 82 VAL n 1 83 VAL n 1 84 THR n 1 85 VAL n 1 86 LEU n 1 87 ALA n 1 88 ASP n 1 89 THR n 1 90 ALA n 1 91 ILE n 1 92 ARG n 1 93 ALA n 1 94 ASP n 1 95 ASN n 1 96 LEU n 1 97 ASP n 1 98 GLU n 1 99 ALA n 1 100 ALA n 1 101 ILE n 1 102 LEU n 1 103 GLU n 1 104 ALA n 1 105 ARG n 1 106 LYS n 1 107 ASN n 1 108 ALA n 1 109 GLU n 1 110 GLN n 1 111 LEU n 1 112 LEU n 1 113 ALA n 1 114 ASN n 1 115 GLN n 1 116 LYS n 1 117 SER n 1 118 ASP n 1 119 LEU n 1 120 ASP n 1 121 SER n 1 122 ALA n 1 123 ALA n 1 124 ALA n 1 125 LEU n 1 126 ALA n 1 127 ALA n 1 128 LEU n 1 129 ALA n 1 130 GLU n 1 131 THR n 1 132 ALA n 1 133 ALA n 1 134 GLN n 1 135 LEU n 1 136 GLU n 1 137 THR n 1 138 ILE n 1 139 ARG n 1 140 LYS n 1 141 ILE n 1 142 LYS n 1 143 ASN n 1 144 ARG n 1 145 ALA n 1 146 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 146 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;atpC, A7M90_08520, AB945B12_00682, Aba9201_12755, ABCAM1_0172, ABKPCSM17A_01727, ABR2091_0173, ABUW_3731, ACX61_17950, APC21_14385, APD31_00885, AUO97_06420, AYR68_18050, B7L45_18620, B9X95_01230, BAA1790NC_3496, BS065_18355, C2U32_15275, C6N18_19570, CBE85_14435, CBL15_17785, CSB70_3895, CTZ19_18500, D8O08_000335, DLI71_10775, DLI72_06180, DOL94_02920, DVA69_09710, E1A86_02075, E1A87_05110, E2532_15790, E2533_14640, E2534_11110, E2535_10530, E2536_13180, E2538_11270, E2539_11975, E2540_15325, E2541_09260, EA686_08570, EA706_05510, EA720_009765, EA722_10625, EGM95_19705, EKS29_01635, EWO96_15825, F2P40_12650, F4T85_15175, FDN00_02385, FE003_18665, FJU36_14065, FJU42_13255, FJU76_16610, FR761_02125, G3N53_14500, GNY86_14290, GSE42_00725, H0529_15450, H1058_00785, HB367_12610, HBK86_18985, HIN86_18905, IMO23_00750, NCTC13305_02274, NCTC13421_03737, SAMEA104305318_03328, SAMEA104305340_02247, SAMEA104305385_03000, SI89_14475 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Acinetobacter baumannii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 470 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -6 ? ? ? A . n A 1 2 HIS 2 -5 ? ? ? A . n A 1 3 HIS 3 -4 ? ? ? A . n A 1 4 HIS 4 -3 ? ? ? A . n A 1 5 HIS 5 -2 ? ? ? A . n A 1 6 HIS 6 -1 ? ? ? A . n A 1 7 HIS 7 0 ? ? ? A . n A 1 8 MET 8 1 1 MET MET A . n A 1 9 ALA 9 2 2 ALA ALA A . n A 1 10 THR 10 3 3 THR THR A . n A 1 11 MET 11 4 4 MET MET A . n A 1 12 GLN 12 5 5 GLN GLN A . n A 1 13 CYS 13 6 6 CYS CYS A . n A 1 14 ASP 14 7 7 ASP ASP A . n A 1 15 VAL 15 8 8 VAL VAL A . n A 1 16 VAL 16 9 9 VAL VAL A . n A 1 17 SER 17 10 10 SER SER A . n A 1 18 VAL 18 11 11 VAL VAL A . n A 1 19 LYS 19 12 12 LYS LYS A . n A 1 20 GLU 20 13 13 GLU GLU A . n A 1 21 SER 21 14 14 SER SER A . n A 1 22 ILE 22 15 15 ILE ILE A . n A 1 23 TYR 23 16 16 TYR TYR A . n A 1 24 SER 24 17 17 SER SER A . n A 1 25 GLY 25 18 18 GLY GLY A . n A 1 26 ALA 26 19 19 ALA ALA A . n A 1 27 VAL 27 20 20 VAL VAL A . n A 1 28 THR 28 21 21 THR THR A . n A 1 29 MET 29 22 22 MET MET A . n A 1 30 LEU 30 23 23 LEU LEU A . n A 1 31 ILE 31 24 24 ILE ILE A . n A 1 32 ALA 32 25 25 ALA ALA A . n A 1 33 LYS 33 26 26 LYS LYS A . n A 1 34 GLY 34 27 27 GLY GLY A . n A 1 35 ALA 35 28 28 ALA ALA A . n A 1 36 GLY 36 29 29 GLY GLY A . n A 1 37 GLY 37 30 30 GLY GLY A . n A 1 38 GLU 38 31 31 GLU GLU A . n A 1 39 LEU 39 32 32 LEU LEU A . n A 1 40 GLY 40 33 33 GLY GLY A . n A 1 41 ILE 41 34 34 ILE ILE A . n A 1 42 LEU 42 35 35 LEU LEU A . n A 1 43 PRO 43 36 36 PRO PRO A . n A 1 44 GLY 44 37 37 GLY GLY A . n A 1 45 HIS 45 38 38 HIS HIS A . n A 1 46 ALA 46 39 39 ALA ALA A . n A 1 47 PRO 47 40 40 PRO PRO A . n A 1 48 LEU 48 41 41 LEU LEU A . n A 1 49 VAL 49 42 42 VAL VAL A . n A 1 50 THR 50 43 43 THR THR A . n A 1 51 LEU 51 44 44 LEU LEU A . n A 1 52 LEU 52 45 45 LEU LEU A . n A 1 53 GLN 53 46 46 GLN GLN A . n A 1 54 PRO 54 47 47 PRO PRO A . n A 1 55 GLY 55 48 48 GLY GLY A . n A 1 56 PRO 56 49 49 PRO PRO A . n A 1 57 ILE 57 50 50 ILE ILE A . n A 1 58 ARG 58 51 51 ARG ARG A . n A 1 59 VAL 59 52 52 VAL VAL A . n A 1 60 LEU 60 53 53 LEU LEU A . n A 1 61 LEU 61 54 54 LEU LEU A . n A 1 62 GLU 62 55 55 GLU GLU A . n A 1 63 ASN 63 56 56 ASN ASN A . n A 1 64 GLY 64 57 57 GLY GLY A . n A 1 65 THR 65 58 58 THR THR A . n A 1 66 GLU 66 59 59 GLU GLU A . n A 1 67 GLU 67 60 60 GLU GLU A . n A 1 68 ILE 68 61 61 ILE ILE A . n A 1 69 VAL 69 62 62 VAL VAL A . n A 1 70 TYR 70 63 63 TYR TYR A . n A 1 71 VAL 71 64 64 VAL VAL A . n A 1 72 SER 72 65 65 SER SER A . n A 1 73 GLY 73 66 66 GLY GLY A . n A 1 74 GLY 74 67 67 GLY GLY A . n A 1 75 VAL 75 68 68 VAL VAL A . n A 1 76 LEU 76 69 69 LEU LEU A . n A 1 77 GLU 77 70 70 GLU GLU A . n A 1 78 VAL 78 71 71 VAL VAL A . n A 1 79 GLN 79 72 72 GLN GLN A . n A 1 80 PRO 80 73 73 PRO PRO A . n A 1 81 HIS 81 74 74 HIS HIS A . n A 1 82 VAL 82 75 75 VAL VAL A . n A 1 83 VAL 83 76 76 VAL VAL A . n A 1 84 THR 84 77 77 THR THR A . n A 1 85 VAL 85 78 78 VAL VAL A . n A 1 86 LEU 86 79 79 LEU LEU A . n A 1 87 ALA 87 80 80 ALA ALA A . n A 1 88 ASP 88 81 81 ASP ASP A . n A 1 89 THR 89 82 82 THR THR A . n A 1 90 ALA 90 83 83 ALA ALA A . n A 1 91 ILE 91 84 84 ILE ILE A . n A 1 92 ARG 92 85 85 ARG ARG A . n A 1 93 ALA 93 86 86 ALA ALA A . n A 1 94 ASP 94 87 87 ASP ASP A . n A 1 95 ASN 95 88 88 ASN ASN A . n A 1 96 LEU 96 89 89 LEU LEU A . n A 1 97 ASP 97 90 90 ASP ASP A . n A 1 98 GLU 98 91 91 GLU GLU A . n A 1 99 ALA 99 92 92 ALA ALA A . n A 1 100 ALA 100 93 93 ALA ALA A . n A 1 101 ILE 101 94 94 ILE ILE A . n A 1 102 LEU 102 95 95 LEU LEU A . n A 1 103 GLU 103 96 96 GLU GLU A . n A 1 104 ALA 104 97 97 ALA ALA A . n A 1 105 ARG 105 98 98 ARG ARG A . n A 1 106 LYS 106 99 99 LYS LYS A . n A 1 107 ASN 107 100 100 ASN ASN A . n A 1 108 ALA 108 101 101 ALA ALA A . n A 1 109 GLU 109 102 102 GLU GLU A . n A 1 110 GLN 110 103 103 GLN GLN A . n A 1 111 LEU 111 104 104 LEU LEU A . n A 1 112 LEU 112 105 105 LEU LEU A . n A 1 113 ALA 113 106 106 ALA ALA A . n A 1 114 ASN 114 107 107 ASN ASN A . n A 1 115 GLN 115 108 108 GLN GLN A . n A 1 116 LYS 116 109 109 LYS LYS A . n A 1 117 SER 117 110 110 SER SER A . n A 1 118 ASP 118 111 111 ASP ASP A . n A 1 119 LEU 119 112 112 LEU LEU A . n A 1 120 ASP 120 113 113 ASP ASP A . n A 1 121 SER 121 114 114 SER SER A . n A 1 122 ALA 122 115 115 ALA ALA A . n A 1 123 ALA 123 116 116 ALA ALA A . n A 1 124 ALA 124 117 117 ALA ALA A . n A 1 125 LEU 125 118 118 LEU LEU A . n A 1 126 ALA 126 119 119 ALA ALA A . n A 1 127 ALA 127 120 120 ALA ALA A . n A 1 128 LEU 128 121 121 LEU LEU A . n A 1 129 ALA 129 122 122 ALA ALA A . n A 1 130 GLU 130 123 123 GLU GLU A . n A 1 131 THR 131 124 124 THR THR A . n A 1 132 ALA 132 125 125 ALA ALA A . n A 1 133 ALA 133 126 126 ALA ALA A . n A 1 134 GLN 134 127 127 GLN GLN A . n A 1 135 LEU 135 128 128 LEU LEU A . n A 1 136 GLU 136 129 129 GLU GLU A . n A 1 137 THR 137 130 130 THR THR A . n A 1 138 ILE 138 131 131 ILE ILE A . n A 1 139 ARG 139 132 132 ARG ARG A . n A 1 140 LYS 140 133 133 LYS LYS A . n A 1 141 ILE 141 134 134 ILE ILE A . n A 1 142 LYS 142 135 135 LYS LYS A . n A 1 143 ASN 143 136 136 ASN ASN A . n A 1 144 ARG 144 137 137 ARG ARG A . n A 1 145 ALA 145 138 138 ALA ALA A . n A 1 146 GLN 146 139 139 GLN GLN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8HGX _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8HGX _struct.title 'NMR solution structure of subunit epsilon of the Acinetobacter baumannii F-ATP synthase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8HGX _struct_keywords.text 'F-ATP synthase, subunit eosilon, bioenergetics, Acinetobacter, baumannii, ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code V5VHG0_ACIBA _struct_ref.pdbx_db_accession V5VHG0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MATMQCDVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTLLQPGPIRVLLENGTEEIVYVSGGVLEVQPHVVTVLA DTAIRADNLDEAAILEARKNAEQLLANQKSDLDSAAALAALAETAAQLETIRKIKNRAQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8HGX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 146 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession V5VHG0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 139 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 139 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8HGX MET A 1 ? UNP V5VHG0 ? ? 'initiating methionine' -6 1 1 8HGX HIS A 2 ? UNP V5VHG0 ? ? 'expression tag' -5 2 1 8HGX HIS A 3 ? UNP V5VHG0 ? ? 'expression tag' -4 3 1 8HGX HIS A 4 ? UNP V5VHG0 ? ? 'expression tag' -3 4 1 8HGX HIS A 5 ? UNP V5VHG0 ? ? 'expression tag' -2 5 1 8HGX HIS A 6 ? UNP V5VHG0 ? ? 'expression tag' -1 6 1 8HGX HIS A 7 ? UNP V5VHG0 ? ? 'expression tag' 0 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 97 ? ASN A 114 ? ASP A 90 ASN A 107 1 ? 18 HELX_P HELX_P2 AA2 SER A 117 ? ASN A 143 ? SER A 110 ASN A 136 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 21 ? VAL A 27 ? SER A 14 VAL A 20 AA1 2 MET A 11 ? SER A 17 ? MET A 4 SER A 10 AA1 3 VAL A 82 ? ALA A 87 ? VAL A 75 ALA A 80 AA1 4 GLY A 74 ? VAL A 78 ? GLY A 67 VAL A 71 AA1 5 LEU A 48 ? LEU A 52 ? LEU A 41 LEU A 45 AA2 1 GLY A 37 ? ILE A 41 ? GLY A 30 ILE A 34 AA2 2 MET A 29 ? GLY A 34 ? MET A 22 GLY A 27 AA2 3 GLY A 55 ? LEU A 60 ? GLY A 48 LEU A 53 AA2 4 GLU A 66 ? VAL A 71 ? GLU A 59 VAL A 64 AA2 5 ALA A 90 ? ARG A 92 ? ALA A 83 ARG A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 22 ? O ILE A 15 N VAL A 15 ? N VAL A 8 AA1 2 3 N GLN A 12 ? N GLN A 5 O VAL A 83 ? O VAL A 76 AA1 3 4 O LEU A 86 ? O LEU A 79 N VAL A 75 ? N VAL A 68 AA1 4 5 O VAL A 78 ? O VAL A 71 N LEU A 48 ? N LEU A 41 AA2 1 2 O GLY A 37 ? O GLY A 30 N GLY A 34 ? N GLY A 27 AA2 2 3 N MET A 29 ? N MET A 22 O LEU A 60 ? O LEU A 53 AA2 3 4 N ILE A 57 ? N ILE A 50 O VAL A 69 ? O VAL A 62 AA2 4 5 N TYR A 70 ? N TYR A 63 O ILE A 91 ? O ILE A 84 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -59.82 172.50 2 1 GLU A 13 ? ? 157.71 174.46 3 1 SER A 17 ? ? -175.33 103.99 4 1 MET A 22 ? ? -173.10 139.63 5 1 PRO A 36 ? ? -49.52 109.78 6 1 ASN A 136 ? ? -107.78 -74.22 7 1 ALA A 138 ? ? -116.23 63.66 8 2 GLU A 13 ? ? 157.65 175.69 9 2 SER A 17 ? ? -173.13 104.04 10 2 MET A 22 ? ? 179.33 145.65 11 2 PRO A 36 ? ? -51.61 107.98 12 2 ASP A 90 ? ? -65.99 84.57 13 2 ARG A 137 ? ? -150.98 -43.73 14 3 ALA A 2 ? ? -59.72 171.27 15 3 GLU A 13 ? ? 159.19 173.67 16 3 SER A 17 ? ? -175.24 104.11 17 3 ALA A 138 ? ? -108.24 61.34 18 4 GLU A 13 ? ? 157.31 175.18 19 4 SER A 17 ? ? -168.76 104.12 20 4 MET A 22 ? ? 174.82 153.33 21 4 GLN A 108 ? ? -55.71 103.22 22 4 ASN A 136 ? ? -155.99 -44.64 23 4 ALA A 138 ? ? -114.77 60.24 24 5 ALA A 2 ? ? 59.79 162.08 25 5 GLU A 13 ? ? 156.04 174.55 26 5 SER A 17 ? ? -175.18 104.01 27 5 ALA A 138 ? ? -112.13 63.47 28 6 GLU A 13 ? ? 156.69 173.82 29 6 ILE A 15 ? ? -100.18 -67.93 30 6 SER A 17 ? ? -175.27 104.10 31 6 ALA A 138 ? ? -109.90 60.93 32 7 GLU A 13 ? ? 156.04 173.54 33 7 ILE A 15 ? ? -121.91 -58.52 34 7 SER A 17 ? ? -175.20 104.03 35 7 MET A 22 ? ? -171.78 138.26 36 7 PRO A 36 ? ? -49.88 107.12 37 7 ARG A 137 ? ? 70.84 31.91 38 7 ALA A 138 ? ? -114.79 63.53 39 8 ALA A 2 ? ? 57.53 167.96 40 8 GLU A 13 ? ? 157.82 174.19 41 8 ILE A 15 ? ? -121.21 -53.15 42 8 SER A 17 ? ? -175.16 104.10 43 8 MET A 22 ? ? -174.82 143.50 44 8 PRO A 36 ? ? -48.33 108.56 45 8 ASP A 90 ? ? -60.61 93.68 46 8 ALA A 138 ? ? -106.98 61.91 47 9 GLU A 13 ? ? 158.89 175.56 48 9 SER A 17 ? ? -168.52 104.01 49 9 ASP A 90 ? ? -68.85 94.00 50 10 GLU A 13 ? ? 155.83 175.20 51 10 SER A 17 ? ? -175.25 104.06 52 11 ALA A 2 ? ? 61.30 154.05 53 11 GLU A 13 ? ? 156.13 174.43 54 11 ILE A 15 ? ? -124.81 -57.70 55 11 SER A 17 ? ? -175.17 104.08 56 11 MET A 22 ? ? -171.82 137.56 57 11 ASP A 90 ? ? -59.06 96.90 58 11 ALA A 138 ? ? -109.55 58.15 59 12 GLU A 13 ? ? 157.28 174.16 60 12 SER A 17 ? ? -175.22 104.16 61 12 MET A 22 ? ? -176.11 133.01 62 12 ASN A 136 ? ? -100.54 -62.11 63 12 ALA A 138 ? ? -113.42 62.61 64 13 ALA A 2 ? ? 59.86 166.84 65 13 GLU A 13 ? ? 157.01 174.25 66 13 SER A 17 ? ? -175.30 104.02 67 13 MET A 22 ? ? -171.86 139.28 68 13 PRO A 36 ? ? -48.77 108.42 69 13 LYS A 109 ? ? -130.94 -46.25 70 13 ALA A 138 ? ? -109.31 58.63 71 14 ALA A 2 ? ? -59.29 172.60 72 14 GLU A 13 ? ? 158.43 175.12 73 14 SER A 17 ? ? -175.25 104.01 74 14 ARG A 137 ? ? 178.18 -37.47 75 15 GLU A 13 ? ? 157.18 176.33 76 15 SER A 17 ? ? -175.26 104.02 77 15 PRO A 36 ? ? -52.88 109.83 78 15 ARG A 137 ? ? -140.20 21.27 79 15 ALA A 138 ? ? -98.21 55.02 80 16 ALA A 2 ? ? 62.28 147.92 81 16 GLU A 13 ? ? 156.11 174.10 82 16 ILE A 15 ? ? -124.02 -53.33 83 16 SER A 17 ? ? -175.24 104.01 84 16 ASP A 90 ? ? -57.99 92.44 85 16 LYS A 109 ? ? -157.12 -45.73 86 16 ALA A 138 ? ? -110.68 64.46 87 17 GLU A 13 ? ? 156.30 174.00 88 17 ILE A 15 ? ? -125.30 -60.11 89 17 SER A 17 ? ? -175.28 104.13 90 17 MET A 22 ? ? 178.09 158.07 91 17 ASN A 136 ? ? -104.50 -61.51 92 17 ARG A 137 ? ? 70.42 34.17 93 17 ALA A 138 ? ? -116.83 63.13 94 18 ALA A 2 ? ? 60.60 156.72 95 18 GLU A 13 ? ? 156.71 173.71 96 18 ILE A 15 ? ? -122.87 -51.02 97 18 SER A 17 ? ? -175.17 104.08 98 18 LYS A 109 ? ? -133.08 -46.00 99 18 ASN A 136 ? ? -145.71 -44.55 100 18 ALA A 138 ? ? -108.54 59.83 101 19 GLU A 13 ? ? 158.37 174.33 102 19 SER A 17 ? ? -174.18 104.08 103 19 MET A 22 ? ? -174.06 139.65 104 19 PRO A 36 ? ? -53.25 108.85 105 19 ALA A 138 ? ? -110.54 62.38 106 20 GLU A 13 ? ? 158.22 174.72 107 20 SER A 17 ? ? -175.16 104.08 108 20 ARG A 137 ? ? 78.24 -57.99 109 20 ALA A 138 ? ? 74.65 60.35 110 21 GLU A 13 ? ? 157.66 173.57 111 21 ILE A 15 ? ? -122.12 -58.22 112 21 SER A 17 ? ? -175.23 104.12 113 21 MET A 22 ? ? -172.57 148.01 114 21 LYS A 109 ? ? -133.59 -46.18 115 21 ASN A 136 ? ? -106.36 -62.54 116 21 ALA A 138 ? ? -111.84 62.74 # _pdbx_nmr_ensemble.entry_id 8HGX _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8HGX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;0.5 mM [U-100% 15N] A. baumannii F-ATP synthase subunit epsilon, 20 mM sodium phosphate, 100 mM sodium chloride, 0.01 % w/v sodium azide, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N_sample solution ? 2 ;0.5 mM [U-100% 15N] A. baumannii F-ATP synthase subunit epsilon, 20 mM sodium phosphate, 100 mM sodium chloride, 0.01 % w/v sodium azide, 90% H2O/10% D2O ; '90% H2O/10% D2O' 13C15N_sample solution ? 3 ;0.5 mM [U-100% 15N] A. baumannii F-ATP synthase subunit epsilon, 20 mM sodium phosphate, 100 mM sodium chloride, 0.01 % w/v sodium azide, 100% D2O ; '100% D2O' 13C15N_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'A. baumannii F-ATP synthase subunit epsilon' 0.5 ? mM '[U-100% 15N]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 100 ? mM 'natural abundance' 1 'sodium azide' 0.01 ? '% w/v' 'natural abundance' 2 'A. baumannii F-ATP synthase subunit epsilon' 0.5 ? mM '[U-100% 15N]' 2 'sodium phosphate' 20 ? mM 'natural abundance' 2 'sodium chloride' 100 ? mM 'natural abundance' 2 'sodium azide' 0.01 ? '% w/v' 'natural abundance' 3 'A. baumannii F-ATP synthase subunit epsilon' 0.5 ? mM '[U-100% 15N]' 3 'sodium phosphate' 20 ? mM 'natural abundance' 3 'sodium chloride' 100 ? mM 'natural abundance' 3 'sodium azide' 0.01 ? '% w/v' 'natural abundance' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 7 100 ? ? mM 15N_1 ? pH ? ? K 2 298 atm 1 7 100 ? ? mM 13C15N_1 ? pH ? ? K 3 298 atm 1 7 100 ? ? mM 13C15N_2 ? pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 2 2 '3D HNCACB' 1 isotropic 3 2 2 '3D CBCA(CO)NH' 1 isotropic 4 2 2 '3D HNCA' 1 isotropic 5 2 2 '3D HN(CO)CA' 1 isotropic 6 1 1 '3D 1H-15N NOESY' 1 isotropic 7 3 3 '3D HCCH-TOCSY' 1 isotropic 8 3 3 '3D 1H-13C NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 8HGX _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 8 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 5 collection TopSpin ? 'Bruker Biospin' 6 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 7 processing NMRDraw ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'data analysis' Sparky ? Goddard 4 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 8 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -6 ? A MET 1 2 1 Y 1 A HIS -5 ? A HIS 2 3 1 Y 1 A HIS -4 ? A HIS 3 4 1 Y 1 A HIS -3 ? A HIS 4 5 1 Y 1 A HIS -2 ? A HIS 5 6 1 Y 1 A HIS -1 ? A HIS 6 7 1 Y 1 A HIS 0 ? A HIS 7 8 2 Y 1 A MET -6 ? A MET 1 9 2 Y 1 A HIS -5 ? A HIS 2 10 2 Y 1 A HIS -4 ? A HIS 3 11 2 Y 1 A HIS -3 ? A HIS 4 12 2 Y 1 A HIS -2 ? A HIS 5 13 2 Y 1 A HIS -1 ? A HIS 6 14 2 Y 1 A HIS 0 ? A HIS 7 15 3 Y 1 A MET -6 ? A MET 1 16 3 Y 1 A HIS -5 ? A HIS 2 17 3 Y 1 A HIS -4 ? A HIS 3 18 3 Y 1 A HIS -3 ? A HIS 4 19 3 Y 1 A HIS -2 ? A HIS 5 20 3 Y 1 A HIS -1 ? A HIS 6 21 3 Y 1 A HIS 0 ? A HIS 7 22 4 Y 1 A MET -6 ? A MET 1 23 4 Y 1 A HIS -5 ? A HIS 2 24 4 Y 1 A HIS -4 ? A HIS 3 25 4 Y 1 A HIS -3 ? A HIS 4 26 4 Y 1 A HIS -2 ? A HIS 5 27 4 Y 1 A HIS -1 ? A HIS 6 28 4 Y 1 A HIS 0 ? A HIS 7 29 5 Y 1 A MET -6 ? A MET 1 30 5 Y 1 A HIS -5 ? A HIS 2 31 5 Y 1 A HIS -4 ? A HIS 3 32 5 Y 1 A HIS -3 ? A HIS 4 33 5 Y 1 A HIS -2 ? A HIS 5 34 5 Y 1 A HIS -1 ? A HIS 6 35 5 Y 1 A HIS 0 ? A HIS 7 36 6 Y 1 A MET -6 ? A MET 1 37 6 Y 1 A HIS -5 ? A HIS 2 38 6 Y 1 A HIS -4 ? A HIS 3 39 6 Y 1 A HIS -3 ? A HIS 4 40 6 Y 1 A HIS -2 ? A HIS 5 41 6 Y 1 A HIS -1 ? A HIS 6 42 6 Y 1 A HIS 0 ? A HIS 7 43 7 Y 1 A MET -6 ? A MET 1 44 7 Y 1 A HIS -5 ? A HIS 2 45 7 Y 1 A HIS -4 ? A HIS 3 46 7 Y 1 A HIS -3 ? A HIS 4 47 7 Y 1 A HIS -2 ? A HIS 5 48 7 Y 1 A HIS -1 ? A HIS 6 49 7 Y 1 A HIS 0 ? A HIS 7 50 8 Y 1 A MET -6 ? A MET 1 51 8 Y 1 A HIS -5 ? A HIS 2 52 8 Y 1 A HIS -4 ? A HIS 3 53 8 Y 1 A HIS -3 ? A HIS 4 54 8 Y 1 A HIS -2 ? A HIS 5 55 8 Y 1 A HIS -1 ? A HIS 6 56 8 Y 1 A HIS 0 ? A HIS 7 57 9 Y 1 A MET -6 ? A MET 1 58 9 Y 1 A HIS -5 ? A HIS 2 59 9 Y 1 A HIS -4 ? A HIS 3 60 9 Y 1 A HIS -3 ? A HIS 4 61 9 Y 1 A HIS -2 ? A HIS 5 62 9 Y 1 A HIS -1 ? A HIS 6 63 9 Y 1 A HIS 0 ? A HIS 7 64 10 Y 1 A MET -6 ? A MET 1 65 10 Y 1 A HIS -5 ? A HIS 2 66 10 Y 1 A HIS -4 ? A HIS 3 67 10 Y 1 A HIS -3 ? A HIS 4 68 10 Y 1 A HIS -2 ? A HIS 5 69 10 Y 1 A HIS -1 ? A HIS 6 70 10 Y 1 A HIS 0 ? A HIS 7 71 11 Y 1 A MET -6 ? A MET 1 72 11 Y 1 A HIS -5 ? A HIS 2 73 11 Y 1 A HIS -4 ? A HIS 3 74 11 Y 1 A HIS -3 ? A HIS 4 75 11 Y 1 A HIS -2 ? A HIS 5 76 11 Y 1 A HIS -1 ? A HIS 6 77 11 Y 1 A HIS 0 ? A HIS 7 78 12 Y 1 A MET -6 ? A MET 1 79 12 Y 1 A HIS -5 ? A HIS 2 80 12 Y 1 A HIS -4 ? A HIS 3 81 12 Y 1 A HIS -3 ? A HIS 4 82 12 Y 1 A HIS -2 ? A HIS 5 83 12 Y 1 A HIS -1 ? A HIS 6 84 12 Y 1 A HIS 0 ? A HIS 7 85 13 Y 1 A MET -6 ? A MET 1 86 13 Y 1 A HIS -5 ? A HIS 2 87 13 Y 1 A HIS -4 ? A HIS 3 88 13 Y 1 A HIS -3 ? A HIS 4 89 13 Y 1 A HIS -2 ? A HIS 5 90 13 Y 1 A HIS -1 ? A HIS 6 91 13 Y 1 A HIS 0 ? A HIS 7 92 14 Y 1 A MET -6 ? A MET 1 93 14 Y 1 A HIS -5 ? A HIS 2 94 14 Y 1 A HIS -4 ? A HIS 3 95 14 Y 1 A HIS -3 ? A HIS 4 96 14 Y 1 A HIS -2 ? A HIS 5 97 14 Y 1 A HIS -1 ? A HIS 6 98 14 Y 1 A HIS 0 ? A HIS 7 99 15 Y 1 A MET -6 ? A MET 1 100 15 Y 1 A HIS -5 ? A HIS 2 101 15 Y 1 A HIS -4 ? A HIS 3 102 15 Y 1 A HIS -3 ? A HIS 4 103 15 Y 1 A HIS -2 ? A HIS 5 104 15 Y 1 A HIS -1 ? A HIS 6 105 15 Y 1 A HIS 0 ? A HIS 7 106 16 Y 1 A MET -6 ? A MET 1 107 16 Y 1 A HIS -5 ? A HIS 2 108 16 Y 1 A HIS -4 ? A HIS 3 109 16 Y 1 A HIS -3 ? A HIS 4 110 16 Y 1 A HIS -2 ? A HIS 5 111 16 Y 1 A HIS -1 ? A HIS 6 112 16 Y 1 A HIS 0 ? A HIS 7 113 17 Y 1 A MET -6 ? A MET 1 114 17 Y 1 A HIS -5 ? A HIS 2 115 17 Y 1 A HIS -4 ? A HIS 3 116 17 Y 1 A HIS -3 ? A HIS 4 117 17 Y 1 A HIS -2 ? A HIS 5 118 17 Y 1 A HIS -1 ? A HIS 6 119 17 Y 1 A HIS 0 ? A HIS 7 120 18 Y 1 A MET -6 ? A MET 1 121 18 Y 1 A HIS -5 ? A HIS 2 122 18 Y 1 A HIS -4 ? A HIS 3 123 18 Y 1 A HIS -3 ? A HIS 4 124 18 Y 1 A HIS -2 ? A HIS 5 125 18 Y 1 A HIS -1 ? A HIS 6 126 18 Y 1 A HIS 0 ? A HIS 7 127 19 Y 1 A MET -6 ? A MET 1 128 19 Y 1 A HIS -5 ? A HIS 2 129 19 Y 1 A HIS -4 ? A HIS 3 130 19 Y 1 A HIS -3 ? A HIS 4 131 19 Y 1 A HIS -2 ? A HIS 5 132 19 Y 1 A HIS -1 ? A HIS 6 133 19 Y 1 A HIS 0 ? A HIS 7 134 20 Y 1 A MET -6 ? A MET 1 135 20 Y 1 A HIS -5 ? A HIS 2 136 20 Y 1 A HIS -4 ? A HIS 3 137 20 Y 1 A HIS -3 ? A HIS 4 138 20 Y 1 A HIS -2 ? A HIS 5 139 20 Y 1 A HIS -1 ? A HIS 6 140 20 Y 1 A HIS 0 ? A HIS 7 141 21 Y 1 A MET -6 ? A MET 1 142 21 Y 1 A HIS -5 ? A HIS 2 143 21 Y 1 A HIS -4 ? A HIS 3 144 21 Y 1 A HIS -3 ? A HIS 4 145 21 Y 1 A HIS -2 ? A HIS 5 146 21 Y 1 A HIS -1 ? A HIS 6 147 21 Y 1 A HIS 0 ? A HIS 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PRO N N N N 247 PRO CA C N S 248 PRO C C N N 249 PRO O O N N 250 PRO CB C N N 251 PRO CG C N N 252 PRO CD C N N 253 PRO OXT O N N 254 PRO H H N N 255 PRO HA H N N 256 PRO HB2 H N N 257 PRO HB3 H N N 258 PRO HG2 H N N 259 PRO HG3 H N N 260 PRO HD2 H N N 261 PRO HD3 H N N 262 PRO HXT H N N 263 SER N N N N 264 SER CA C N S 265 SER C C N N 266 SER O O N N 267 SER CB C N N 268 SER OG O N N 269 SER OXT O N N 270 SER H H N N 271 SER H2 H N N 272 SER HA H N N 273 SER HB2 H N N 274 SER HB3 H N N 275 SER HG H N N 276 SER HXT H N N 277 THR N N N N 278 THR CA C N S 279 THR C C N N 280 THR O O N N 281 THR CB C N R 282 THR OG1 O N N 283 THR CG2 C N N 284 THR OXT O N N 285 THR H H N N 286 THR H2 H N N 287 THR HA H N N 288 THR HB H N N 289 THR HG1 H N N 290 THR HG21 H N N 291 THR HG22 H N N 292 THR HG23 H N N 293 THR HXT H N N 294 TYR N N N N 295 TYR CA C N S 296 TYR C C N N 297 TYR O O N N 298 TYR CB C N N 299 TYR CG C Y N 300 TYR CD1 C Y N 301 TYR CD2 C Y N 302 TYR CE1 C Y N 303 TYR CE2 C Y N 304 TYR CZ C Y N 305 TYR OH O N N 306 TYR OXT O N N 307 TYR H H N N 308 TYR H2 H N N 309 TYR HA H N N 310 TYR HB2 H N N 311 TYR HB3 H N N 312 TYR HD1 H N N 313 TYR HD2 H N N 314 TYR HE1 H N N 315 TYR HE2 H N N 316 TYR HH H N N 317 TYR HXT H N N 318 VAL N N N N 319 VAL CA C N S 320 VAL C C N N 321 VAL O O N N 322 VAL CB C N N 323 VAL CG1 C N N 324 VAL CG2 C N N 325 VAL OXT O N N 326 VAL H H N N 327 VAL H2 H N N 328 VAL HA H N N 329 VAL HB H N N 330 VAL HG11 H N N 331 VAL HG12 H N N 332 VAL HG13 H N N 333 VAL HG21 H N N 334 VAL HG22 H N N 335 VAL HG23 H N N 336 VAL HXT H N N 337 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PRO N CA sing N N 235 PRO N CD sing N N 236 PRO N H sing N N 237 PRO CA C sing N N 238 PRO CA CB sing N N 239 PRO CA HA sing N N 240 PRO C O doub N N 241 PRO C OXT sing N N 242 PRO CB CG sing N N 243 PRO CB HB2 sing N N 244 PRO CB HB3 sing N N 245 PRO CG CD sing N N 246 PRO CG HG2 sing N N 247 PRO CG HG3 sing N N 248 PRO CD HD2 sing N N 249 PRO CD HD3 sing N N 250 PRO OXT HXT sing N N 251 SER N CA sing N N 252 SER N H sing N N 253 SER N H2 sing N N 254 SER CA C sing N N 255 SER CA CB sing N N 256 SER CA HA sing N N 257 SER C O doub N N 258 SER C OXT sing N N 259 SER CB OG sing N N 260 SER CB HB2 sing N N 261 SER CB HB3 sing N N 262 SER OG HG sing N N 263 SER OXT HXT sing N N 264 THR N CA sing N N 265 THR N H sing N N 266 THR N H2 sing N N 267 THR CA C sing N N 268 THR CA CB sing N N 269 THR CA HA sing N N 270 THR C O doub N N 271 THR C OXT sing N N 272 THR CB OG1 sing N N 273 THR CB CG2 sing N N 274 THR CB HB sing N N 275 THR OG1 HG1 sing N N 276 THR CG2 HG21 sing N N 277 THR CG2 HG22 sing N N 278 THR CG2 HG23 sing N N 279 THR OXT HXT sing N N 280 TYR N CA sing N N 281 TYR N H sing N N 282 TYR N H2 sing N N 283 TYR CA C sing N N 284 TYR CA CB sing N N 285 TYR CA HA sing N N 286 TYR C O doub N N 287 TYR C OXT sing N N 288 TYR CB CG sing N N 289 TYR CB HB2 sing N N 290 TYR CB HB3 sing N N 291 TYR CG CD1 doub Y N 292 TYR CG CD2 sing Y N 293 TYR CD1 CE1 sing Y N 294 TYR CD1 HD1 sing N N 295 TYR CD2 CE2 doub Y N 296 TYR CD2 HD2 sing N N 297 TYR CE1 CZ doub Y N 298 TYR CE1 HE1 sing N N 299 TYR CE2 CZ sing Y N 300 TYR CE2 HE2 sing N N 301 TYR CZ OH sing N N 302 TYR OH HH sing N N 303 TYR OXT HXT sing N N 304 VAL N CA sing N N 305 VAL N H sing N N 306 VAL N H2 sing N N 307 VAL CA C sing N N 308 VAL CA CB sing N N 309 VAL CA HA sing N N 310 VAL C O doub N N 311 VAL C OXT sing N N 312 VAL CB CG1 sing N N 313 VAL CB CG2 sing N N 314 VAL CB HB sing N N 315 VAL CG1 HG11 sing N N 316 VAL CG1 HG12 sing N N 317 VAL CG1 HG13 sing N N 318 VAL CG2 HG21 sing N N 319 VAL CG2 HG22 sing N N 320 VAL CG2 HG23 sing N N 321 VAL OXT HXT sing N N 322 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Singapore)' _pdbx_audit_support.country Singapore _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8HGX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #