data_8HHP # _entry.id 8HHP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8HHP pdb_00008hhp 10.2210/pdb8hhp/pdb WWPDB D_1300033615 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-11-22 2 'Structure model' 1 1 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8HHP _pdbx_database_status.recvd_initial_deposition_date 2022-11-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email titoh@ac.shoyaku.ac.jp _pdbx_contact_author.name_first Toshimasa _pdbx_contact_author.name_last Itoh _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3446-4447 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kojima, H.' 1 0000-0002-1621-9352 'Itoh, T.' 2 0000-0003-3446-4447 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 66 _citation.language ? _citation.page_first 4827 _citation.page_last 4839 _citation.title 'Covalent Modifier Discovery Using Hydrogen/Deuterium Exchange-Mass Spectrometry.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.2c01986 _citation.pdbx_database_id_PubMed 36994595 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kojima, H.' 1 ? primary 'Yanagi, R.' 2 ? primary 'Higuchi, E.' 3 ? primary 'Yoshizawa, M.' 4 ? primary 'Shimodaira, T.' 5 ? primary 'Kumagai, M.' 6 ? primary 'Kyoya, T.' 7 ? primary 'Sekine, M.' 8 ? primary 'Egawa, D.' 9 ? primary 'Ohashi, N.' 10 ? primary 'Ishida, H.' 11 0000-0003-0341-2660 primary 'Yamamoto, K.' 12 0000-0001-6642-7961 primary 'Itoh, T.' 13 0000-0003-3446-4447 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peroxisome proliferator-activated receptor gamma' 31449.520 1 ? ? ? ? 2 non-polymer syn '5-CHLORO-1-(4-CHLOROBENZYL)-3-(PHENYLTHIO)-1H-INDOLE-2-CARBOXYLIC ACID' 428.331 1 ? ? ? ? 3 non-polymer syn '(2S)-2-(biphenyl-4-yloxy)-3-phenylpropanoic acid' 318.366 2 ? ? ? ? 4 water nat water 18.015 33 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GALNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRI FQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFG DFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTD LRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; _entity_poly.pdbx_seq_one_letter_code_can ;GALNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRI FQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFG DFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTD LRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-CHLORO-1-(4-CHLOROBENZYL)-3-(PHENYLTHIO)-1H-INDOLE-2-CARBOXYLIC ACID' NZA 3 '(2S)-2-(biphenyl-4-yloxy)-3-phenylpropanoic acid' LRG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 LEU n 1 4 ASN n 1 5 PRO n 1 6 GLU n 1 7 SER n 1 8 ALA n 1 9 ASP n 1 10 LEU n 1 11 ARG n 1 12 ALA n 1 13 LEU n 1 14 ALA n 1 15 LYS n 1 16 HIS n 1 17 LEU n 1 18 TYR n 1 19 ASP n 1 20 SER n 1 21 TYR n 1 22 ILE n 1 23 LYS n 1 24 SER n 1 25 PHE n 1 26 PRO n 1 27 LEU n 1 28 THR n 1 29 LYS n 1 30 ALA n 1 31 LYS n 1 32 ALA n 1 33 ARG n 1 34 ALA n 1 35 ILE n 1 36 LEU n 1 37 THR n 1 38 GLY n 1 39 LYS n 1 40 THR n 1 41 THR n 1 42 ASP n 1 43 LYS n 1 44 SER n 1 45 PRO n 1 46 PHE n 1 47 VAL n 1 48 ILE n 1 49 TYR n 1 50 ASP n 1 51 MET n 1 52 ASN n 1 53 SER n 1 54 LEU n 1 55 MET n 1 56 MET n 1 57 GLY n 1 58 GLU n 1 59 ASP n 1 60 LYS n 1 61 ILE n 1 62 LYS n 1 63 PHE n 1 64 LYS n 1 65 HIS n 1 66 ILE n 1 67 THR n 1 68 PRO n 1 69 LEU n 1 70 GLN n 1 71 GLU n 1 72 GLN n 1 73 SER n 1 74 LYS n 1 75 GLU n 1 76 VAL n 1 77 ALA n 1 78 ILE n 1 79 ARG n 1 80 ILE n 1 81 PHE n 1 82 GLN n 1 83 GLY n 1 84 CYS n 1 85 GLN n 1 86 PHE n 1 87 ARG n 1 88 SER n 1 89 VAL n 1 90 GLU n 1 91 ALA n 1 92 VAL n 1 93 GLN n 1 94 GLU n 1 95 ILE n 1 96 THR n 1 97 GLU n 1 98 TYR n 1 99 ALA n 1 100 LYS n 1 101 SER n 1 102 ILE n 1 103 PRO n 1 104 GLY n 1 105 PHE n 1 106 VAL n 1 107 ASN n 1 108 LEU n 1 109 ASP n 1 110 LEU n 1 111 ASN n 1 112 ASP n 1 113 GLN n 1 114 VAL n 1 115 THR n 1 116 LEU n 1 117 LEU n 1 118 LYS n 1 119 TYR n 1 120 GLY n 1 121 VAL n 1 122 HIS n 1 123 GLU n 1 124 ILE n 1 125 ILE n 1 126 TYR n 1 127 THR n 1 128 MET n 1 129 LEU n 1 130 ALA n 1 131 SER n 1 132 LEU n 1 133 MET n 1 134 ASN n 1 135 LYS n 1 136 ASP n 1 137 GLY n 1 138 VAL n 1 139 LEU n 1 140 ILE n 1 141 SER n 1 142 GLU n 1 143 GLY n 1 144 GLN n 1 145 GLY n 1 146 PHE n 1 147 MET n 1 148 THR n 1 149 ARG n 1 150 GLU n 1 151 PHE n 1 152 LEU n 1 153 LYS n 1 154 SER n 1 155 LEU n 1 156 ARG n 1 157 LYS n 1 158 PRO n 1 159 PHE n 1 160 GLY n 1 161 ASP n 1 162 PHE n 1 163 MET n 1 164 GLU n 1 165 PRO n 1 166 LYS n 1 167 PHE n 1 168 GLU n 1 169 PHE n 1 170 ALA n 1 171 VAL n 1 172 LYS n 1 173 PHE n 1 174 ASN n 1 175 ALA n 1 176 LEU n 1 177 GLU n 1 178 LEU n 1 179 ASP n 1 180 ASP n 1 181 SER n 1 182 ASP n 1 183 LEU n 1 184 ALA n 1 185 ILE n 1 186 PHE n 1 187 ILE n 1 188 ALA n 1 189 VAL n 1 190 ILE n 1 191 ILE n 1 192 LEU n 1 193 SER n 1 194 GLY n 1 195 ASP n 1 196 ARG n 1 197 PRO n 1 198 GLY n 1 199 LEU n 1 200 LEU n 1 201 ASN n 1 202 VAL n 1 203 LYS n 1 204 PRO n 1 205 ILE n 1 206 GLU n 1 207 ASP n 1 208 ILE n 1 209 GLN n 1 210 ASP n 1 211 ASN n 1 212 LEU n 1 213 LEU n 1 214 GLN n 1 215 ALA n 1 216 LEU n 1 217 GLU n 1 218 LEU n 1 219 GLN n 1 220 LEU n 1 221 LYS n 1 222 LEU n 1 223 ASN n 1 224 HIS n 1 225 PRO n 1 226 GLU n 1 227 SER n 1 228 SER n 1 229 GLN n 1 230 LEU n 1 231 PHE n 1 232 ALA n 1 233 LYS n 1 234 LEU n 1 235 LEU n 1 236 GLN n 1 237 LYS n 1 238 MET n 1 239 THR n 1 240 ASP n 1 241 LEU n 1 242 ARG n 1 243 GLN n 1 244 ILE n 1 245 VAL n 1 246 THR n 1 247 GLU n 1 248 HIS n 1 249 VAL n 1 250 GLN n 1 251 LEU n 1 252 LEU n 1 253 GLN n 1 254 VAL n 1 255 ILE n 1 256 LYS n 1 257 LYS n 1 258 THR n 1 259 GLU n 1 260 THR n 1 261 ASP n 1 262 MET n 1 263 SER n 1 264 LEU n 1 265 HIS n 1 266 PRO n 1 267 LEU n 1 268 LEU n 1 269 GLN n 1 270 GLU n 1 271 ILE n 1 272 TYR n 1 273 LYS n 1 274 ASP n 1 275 LEU n 1 276 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 276 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PPARG _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LRG non-polymer . '(2S)-2-(biphenyl-4-yloxy)-3-phenylpropanoic acid' ? 'C21 H18 O3' 318.366 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NZA non-polymer . '5-CHLORO-1-(4-CHLOROBENZYL)-3-(PHENYLTHIO)-1H-INDOLE-2-CARBOXYLIC ACID' NTZDPA 'C22 H15 Cl2 N O2 S' 428.331 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 202 ? ? ? A . n A 1 2 ALA 2 203 ? ? ? A . n A 1 3 LEU 3 204 ? ? ? A . n A 1 4 ASN 4 205 ? ? ? A . n A 1 5 PRO 5 206 ? ? ? A . n A 1 6 GLU 6 207 207 GLU GLU A . n A 1 7 SER 7 208 208 SER SER A . n A 1 8 ALA 8 209 209 ALA ALA A . n A 1 9 ASP 9 210 210 ASP ASP A . n A 1 10 LEU 10 211 211 LEU LEU A . n A 1 11 ARG 11 212 212 ARG ARG A . n A 1 12 ALA 12 213 213 ALA ALA A . n A 1 13 LEU 13 214 214 LEU LEU A . n A 1 14 ALA 14 215 215 ALA ALA A . n A 1 15 LYS 15 216 216 LYS LYS A . n A 1 16 HIS 16 217 217 HIS HIS A . n A 1 17 LEU 17 218 218 LEU LEU A . n A 1 18 TYR 18 219 219 TYR TYR A . n A 1 19 ASP 19 220 220 ASP ASP A . n A 1 20 SER 20 221 221 SER SER A . n A 1 21 TYR 21 222 222 TYR TYR A . n A 1 22 ILE 22 223 223 ILE ILE A . n A 1 23 LYS 23 224 224 LYS LYS A . n A 1 24 SER 24 225 225 SER SER A . n A 1 25 PHE 25 226 226 PHE PHE A . n A 1 26 PRO 26 227 227 PRO PRO A . n A 1 27 LEU 27 228 228 LEU LEU A . n A 1 28 THR 28 229 229 THR THR A . n A 1 29 LYS 29 230 230 LYS LYS A . n A 1 30 ALA 30 231 231 ALA ALA A . n A 1 31 LYS 31 232 232 LYS LYS A . n A 1 32 ALA 32 233 233 ALA ALA A . n A 1 33 ARG 33 234 234 ARG ARG A . n A 1 34 ALA 34 235 235 ALA ALA A . n A 1 35 ILE 35 236 236 ILE ILE A . n A 1 36 LEU 36 237 237 LEU LEU A . n A 1 37 THR 37 238 238 THR THR A . n A 1 38 GLY 38 239 239 GLY GLY A . n A 1 39 LYS 39 240 240 LYS LYS A . n A 1 40 THR 40 241 ? ? ? A . n A 1 41 THR 41 242 ? ? ? A . n A 1 42 ASP 42 243 ? ? ? A . n A 1 43 LYS 43 244 ? ? ? A . n A 1 44 SER 44 245 245 SER SER A . n A 1 45 PRO 45 246 246 PRO PRO A . n A 1 46 PHE 46 247 247 PHE PHE A . n A 1 47 VAL 47 248 248 VAL VAL A . n A 1 48 ILE 48 249 249 ILE ILE A . n A 1 49 TYR 49 250 250 TYR TYR A . n A 1 50 ASP 50 251 251 ASP ASP A . n A 1 51 MET 51 252 252 MET MET A . n A 1 52 ASN 52 253 253 ASN ASN A . n A 1 53 SER 53 254 254 SER SER A . n A 1 54 LEU 54 255 255 LEU LEU A . n A 1 55 MET 55 256 256 MET MET A . n A 1 56 MET 56 257 257 MET MET A . n A 1 57 GLY 57 258 258 GLY GLY A . n A 1 58 GLU 58 259 259 GLU GLU A . n A 1 59 ASP 59 260 260 ASP ASP A . n A 1 60 LYS 60 261 261 LYS LYS A . n A 1 61 ILE 61 262 262 ILE ILE A . n A 1 62 LYS 62 263 ? ? ? A . n A 1 63 PHE 63 264 ? ? ? A . n A 1 64 LYS 64 265 ? ? ? A . n A 1 65 HIS 65 266 ? ? ? A . n A 1 66 ILE 66 267 267 ILE ILE A . n A 1 67 THR 67 268 268 THR THR A . n A 1 68 PRO 68 269 269 PRO PRO A . n A 1 69 LEU 69 270 270 LEU LEU A . n A 1 70 GLN 70 271 271 GLN GLN A . n A 1 71 GLU 71 272 272 GLU GLU A . n A 1 72 GLN 72 273 273 GLN GLN A . n A 1 73 SER 73 274 274 SER SER A . n A 1 74 LYS 74 275 275 LYS LYS A . n A 1 75 GLU 75 276 276 GLU GLU A . n A 1 76 VAL 76 277 277 VAL VAL A . n A 1 77 ALA 77 278 278 ALA ALA A . n A 1 78 ILE 78 279 279 ILE ILE A . n A 1 79 ARG 79 280 280 ARG ARG A . n A 1 80 ILE 80 281 281 ILE ILE A . n A 1 81 PHE 81 282 282 PHE PHE A . n A 1 82 GLN 82 283 283 GLN GLN A . n A 1 83 GLY 83 284 284 GLY GLY A . n A 1 84 CYS 84 285 285 CYS CYS A . n A 1 85 GLN 85 286 286 GLN GLN A . n A 1 86 PHE 86 287 287 PHE PHE A . n A 1 87 ARG 87 288 288 ARG ARG A . n A 1 88 SER 88 289 289 SER SER A . n A 1 89 VAL 89 290 290 VAL VAL A . n A 1 90 GLU 90 291 291 GLU GLU A . n A 1 91 ALA 91 292 292 ALA ALA A . n A 1 92 VAL 92 293 293 VAL VAL A . n A 1 93 GLN 93 294 294 GLN GLN A . n A 1 94 GLU 94 295 295 GLU GLU A . n A 1 95 ILE 95 296 296 ILE ILE A . n A 1 96 THR 96 297 297 THR THR A . n A 1 97 GLU 97 298 298 GLU GLU A . n A 1 98 TYR 98 299 299 TYR TYR A . n A 1 99 ALA 99 300 300 ALA ALA A . n A 1 100 LYS 100 301 301 LYS LYS A . n A 1 101 SER 101 302 302 SER SER A . n A 1 102 ILE 102 303 303 ILE ILE A . n A 1 103 PRO 103 304 304 PRO PRO A . n A 1 104 GLY 104 305 305 GLY GLY A . n A 1 105 PHE 105 306 306 PHE PHE A . n A 1 106 VAL 106 307 307 VAL VAL A . n A 1 107 ASN 107 308 308 ASN ASN A . n A 1 108 LEU 108 309 309 LEU LEU A . n A 1 109 ASP 109 310 310 ASP ASP A . n A 1 110 LEU 110 311 311 LEU LEU A . n A 1 111 ASN 111 312 312 ASN ASN A . n A 1 112 ASP 112 313 313 ASP ASP A . n A 1 113 GLN 113 314 314 GLN GLN A . n A 1 114 VAL 114 315 315 VAL VAL A . n A 1 115 THR 115 316 316 THR THR A . n A 1 116 LEU 116 317 317 LEU LEU A . n A 1 117 LEU 117 318 318 LEU LEU A . n A 1 118 LYS 118 319 319 LYS LYS A . n A 1 119 TYR 119 320 320 TYR TYR A . n A 1 120 GLY 120 321 321 GLY GLY A . n A 1 121 VAL 121 322 322 VAL VAL A . n A 1 122 HIS 122 323 323 HIS HIS A . n A 1 123 GLU 123 324 324 GLU GLU A . n A 1 124 ILE 124 325 325 ILE ILE A . n A 1 125 ILE 125 326 326 ILE ILE A . n A 1 126 TYR 126 327 327 TYR TYR A . n A 1 127 THR 127 328 328 THR THR A . n A 1 128 MET 128 329 329 MET MET A . n A 1 129 LEU 129 330 330 LEU LEU A . n A 1 130 ALA 130 331 331 ALA ALA A . n A 1 131 SER 131 332 332 SER SER A . n A 1 132 LEU 132 333 333 LEU LEU A . n A 1 133 MET 133 334 334 MET MET A . n A 1 134 ASN 134 335 335 ASN ASN A . n A 1 135 LYS 135 336 336 LYS LYS A . n A 1 136 ASP 136 337 337 ASP ASP A . n A 1 137 GLY 137 338 338 GLY GLY A . n A 1 138 VAL 138 339 339 VAL VAL A . n A 1 139 LEU 139 340 340 LEU LEU A . n A 1 140 ILE 140 341 341 ILE ILE A . n A 1 141 SER 141 342 342 SER SER A . n A 1 142 GLU 142 343 343 GLU GLU A . n A 1 143 GLY 143 344 344 GLY GLY A . n A 1 144 GLN 144 345 345 GLN GLN A . n A 1 145 GLY 145 346 346 GLY GLY A . n A 1 146 PHE 146 347 347 PHE PHE A . n A 1 147 MET 147 348 348 MET MET A . n A 1 148 THR 148 349 349 THR THR A . n A 1 149 ARG 149 350 350 ARG ARG A . n A 1 150 GLU 150 351 351 GLU GLU A . n A 1 151 PHE 151 352 352 PHE PHE A . n A 1 152 LEU 152 353 353 LEU LEU A . n A 1 153 LYS 153 354 354 LYS LYS A . n A 1 154 SER 154 355 355 SER SER A . n A 1 155 LEU 155 356 356 LEU LEU A . n A 1 156 ARG 156 357 357 ARG ARG A . n A 1 157 LYS 157 358 358 LYS LYS A . n A 1 158 PRO 158 359 359 PRO PRO A . n A 1 159 PHE 159 360 360 PHE PHE A . n A 1 160 GLY 160 361 361 GLY GLY A . n A 1 161 ASP 161 362 362 ASP ASP A . n A 1 162 PHE 162 363 363 PHE PHE A . n A 1 163 MET 163 364 364 MET MET A . n A 1 164 GLU 164 365 365 GLU GLU A . n A 1 165 PRO 165 366 366 PRO PRO A . n A 1 166 LYS 166 367 367 LYS LYS A . n A 1 167 PHE 167 368 368 PHE PHE A . n A 1 168 GLU 168 369 369 GLU GLU A . n A 1 169 PHE 169 370 370 PHE PHE A . n A 1 170 ALA 170 371 371 ALA ALA A . n A 1 171 VAL 171 372 372 VAL VAL A . n A 1 172 LYS 172 373 373 LYS LYS A . n A 1 173 PHE 173 374 374 PHE PHE A . n A 1 174 ASN 174 375 375 ASN ASN A . n A 1 175 ALA 175 376 376 ALA ALA A . n A 1 176 LEU 176 377 377 LEU LEU A . n A 1 177 GLU 177 378 378 GLU GLU A . n A 1 178 LEU 178 379 379 LEU LEU A . n A 1 179 ASP 179 380 380 ASP ASP A . n A 1 180 ASP 180 381 381 ASP ASP A . n A 1 181 SER 181 382 382 SER SER A . n A 1 182 ASP 182 383 383 ASP ASP A . n A 1 183 LEU 183 384 384 LEU LEU A . n A 1 184 ALA 184 385 385 ALA ALA A . n A 1 185 ILE 185 386 386 ILE ILE A . n A 1 186 PHE 186 387 387 PHE PHE A . n A 1 187 ILE 187 388 388 ILE ILE A . n A 1 188 ALA 188 389 389 ALA ALA A . n A 1 189 VAL 189 390 390 VAL VAL A . n A 1 190 ILE 190 391 391 ILE ILE A . n A 1 191 ILE 191 392 392 ILE ILE A . n A 1 192 LEU 192 393 393 LEU LEU A . n A 1 193 SER 193 394 394 SER SER A . n A 1 194 GLY 194 395 395 GLY GLY A . n A 1 195 ASP 195 396 396 ASP ASP A . n A 1 196 ARG 196 397 397 ARG ARG A . n A 1 197 PRO 197 398 398 PRO PRO A . n A 1 198 GLY 198 399 399 GLY GLY A . n A 1 199 LEU 199 400 400 LEU LEU A . n A 1 200 LEU 200 401 401 LEU LEU A . n A 1 201 ASN 201 402 402 ASN ASN A . n A 1 202 VAL 202 403 403 VAL VAL A . n A 1 203 LYS 203 404 404 LYS LYS A . n A 1 204 PRO 204 405 405 PRO PRO A . n A 1 205 ILE 205 406 406 ILE ILE A . n A 1 206 GLU 206 407 407 GLU GLU A . n A 1 207 ASP 207 408 408 ASP ASP A . n A 1 208 ILE 208 409 409 ILE ILE A . n A 1 209 GLN 209 410 410 GLN GLN A . n A 1 210 ASP 210 411 411 ASP ASP A . n A 1 211 ASN 211 412 412 ASN ASN A . n A 1 212 LEU 212 413 413 LEU LEU A . n A 1 213 LEU 213 414 414 LEU LEU A . n A 1 214 GLN 214 415 415 GLN GLN A . n A 1 215 ALA 215 416 416 ALA ALA A . n A 1 216 LEU 216 417 417 LEU LEU A . n A 1 217 GLU 217 418 418 GLU GLU A . n A 1 218 LEU 218 419 419 LEU LEU A . n A 1 219 GLN 219 420 420 GLN GLN A . n A 1 220 LEU 220 421 421 LEU LEU A . n A 1 221 LYS 221 422 422 LYS LYS A . n A 1 222 LEU 222 423 423 LEU LEU A . n A 1 223 ASN 223 424 424 ASN ASN A . n A 1 224 HIS 224 425 425 HIS HIS A . n A 1 225 PRO 225 426 426 PRO PRO A . n A 1 226 GLU 226 427 427 GLU GLU A . n A 1 227 SER 227 428 428 SER SER A . n A 1 228 SER 228 429 429 SER SER A . n A 1 229 GLN 229 430 430 GLN GLN A . n A 1 230 LEU 230 431 431 LEU LEU A . n A 1 231 PHE 231 432 432 PHE PHE A . n A 1 232 ALA 232 433 433 ALA ALA A . n A 1 233 LYS 233 434 434 LYS LYS A . n A 1 234 LEU 234 435 435 LEU LEU A . n A 1 235 LEU 235 436 436 LEU LEU A . n A 1 236 GLN 236 437 437 GLN GLN A . n A 1 237 LYS 237 438 438 LYS LYS A . n A 1 238 MET 238 439 439 MET MET A . n A 1 239 THR 239 440 440 THR THR A . n A 1 240 ASP 240 441 441 ASP ASP A . n A 1 241 LEU 241 442 442 LEU LEU A . n A 1 242 ARG 242 443 443 ARG ARG A . n A 1 243 GLN 243 444 444 GLN GLN A . n A 1 244 ILE 244 445 445 ILE ILE A . n A 1 245 VAL 245 446 446 VAL VAL A . n A 1 246 THR 246 447 447 THR THR A . n A 1 247 GLU 247 448 448 GLU GLU A . n A 1 248 HIS 248 449 449 HIS HIS A . n A 1 249 VAL 249 450 450 VAL VAL A . n A 1 250 GLN 250 451 451 GLN GLN A . n A 1 251 LEU 251 452 452 LEU LEU A . n A 1 252 LEU 252 453 453 LEU LEU A . n A 1 253 GLN 253 454 454 GLN GLN A . n A 1 254 VAL 254 455 455 VAL VAL A . n A 1 255 ILE 255 456 456 ILE ILE A . n A 1 256 LYS 256 457 457 LYS LYS A . n A 1 257 LYS 257 458 458 LYS LYS A . n A 1 258 THR 258 459 459 THR THR A . n A 1 259 GLU 259 460 460 GLU GLU A . n A 1 260 THR 260 461 461 THR THR A . n A 1 261 ASP 261 462 462 ASP ASP A . n A 1 262 MET 262 463 463 MET MET A . n A 1 263 SER 263 464 464 SER SER A . n A 1 264 LEU 264 465 465 LEU LEU A . n A 1 265 HIS 265 466 466 HIS HIS A . n A 1 266 PRO 266 467 467 PRO PRO A . n A 1 267 LEU 267 468 468 LEU LEU A . n A 1 268 LEU 268 469 469 LEU LEU A . n A 1 269 GLN 269 470 470 GLN GLN A . n A 1 270 GLU 270 471 471 GLU GLU A . n A 1 271 ILE 271 472 472 ILE ILE A . n A 1 272 TYR 272 473 473 TYR TYR A . n A 1 273 LYS 273 474 474 LYS LYS A . n A 1 274 ASP 274 475 475 ASP ASP A . n A 1 275 LEU 275 476 476 LEU LEU A . n A 1 276 TYR 276 477 477 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NZA 1 501 1 NZA NZA A . C 3 LRG 1 502 1 LRG LRG A . D 3 LRG 1 503 2 LRG LRG A . E 4 HOH 1 601 19 HOH HOH A . E 4 HOH 2 602 20 HOH HOH A . E 4 HOH 3 603 14 HOH HOH A . E 4 HOH 4 604 2 HOH HOH A . E 4 HOH 5 605 31 HOH HOH A . E 4 HOH 6 606 34 HOH HOH A . E 4 HOH 7 607 27 HOH HOH A . E 4 HOH 8 608 30 HOH HOH A . E 4 HOH 9 609 13 HOH HOH A . E 4 HOH 10 610 32 HOH HOH A . E 4 HOH 11 611 33 HOH HOH A . E 4 HOH 12 612 17 HOH HOH A . E 4 HOH 13 613 12 HOH HOH A . E 4 HOH 14 614 11 HOH HOH A . E 4 HOH 15 615 15 HOH HOH A . E 4 HOH 16 616 26 HOH HOH A . E 4 HOH 17 617 10 HOH HOH A . E 4 HOH 18 618 21 HOH HOH A . E 4 HOH 19 619 16 HOH HOH A . E 4 HOH 20 620 6 HOH HOH A . E 4 HOH 21 621 35 HOH HOH A . E 4 HOH 22 622 25 HOH HOH A . E 4 HOH 23 623 28 HOH HOH A . E 4 HOH 24 624 5 HOH HOH A . E 4 HOH 25 625 7 HOH HOH A . E 4 HOH 26 626 4 HOH HOH A . E 4 HOH 27 627 24 HOH HOH A . E 4 HOH 28 628 1 HOH HOH A . E 4 HOH 29 629 29 HOH HOH A . E 4 HOH 30 630 18 HOH HOH A . E 4 HOH 31 631 3 HOH HOH A . E 4 HOH 32 632 23 HOH HOH A . E 4 HOH 33 633 36 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 319 ? CG ? A LYS 118 CG 2 1 Y 1 A LYS 319 ? CD ? A LYS 118 CD 3 1 Y 1 A LYS 319 ? CE ? A LYS 118 CE 4 1 Y 1 A LYS 319 ? NZ ? A LYS 118 NZ 5 1 Y 1 A LYS 422 ? CG ? A LYS 221 CG 6 1 Y 1 A LYS 422 ? CD ? A LYS 221 CD 7 1 Y 1 A LYS 422 ? CE ? A LYS 221 CE 8 1 Y 1 A LYS 422 ? NZ ? A LYS 221 NZ 9 1 Y 1 A LYS 457 ? CG ? A LYS 256 CG 10 1 Y 1 A LYS 457 ? CD ? A LYS 256 CD 11 1 Y 1 A LYS 457 ? CE ? A LYS 256 CE 12 1 Y 1 A LYS 457 ? NZ ? A LYS 256 NZ 13 1 Y 1 A LYS 458 ? CG ? A LYS 257 CG 14 1 Y 1 A LYS 458 ? CD ? A LYS 257 CD 15 1 Y 1 A LYS 458 ? CE ? A LYS 257 CE 16 1 Y 1 A LYS 458 ? NZ ? A LYS 257 NZ 17 1 Y 1 A MET 463 ? CG ? A MET 262 CG 18 1 Y 1 A MET 463 ? SD ? A MET 262 SD 19 1 Y 1 A MET 463 ? CE ? A MET 262 CE # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8HHP _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.500 _cell.length_a_esd ? _cell.length_b 60.500 _cell.length_b_esd ? _cell.length_c 162.260 _cell.length_c_esd ? _cell.volume 593912.165 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8HHP _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8HHP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.36 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris-HCl pH 7.7, 0.75 M sodium citrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-05-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW12A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline AR-NW12A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate 28.63 _reflns.entry_id 8HHP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.45 _reflns.d_resolution_low 48.5 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11599 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.45 _reflns_shell.d_res_low 2.57 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 11599 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.948 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 31.76 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8HHP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.45 _refine.ls_d_res_low 48.50 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11586 _refine.ls_number_reflns_R_free 1158 _refine.ls_number_reflns_R_work 10428 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.57 _refine.ls_percent_reflns_R_free 9.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2211 _refine.ls_R_factor_R_free 0.2864 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2137 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2VV3 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.9868 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3383 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.45 _refine_hist.d_res_low 48.50 _refine_hist.number_atoms_solvent 33 _refine_hist.number_atoms_total 2197 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2088 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 76 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0088 ? 2219 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2536 ? 2999 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0670 ? 340 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0062 ? 381 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.3813 ? 297 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.45 2.56 . . 140 1267 99.22 . . . 0.3303 . 0.2302 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.56 2.70 . . 142 1277 99.37 . . . 0.3341 . 0.2453 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.70 2.86 . . 141 1278 99.09 . . . 0.3171 . 0.2424 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.87 3.09 . . 144 1287 99.03 . . . 0.3635 . 0.2459 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.09 3.40 . . 144 1300 98.90 . . . 0.3366 . 0.2337 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.40 3.89 . . 145 1299 98.70 . . . 0.2609 . 0.2086 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.89 4.90 . . 145 1316 98.12 . . . 0.2428 . 0.1668 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.90 48.50 . . 157 1404 96.54 . . . 0.2389 . 0.2094 . . . . . . . . . . . # _struct.entry_id 8HHP _struct.title 'Crystal structure of PPARg-LBD complexed with three partial agonists, one nTZDpa and two LT175' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8HHP _struct_keywords.text 'PPARg-LBD, Partial agonists, nTZDpa, LT175, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PPARG_HUMAN _struct_ref.pdbx_db_accession P37231 _struct_ref.pdbx_db_isoform P37231-2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQ GCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDF MEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLR QIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; _struct_ref.pdbx_align_begin 204 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8HHP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 276 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P37231 _struct_ref_seq.db_align_beg 204 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 477 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 204 _struct_ref_seq.pdbx_auth_seq_align_end 477 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8HHP GLY A 1 ? UNP P37231 ? ? 'expression tag' 202 1 1 8HHP ALA A 2 ? UNP P37231 ? ? 'expression tag' 203 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 830 ? 1 MORE -20 ? 1 'SSA (A^2)' 13510 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 6 ? PHE A 25 ? GLU A 207 PHE A 226 1 ? 20 HELX_P HELX_P2 AA2 THR A 28 ? GLY A 38 ? THR A 229 GLY A 239 1 ? 11 HELX_P HELX_P3 AA3 ASP A 50 ? LYS A 60 ? ASP A 251 LYS A 261 1 ? 11 HELX_P HELX_P4 AA4 PRO A 68 ? SER A 73 ? PRO A 269 SER A 274 1 ? 6 HELX_P HELX_P5 AA5 GLU A 75 ? SER A 101 ? GLU A 276 SER A 302 1 ? 27 HELX_P HELX_P6 AA6 GLY A 104 ? LEU A 108 ? GLY A 305 LEU A 309 5 ? 5 HELX_P HELX_P7 AA7 ASP A 109 ? SER A 131 ? ASP A 310 SER A 332 1 ? 23 HELX_P HELX_P8 AA8 ARG A 149 ? SER A 154 ? ARG A 350 SER A 355 1 ? 6 HELX_P HELX_P9 AA9 PRO A 158 ? PHE A 162 ? PRO A 359 PHE A 363 5 ? 5 HELX_P HELX_P10 AB1 MET A 163 ? ALA A 175 ? MET A 364 ALA A 376 1 ? 13 HELX_P HELX_P11 AB2 ASP A 179 ? LEU A 192 ? ASP A 380 LEU A 393 1 ? 14 HELX_P HELX_P12 AB3 ASN A 201 ? HIS A 224 ? ASN A 402 HIS A 425 1 ? 24 HELX_P HELX_P13 AB4 GLN A 229 ? GLU A 259 ? GLN A 430 GLU A 460 1 ? 31 HELX_P HELX_P14 AB5 HIS A 265 ? TYR A 272 ? HIS A 466 TYR A 473 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 157 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 358 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 158 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 359 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.38 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 46 ? ILE A 48 ? PHE A 247 ILE A 249 AA1 2 GLY A 145 ? THR A 148 ? GLY A 346 THR A 349 AA1 3 GLY A 137 ? ILE A 140 ? GLY A 338 ILE A 341 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 48 ? N ILE A 249 O PHE A 146 ? O PHE A 347 AA1 2 3 O GLY A 145 ? O GLY A 346 N ILE A 140 ? N ILE A 341 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLN _pdbx_validate_close_contact.auth_seq_id_1 437 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 601 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.05 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 335 ? ? -127.31 -169.64 2 1 LEU A 393 ? ? -91.78 52.14 3 1 THR A 461 ? ? -123.46 -54.06 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # _pdbx_entry_details.entry_id 8HHP _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 202 ? A GLY 1 2 1 Y 1 A ALA 203 ? A ALA 2 3 1 Y 1 A LEU 204 ? A LEU 3 4 1 Y 1 A ASN 205 ? A ASN 4 5 1 Y 1 A PRO 206 ? A PRO 5 6 1 Y 1 A THR 241 ? A THR 40 7 1 Y 1 A THR 242 ? A THR 41 8 1 Y 1 A ASP 243 ? A ASP 42 9 1 Y 1 A LYS 244 ? A LYS 43 10 1 Y 1 A LYS 263 ? A LYS 62 11 1 Y 1 A PHE 264 ? A PHE 63 12 1 Y 1 A LYS 265 ? A LYS 64 13 1 Y 1 A HIS 266 ? A HIS 65 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LRG CAI C Y N 205 LRG CAE C Y N 206 LRG CAC C Y N 207 LRG CAF C Y N 208 LRG CAJ C Y N 209 LRG CAT C Y N 210 LRG CAQ C N N 211 LRG CAX C N S 212 LRG CAS C N N 213 LRG OAB O N N 214 LRG OAA O N N 215 LRG OAR O N N 216 LRG CAU C Y N 217 LRG CAN C Y N 218 LRG CAP C Y N 219 LRG CAM C Y N 220 LRG CAO C Y N 221 LRG CAW C Y N 222 LRG CAV C Y N 223 LRG CAK C Y N 224 LRG CAG C Y N 225 LRG CAD C Y N 226 LRG CAH C Y N 227 LRG CAL C Y N 228 LRG HAI H N N 229 LRG HAE H N N 230 LRG HAC H N N 231 LRG HAF H N N 232 LRG HAJ H N N 233 LRG HAQ H N N 234 LRG HAQA H N N 235 LRG HAX H N N 236 LRG HAN H N N 237 LRG HAP H N N 238 LRG HAM H N N 239 LRG HAO H N N 240 LRG HAK H N N 241 LRG HAG H N N 242 LRG HAD H N N 243 LRG HAH H N N 244 LRG HAL H N N 245 LRG HAB H N N 246 LYS N N N N 247 LYS CA C N S 248 LYS C C N N 249 LYS O O N N 250 LYS CB C N N 251 LYS CG C N N 252 LYS CD C N N 253 LYS CE C N N 254 LYS NZ N N N 255 LYS OXT O N N 256 LYS H H N N 257 LYS H2 H N N 258 LYS HA H N N 259 LYS HB2 H N N 260 LYS HB3 H N N 261 LYS HG2 H N N 262 LYS HG3 H N N 263 LYS HD2 H N N 264 LYS HD3 H N N 265 LYS HE2 H N N 266 LYS HE3 H N N 267 LYS HZ1 H N N 268 LYS HZ2 H N N 269 LYS HZ3 H N N 270 LYS HXT H N N 271 MET N N N N 272 MET CA C N S 273 MET C C N N 274 MET O O N N 275 MET CB C N N 276 MET CG C N N 277 MET SD S N N 278 MET CE C N N 279 MET OXT O N N 280 MET H H N N 281 MET H2 H N N 282 MET HA H N N 283 MET HB2 H N N 284 MET HB3 H N N 285 MET HG2 H N N 286 MET HG3 H N N 287 MET HE1 H N N 288 MET HE2 H N N 289 MET HE3 H N N 290 MET HXT H N N 291 NZA CAM C Y N 292 NZA CAJ C Y N 293 NZA CAT C Y N 294 NZA CLAC CL N N 295 NZA CAK C Y N 296 NZA CAN C Y N 297 NZA CAV C Y N 298 NZA CAQ C N N 299 NZA NBB N Y N 300 NZA CAY C Y N 301 NZA CAS C N N 302 NZA OAB O N N 303 NZA OAA O N N 304 NZA CBA C Y N 305 NZA CAO C Y N 306 NZA CAL C Y N 307 NZA CAU C Y N 308 NZA CLAD CL N N 309 NZA CAP C Y N 310 NZA CAZ C Y N 311 NZA CAX C Y N 312 NZA SAR S N N 313 NZA CAW C Y N 314 NZA CAH C Y N 315 NZA CAF C Y N 316 NZA CAE C Y N 317 NZA CAG C Y N 318 NZA CAI C Y N 319 NZA HAM H N N 320 NZA HAJ H N N 321 NZA HAK H N N 322 NZA HAN H N N 323 NZA HAQ1 H N N 324 NZA HAQ2 H N N 325 NZA HOAB H N N 326 NZA HAO H N N 327 NZA HAL H N N 328 NZA HAP H N N 329 NZA HAH H N N 330 NZA HAF H N N 331 NZA HAE H N N 332 NZA HAG H N N 333 NZA HAI H N N 334 PHE N N N N 335 PHE CA C N S 336 PHE C C N N 337 PHE O O N N 338 PHE CB C N N 339 PHE CG C Y N 340 PHE CD1 C Y N 341 PHE CD2 C Y N 342 PHE CE1 C Y N 343 PHE CE2 C Y N 344 PHE CZ C Y N 345 PHE OXT O N N 346 PHE H H N N 347 PHE H2 H N N 348 PHE HA H N N 349 PHE HB2 H N N 350 PHE HB3 H N N 351 PHE HD1 H N N 352 PHE HD2 H N N 353 PHE HE1 H N N 354 PHE HE2 H N N 355 PHE HZ H N N 356 PHE HXT H N N 357 PRO N N N N 358 PRO CA C N S 359 PRO C C N N 360 PRO O O N N 361 PRO CB C N N 362 PRO CG C N N 363 PRO CD C N N 364 PRO OXT O N N 365 PRO H H N N 366 PRO HA H N N 367 PRO HB2 H N N 368 PRO HB3 H N N 369 PRO HG2 H N N 370 PRO HG3 H N N 371 PRO HD2 H N N 372 PRO HD3 H N N 373 PRO HXT H N N 374 SER N N N N 375 SER CA C N S 376 SER C C N N 377 SER O O N N 378 SER CB C N N 379 SER OG O N N 380 SER OXT O N N 381 SER H H N N 382 SER H2 H N N 383 SER HA H N N 384 SER HB2 H N N 385 SER HB3 H N N 386 SER HG H N N 387 SER HXT H N N 388 THR N N N N 389 THR CA C N S 390 THR C C N N 391 THR O O N N 392 THR CB C N R 393 THR OG1 O N N 394 THR CG2 C N N 395 THR OXT O N N 396 THR H H N N 397 THR H2 H N N 398 THR HA H N N 399 THR HB H N N 400 THR HG1 H N N 401 THR HG21 H N N 402 THR HG22 H N N 403 THR HG23 H N N 404 THR HXT H N N 405 TYR N N N N 406 TYR CA C N S 407 TYR C C N N 408 TYR O O N N 409 TYR CB C N N 410 TYR CG C Y N 411 TYR CD1 C Y N 412 TYR CD2 C Y N 413 TYR CE1 C Y N 414 TYR CE2 C Y N 415 TYR CZ C Y N 416 TYR OH O N N 417 TYR OXT O N N 418 TYR H H N N 419 TYR H2 H N N 420 TYR HA H N N 421 TYR HB2 H N N 422 TYR HB3 H N N 423 TYR HD1 H N N 424 TYR HD2 H N N 425 TYR HE1 H N N 426 TYR HE2 H N N 427 TYR HH H N N 428 TYR HXT H N N 429 VAL N N N N 430 VAL CA C N S 431 VAL C C N N 432 VAL O O N N 433 VAL CB C N N 434 VAL CG1 C N N 435 VAL CG2 C N N 436 VAL OXT O N N 437 VAL H H N N 438 VAL H2 H N N 439 VAL HA H N N 440 VAL HB H N N 441 VAL HG11 H N N 442 VAL HG12 H N N 443 VAL HG13 H N N 444 VAL HG21 H N N 445 VAL HG22 H N N 446 VAL HG23 H N N 447 VAL HXT H N N 448 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LRG CAC CAF doub Y N 194 LRG CAC CAE sing Y N 195 LRG CAF CAJ sing Y N 196 LRG CAE CAI doub Y N 197 LRG CAJ CAT doub Y N 198 LRG CAI CAT sing Y N 199 LRG CAT CAQ sing N N 200 LRG CAG CAD doub Y N 201 LRG CAG CAK sing Y N 202 LRG CAD CAH sing Y N 203 LRG CAO CAM doub Y N 204 LRG CAO CAW sing Y N 205 LRG CAK CAV doub Y N 206 LRG CAM CAU sing Y N 207 LRG CAH CAL doub Y N 208 LRG CAV CAL sing Y N 209 LRG CAV CAW sing Y N 210 LRG OAR CAU sing N N 211 LRG OAR CAX sing N N 212 LRG CAW CAP doub Y N 213 LRG CAU CAN doub Y N 214 LRG CAP CAN sing Y N 215 LRG CAQ CAX sing N N 216 LRG CAX CAS sing N N 217 LRG CAS OAA doub N N 218 LRG CAS OAB sing N N 219 LRG CAI HAI sing N N 220 LRG CAE HAE sing N N 221 LRG CAC HAC sing N N 222 LRG CAF HAF sing N N 223 LRG CAJ HAJ sing N N 224 LRG CAQ HAQ sing N N 225 LRG CAQ HAQA sing N N 226 LRG CAX HAX sing N N 227 LRG CAN HAN sing N N 228 LRG CAP HAP sing N N 229 LRG CAM HAM sing N N 230 LRG CAO HAO sing N N 231 LRG CAK HAK sing N N 232 LRG CAG HAG sing N N 233 LRG CAD HAD sing N N 234 LRG CAH HAH sing N N 235 LRG CAL HAL sing N N 236 LRG OAB HAB sing N N 237 LYS N CA sing N N 238 LYS N H sing N N 239 LYS N H2 sing N N 240 LYS CA C sing N N 241 LYS CA CB sing N N 242 LYS CA HA sing N N 243 LYS C O doub N N 244 LYS C OXT sing N N 245 LYS CB CG sing N N 246 LYS CB HB2 sing N N 247 LYS CB HB3 sing N N 248 LYS CG CD sing N N 249 LYS CG HG2 sing N N 250 LYS CG HG3 sing N N 251 LYS CD CE sing N N 252 LYS CD HD2 sing N N 253 LYS CD HD3 sing N N 254 LYS CE NZ sing N N 255 LYS CE HE2 sing N N 256 LYS CE HE3 sing N N 257 LYS NZ HZ1 sing N N 258 LYS NZ HZ2 sing N N 259 LYS NZ HZ3 sing N N 260 LYS OXT HXT sing N N 261 MET N CA sing N N 262 MET N H sing N N 263 MET N H2 sing N N 264 MET CA C sing N N 265 MET CA CB sing N N 266 MET CA HA sing N N 267 MET C O doub N N 268 MET C OXT sing N N 269 MET CB CG sing N N 270 MET CB HB2 sing N N 271 MET CB HB3 sing N N 272 MET CG SD sing N N 273 MET CG HG2 sing N N 274 MET CG HG3 sing N N 275 MET SD CE sing N N 276 MET CE HE1 sing N N 277 MET CE HE2 sing N N 278 MET CE HE3 sing N N 279 MET OXT HXT sing N N 280 NZA CAM CAJ sing Y N 281 NZA CAM CAV doub Y N 282 NZA CAM HAM sing N N 283 NZA CAJ CAT doub Y N 284 NZA CAJ HAJ sing N N 285 NZA CAT CLAC sing N N 286 NZA CAT CAK sing Y N 287 NZA CAK CAN doub Y N 288 NZA CAK HAK sing N N 289 NZA CAN CAV sing Y N 290 NZA CAN HAN sing N N 291 NZA CAV CAQ sing N N 292 NZA CAQ NBB sing N N 293 NZA CAQ HAQ1 sing N N 294 NZA CAQ HAQ2 sing N N 295 NZA NBB CBA sing Y N 296 NZA NBB CAY sing Y N 297 NZA CAY CAS sing N N 298 NZA CAY CAX doub Y N 299 NZA CAS OAA doub N N 300 NZA CAS OAB sing N N 301 NZA OAB HOAB sing N N 302 NZA CBA CAO sing Y N 303 NZA CBA CAZ doub Y N 304 NZA CAO CAL doub Y N 305 NZA CAO HAO sing N N 306 NZA CAL CAU sing Y N 307 NZA CAL HAL sing N N 308 NZA CAU CLAD sing N N 309 NZA CAU CAP doub Y N 310 NZA CAP CAZ sing Y N 311 NZA CAP HAP sing N N 312 NZA CAZ CAX sing Y N 313 NZA CAX SAR sing N N 314 NZA SAR CAW sing N N 315 NZA CAW CAI doub Y N 316 NZA CAW CAH sing Y N 317 NZA CAH CAF doub Y N 318 NZA CAH HAH sing N N 319 NZA CAF CAE sing Y N 320 NZA CAF HAF sing N N 321 NZA CAE CAG doub Y N 322 NZA CAE HAE sing N N 323 NZA CAG CAI sing Y N 324 NZA CAG HAG sing N N 325 NZA CAI HAI sing N N 326 PHE N CA sing N N 327 PHE N H sing N N 328 PHE N H2 sing N N 329 PHE CA C sing N N 330 PHE CA CB sing N N 331 PHE CA HA sing N N 332 PHE C O doub N N 333 PHE C OXT sing N N 334 PHE CB CG sing N N 335 PHE CB HB2 sing N N 336 PHE CB HB3 sing N N 337 PHE CG CD1 doub Y N 338 PHE CG CD2 sing Y N 339 PHE CD1 CE1 sing Y N 340 PHE CD1 HD1 sing N N 341 PHE CD2 CE2 doub Y N 342 PHE CD2 HD2 sing N N 343 PHE CE1 CZ doub Y N 344 PHE CE1 HE1 sing N N 345 PHE CE2 CZ sing Y N 346 PHE CE2 HE2 sing N N 347 PHE CZ HZ sing N N 348 PHE OXT HXT sing N N 349 PRO N CA sing N N 350 PRO N CD sing N N 351 PRO N H sing N N 352 PRO CA C sing N N 353 PRO CA CB sing N N 354 PRO CA HA sing N N 355 PRO C O doub N N 356 PRO C OXT sing N N 357 PRO CB CG sing N N 358 PRO CB HB2 sing N N 359 PRO CB HB3 sing N N 360 PRO CG CD sing N N 361 PRO CG HG2 sing N N 362 PRO CG HG3 sing N N 363 PRO CD HD2 sing N N 364 PRO CD HD3 sing N N 365 PRO OXT HXT sing N N 366 SER N CA sing N N 367 SER N H sing N N 368 SER N H2 sing N N 369 SER CA C sing N N 370 SER CA CB sing N N 371 SER CA HA sing N N 372 SER C O doub N N 373 SER C OXT sing N N 374 SER CB OG sing N N 375 SER CB HB2 sing N N 376 SER CB HB3 sing N N 377 SER OG HG sing N N 378 SER OXT HXT sing N N 379 THR N CA sing N N 380 THR N H sing N N 381 THR N H2 sing N N 382 THR CA C sing N N 383 THR CA CB sing N N 384 THR CA HA sing N N 385 THR C O doub N N 386 THR C OXT sing N N 387 THR CB OG1 sing N N 388 THR CB CG2 sing N N 389 THR CB HB sing N N 390 THR OG1 HG1 sing N N 391 THR CG2 HG21 sing N N 392 THR CG2 HG22 sing N N 393 THR CG2 HG23 sing N N 394 THR OXT HXT sing N N 395 TYR N CA sing N N 396 TYR N H sing N N 397 TYR N H2 sing N N 398 TYR CA C sing N N 399 TYR CA CB sing N N 400 TYR CA HA sing N N 401 TYR C O doub N N 402 TYR C OXT sing N N 403 TYR CB CG sing N N 404 TYR CB HB2 sing N N 405 TYR CB HB3 sing N N 406 TYR CG CD1 doub Y N 407 TYR CG CD2 sing Y N 408 TYR CD1 CE1 sing Y N 409 TYR CD1 HD1 sing N N 410 TYR CD2 CE2 doub Y N 411 TYR CD2 HD2 sing N N 412 TYR CE1 CZ doub Y N 413 TYR CE1 HE1 sing N N 414 TYR CE2 CZ sing Y N 415 TYR CE2 HE2 sing N N 416 TYR CZ OH sing N N 417 TYR OH HH sing N N 418 TYR OXT HXT sing N N 419 VAL N CA sing N N 420 VAL N H sing N N 421 VAL N H2 sing N N 422 VAL CA C sing N N 423 VAL CA CB sing N N 424 VAL CA HA sing N N 425 VAL C O doub N N 426 VAL C OXT sing N N 427 VAL CB CG1 sing N N 428 VAL CB CG2 sing N N 429 VAL CB HB sing N N 430 VAL CG1 HG11 sing N N 431 VAL CG1 HG12 sing N N 432 VAL CG1 HG13 sing N N 433 VAL CG2 HG21 sing N N 434 VAL CG2 HG22 sing N N 435 VAL CG2 HG23 sing N N 436 VAL OXT HXT sing N N 437 # _pdbx_audit_support.funding_organization 'Japan Agency for Medical Research and Development (AMED)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id LRG _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id LRG _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 8HHP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016529 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016529 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006163 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_