data_8HV2 # _entry.id 8HV2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8HV2 pdb_00008hv2 10.2210/pdb8hv2/pdb WWPDB D_1300034319 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-12-13 2 'Structure model' 1 1 2024-04-03 3 'Structure model' 1 2 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_entry_details 4 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation_author.identifier_ORCID' 7 2 'Structure model' '_citation_author.name' 8 3 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8HV2 _pdbx_database_status.recvd_initial_deposition_date 2022-12-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email maruoka.hiroshi.xv@rdn.daiichisankyo.co.jp _pdbx_contact_author.name_first Hiroshi _pdbx_contact_author.name_last Maruoka _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3438-3380 # _audit_author.name 'Dokurno, P.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-7332-8889 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Rsc Med Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2632-8682 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 2731 _citation.page_last 2737 _citation.title 'A covalent fragment-based strategy targeting a novel cysteine to inhibit activity of mutant EGFR kinase.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d3md00439b _citation.pdbx_database_id_PubMed 38107172 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kuki, N.' 1 0000-0002-8508-6725 primary 'Walmsley, D.L.' 2 0000-0001-8471-5895 primary 'Kanai, K.' 3 ? primary 'Takechi, S.' 4 ? primary 'Yoshida, M.' 5 ? primary 'Murakami, R.' 6 ? primary 'Takano, K.' 7 ? primary 'Tominaga, Y.' 8 ? primary 'Takahashi, M.' 9 0000-0002-6238-9838 primary 'Ito, S.' 10 ? primary 'Nakao, N.' 11 ? primary 'Angove, H.' 12 ? primary 'Baker, L.M.' 13 0000-0003-2002-0941 primary 'Carter, E.' 14 ? primary 'Dokurno, P.' 15 0000-0002-7332-8889 primary 'Le Strat, L.' 16 ? primary 'Macias, A.T.' 17 0000-0001-5014-1889 primary 'Molyneaux, C.A.' 18 ? primary 'Murray, J.B.' 19 ? primary 'Surgenor, A.E.' 20 0000-0002-9869-1430 primary 'Hamada, T.' 21 ? primary 'Hubbard, R.E.' 22 0000-0002-8233-7461 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 37632.453 1 2.7.10.1 ? ? ? 2 non-polymer syn '~{N}-pyridin-2-ylprop-2-enamide' 148.162 1 ? ? ? ? 3 water nat water 18.015 29 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1,Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDN PHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHV KITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGE RLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVV DADEYLIPQQG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDN PHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHV KITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGE RLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVV DADEYLIPQQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-pyridin-2-ylprop-2-enamide' MWU 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 SER n 1 5 GLY n 1 6 GLU n 1 7 ALA n 1 8 PRO n 1 9 ASN n 1 10 GLN n 1 11 ALA n 1 12 LEU n 1 13 LEU n 1 14 ARG n 1 15 ILE n 1 16 LEU n 1 17 LYS n 1 18 GLU n 1 19 THR n 1 20 GLU n 1 21 PHE n 1 22 LYS n 1 23 LYS n 1 24 ILE n 1 25 LYS n 1 26 VAL n 1 27 LEU n 1 28 GLY n 1 29 SER n 1 30 GLY n 1 31 ALA n 1 32 PHE n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 TYR n 1 37 LYS n 1 38 GLY n 1 39 LEU n 1 40 TRP n 1 41 ILE n 1 42 PRO n 1 43 GLU n 1 44 GLY n 1 45 GLU n 1 46 LYS n 1 47 VAL n 1 48 LYS n 1 49 ILE n 1 50 PRO n 1 51 VAL n 1 52 ALA n 1 53 ILE n 1 54 LYS n 1 55 GLU n 1 56 LEU n 1 57 ARG n 1 58 GLU n 1 59 ALA n 1 60 THR n 1 61 SER n 1 62 PRO n 1 63 LYS n 1 64 ALA n 1 65 ASN n 1 66 LYS n 1 67 GLU n 1 68 ILE n 1 69 LEU n 1 70 ASP n 1 71 GLU n 1 72 ALA n 1 73 TYR n 1 74 VAL n 1 75 MET n 1 76 ALA n 1 77 SER n 1 78 VAL n 1 79 ASP n 1 80 ASN n 1 81 PRO n 1 82 HIS n 1 83 VAL n 1 84 CYS n 1 85 ARG n 1 86 LEU n 1 87 LEU n 1 88 GLY n 1 89 ILE n 1 90 CYS n 1 91 LEU n 1 92 THR n 1 93 SER n 1 94 THR n 1 95 VAL n 1 96 GLN n 1 97 LEU n 1 98 ILE n 1 99 THR n 1 100 GLN n 1 101 LEU n 1 102 MET n 1 103 PRO n 1 104 PHE n 1 105 GLY n 1 106 CYS n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 TYR n 1 111 VAL n 1 112 ARG n 1 113 GLU n 1 114 HIS n 1 115 LYS n 1 116 ASP n 1 117 ASN n 1 118 ILE n 1 119 GLY n 1 120 SER n 1 121 GLN n 1 122 TYR n 1 123 LEU n 1 124 LEU n 1 125 ASN n 1 126 TRP n 1 127 CYS n 1 128 VAL n 1 129 GLN n 1 130 ILE n 1 131 ALA n 1 132 LYS n 1 133 GLY n 1 134 MET n 1 135 ASN n 1 136 TYR n 1 137 LEU n 1 138 GLU n 1 139 ASP n 1 140 ARG n 1 141 ARG n 1 142 LEU n 1 143 VAL n 1 144 HIS n 1 145 ARG n 1 146 ASP n 1 147 LEU n 1 148 ALA n 1 149 ALA n 1 150 ARG n 1 151 ASN n 1 152 VAL n 1 153 LEU n 1 154 VAL n 1 155 LYS n 1 156 THR n 1 157 PRO n 1 158 GLN n 1 159 HIS n 1 160 VAL n 1 161 LYS n 1 162 ILE n 1 163 THR n 1 164 ASP n 1 165 PHE n 1 166 GLY n 1 167 LEU n 1 168 ALA n 1 169 LYS n 1 170 LEU n 1 171 LEU n 1 172 GLY n 1 173 ALA n 1 174 GLU n 1 175 GLU n 1 176 LYS n 1 177 GLU n 1 178 TYR n 1 179 HIS n 1 180 ALA n 1 181 GLU n 1 182 GLY n 1 183 GLY n 1 184 LYS n 1 185 VAL n 1 186 PRO n 1 187 ILE n 1 188 LYS n 1 189 TRP n 1 190 MET n 1 191 ALA n 1 192 LEU n 1 193 GLU n 1 194 SER n 1 195 ILE n 1 196 LEU n 1 197 HIS n 1 198 ARG n 1 199 ILE n 1 200 TYR n 1 201 THR n 1 202 HIS n 1 203 GLN n 1 204 SER n 1 205 ASP n 1 206 VAL n 1 207 TRP n 1 208 SER n 1 209 TYR n 1 210 GLY n 1 211 VAL n 1 212 THR n 1 213 VAL n 1 214 TRP n 1 215 GLU n 1 216 LEU n 1 217 MET n 1 218 THR n 1 219 PHE n 1 220 GLY n 1 221 SER n 1 222 LYS n 1 223 PRO n 1 224 TYR n 1 225 ASP n 1 226 GLY n 1 227 ILE n 1 228 PRO n 1 229 ALA n 1 230 SER n 1 231 GLU n 1 232 ILE n 1 233 SER n 1 234 SER n 1 235 ILE n 1 236 LEU n 1 237 GLU n 1 238 LYS n 1 239 GLY n 1 240 GLU n 1 241 ARG n 1 242 LEU n 1 243 PRO n 1 244 GLN n 1 245 PRO n 1 246 PRO n 1 247 ILE n 1 248 CYS n 1 249 THR n 1 250 ILE n 1 251 ASP n 1 252 VAL n 1 253 TYR n 1 254 MET n 1 255 ILE n 1 256 MET n 1 257 VAL n 1 258 LYS n 1 259 CYS n 1 260 TRP n 1 261 MET n 1 262 ILE n 1 263 ASP n 1 264 ALA n 1 265 ASP n 1 266 SER n 1 267 ARG n 1 268 PRO n 1 269 LYS n 1 270 PHE n 1 271 ARG n 1 272 GLU n 1 273 LEU n 1 274 ILE n 1 275 ILE n 1 276 GLU n 1 277 PHE n 1 278 SER n 1 279 LYS n 1 280 MET n 1 281 ALA n 1 282 ARG n 1 283 ASP n 1 284 PRO n 1 285 GLN n 1 286 ARG n 1 287 TYR n 1 288 LEU n 1 289 VAL n 1 290 ILE n 1 291 GLN n 1 292 GLY n 1 293 ASP n 1 294 GLU n 1 295 ARG n 1 296 MET n 1 297 HIS n 1 298 LEU n 1 299 PRO n 1 300 SER n 1 301 PRO n 1 302 THR n 1 303 ASP n 1 304 SER n 1 305 ASN n 1 306 PHE n 1 307 TYR n 1 308 ARG n 1 309 ALA n 1 310 LEU n 1 311 MET n 1 312 ASP n 1 313 GLU n 1 314 GLU n 1 315 ASP n 1 316 MET n 1 317 ASP n 1 318 ASP n 1 319 VAL n 1 320 VAL n 1 321 ASP n 1 322 ALA n 1 323 ASP n 1 324 GLU n 1 325 TYR n 1 326 LEU n 1 327 ILE n 1 328 PRO n 1 329 GLN n 1 330 GLN n 1 331 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 331 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MWU non-polymer . '~{N}-pyridin-2-ylprop-2-enamide' ? 'C8 H8 N2 O' 148.162 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 692 ? ? ? A . n A 1 2 SER 2 693 ? ? ? A . n A 1 3 PRO 3 694 ? ? ? A . n A 1 4 SER 4 695 ? ? ? A . n A 1 5 GLY 5 696 ? ? ? A . n A 1 6 GLU 6 697 697 GLU GLU A . n A 1 7 ALA 7 698 698 ALA ALA A . n A 1 8 PRO 8 699 699 PRO PRO A . n A 1 9 ASN 9 700 700 ASN ASN A . n A 1 10 GLN 10 701 701 GLN GLN A . n A 1 11 ALA 11 702 702 ALA ALA A . n A 1 12 LEU 12 703 703 LEU LEU A . n A 1 13 LEU 13 704 704 LEU LEU A . n A 1 14 ARG 14 705 705 ARG ARG A . n A 1 15 ILE 15 706 706 ILE ILE A . n A 1 16 LEU 16 707 707 LEU LEU A . n A 1 17 LYS 17 708 708 LYS LYS A . n A 1 18 GLU 18 709 709 GLU GLU A . n A 1 19 THR 19 710 710 THR THR A . n A 1 20 GLU 20 711 711 GLU GLU A . n A 1 21 PHE 21 712 712 PHE PHE A . n A 1 22 LYS 22 713 713 LYS LYS A . n A 1 23 LYS 23 714 714 LYS LYS A . n A 1 24 ILE 24 715 715 ILE ILE A . n A 1 25 LYS 25 716 716 LYS LYS A . n A 1 26 VAL 26 717 717 VAL VAL A . n A 1 27 LEU 27 718 718 LEU LEU A . n A 1 28 GLY 28 719 719 GLY GLY A . n A 1 29 SER 29 720 720 SER SER A . n A 1 30 GLY 30 721 ? ? ? A . n A 1 31 ALA 31 722 ? ? ? A . n A 1 32 PHE 32 723 ? ? ? A . n A 1 33 GLY 33 724 724 GLY GLY A . n A 1 34 THR 34 725 725 THR THR A . n A 1 35 VAL 35 726 726 VAL VAL A . n A 1 36 TYR 36 727 727 TYR TYR A . n A 1 37 LYS 37 728 728 LYS LYS A . n A 1 38 GLY 38 729 729 GLY GLY A . n A 1 39 LEU 39 730 730 LEU LEU A . n A 1 40 TRP 40 731 731 TRP TRP A . n A 1 41 ILE 41 732 732 ILE ILE A . n A 1 42 PRO 42 733 733 PRO PRO A . n A 1 43 GLU 43 734 734 GLU GLU A . n A 1 44 GLY 44 735 735 GLY GLY A . n A 1 45 GLU 45 736 736 GLU GLU A . n A 1 46 LYS 46 737 737 LYS LYS A . n A 1 47 VAL 47 738 738 VAL VAL A . n A 1 48 LYS 48 739 739 LYS LYS A . n A 1 49 ILE 49 740 740 ILE ILE A . n A 1 50 PRO 50 741 741 PRO PRO A . n A 1 51 VAL 51 742 742 VAL VAL A . n A 1 52 ALA 52 743 743 ALA ALA A . n A 1 53 ILE 53 744 744 ILE ILE A . n A 1 54 LYS 54 745 745 LYS LYS A . n A 1 55 GLU 55 746 746 GLU GLU A . n A 1 56 LEU 56 747 747 LEU LEU A . n A 1 57 ARG 57 748 748 ARG ARG A . n A 1 58 GLU 58 749 749 GLU GLU A . n A 1 59 ALA 59 750 750 ALA ALA A . n A 1 60 THR 60 751 751 THR THR A . n A 1 61 SER 61 752 752 SER SER A . n A 1 62 PRO 62 753 753 PRO PRO A . n A 1 63 LYS 63 754 754 LYS LYS A . n A 1 64 ALA 64 755 755 ALA ALA A . n A 1 65 ASN 65 756 756 ASN ASN A . n A 1 66 LYS 66 757 757 LYS LYS A . n A 1 67 GLU 67 758 758 GLU GLU A . n A 1 68 ILE 68 759 759 ILE ILE A . n A 1 69 LEU 69 760 760 LEU LEU A . n A 1 70 ASP 70 761 761 ASP ASP A . n A 1 71 GLU 71 762 762 GLU GLU A . n A 1 72 ALA 72 763 763 ALA ALA A . n A 1 73 TYR 73 764 764 TYR TYR A . n A 1 74 VAL 74 765 765 VAL VAL A . n A 1 75 MET 75 766 766 MET MET A . n A 1 76 ALA 76 767 767 ALA ALA A . n A 1 77 SER 77 768 768 SER SER A . n A 1 78 VAL 78 769 769 VAL VAL A . n A 1 79 ASP 79 770 770 ASP ASP A . n A 1 80 ASN 80 771 771 ASN ASN A . n A 1 81 PRO 81 772 772 PRO PRO A . n A 1 82 HIS 82 773 773 HIS HIS A . n A 1 83 VAL 83 774 774 VAL VAL A . n A 1 84 CYS 84 775 775 CYS CYS A . n A 1 85 ARG 85 776 776 ARG ARG A . n A 1 86 LEU 86 777 777 LEU LEU A . n A 1 87 LEU 87 778 778 LEU LEU A . n A 1 88 GLY 88 779 779 GLY GLY A . n A 1 89 ILE 89 780 780 ILE ILE A . n A 1 90 CYS 90 781 781 CYS CYS A . n A 1 91 LEU 91 782 782 LEU LEU A . n A 1 92 THR 92 783 783 THR THR A . n A 1 93 SER 93 784 784 SER SER A . n A 1 94 THR 94 785 785 THR THR A . n A 1 95 VAL 95 786 786 VAL VAL A . n A 1 96 GLN 96 787 787 GLN GLN A . n A 1 97 LEU 97 788 788 LEU LEU A . n A 1 98 ILE 98 789 789 ILE ILE A . n A 1 99 THR 99 790 790 THR THR A . n A 1 100 GLN 100 791 791 GLN GLN A . n A 1 101 LEU 101 792 792 LEU LEU A . n A 1 102 MET 102 793 793 MET MET A . n A 1 103 PRO 103 794 794 PRO PRO A . n A 1 104 PHE 104 795 795 PHE PHE A . n A 1 105 GLY 105 796 796 GLY GLY A . n A 1 106 CYS 106 797 797 CYS CYS A . n A 1 107 LEU 107 798 798 LEU LEU A . n A 1 108 LEU 108 799 799 LEU LEU A . n A 1 109 ASP 109 800 800 ASP ASP A . n A 1 110 TYR 110 801 801 TYR TYR A . n A 1 111 VAL 111 802 802 VAL VAL A . n A 1 112 ARG 112 803 803 ARG ARG A . n A 1 113 GLU 113 804 804 GLU GLU A . n A 1 114 HIS 114 805 805 HIS HIS A . n A 1 115 LYS 115 806 806 LYS LYS A . n A 1 116 ASP 116 807 807 ASP ASP A . n A 1 117 ASN 117 808 808 ASN ASN A . n A 1 118 ILE 118 809 809 ILE ILE A . n A 1 119 GLY 119 810 810 GLY GLY A . n A 1 120 SER 120 811 811 SER SER A . n A 1 121 GLN 121 812 812 GLN GLN A . n A 1 122 TYR 122 813 813 TYR TYR A . n A 1 123 LEU 123 814 814 LEU LEU A . n A 1 124 LEU 124 815 815 LEU LEU A . n A 1 125 ASN 125 816 816 ASN ASN A . n A 1 126 TRP 126 817 817 TRP TRP A . n A 1 127 CYS 127 818 818 CYS CYS A . n A 1 128 VAL 128 819 819 VAL VAL A . n A 1 129 GLN 129 820 820 GLN GLN A . n A 1 130 ILE 130 821 821 ILE ILE A . n A 1 131 ALA 131 822 822 ALA ALA A . n A 1 132 LYS 132 823 823 LYS LYS A . n A 1 133 GLY 133 824 824 GLY GLY A . n A 1 134 MET 134 825 825 MET MET A . n A 1 135 ASN 135 826 826 ASN ASN A . n A 1 136 TYR 136 827 827 TYR TYR A . n A 1 137 LEU 137 828 828 LEU LEU A . n A 1 138 GLU 138 829 829 GLU GLU A . n A 1 139 ASP 139 830 830 ASP ASP A . n A 1 140 ARG 140 831 831 ARG ARG A . n A 1 141 ARG 141 832 832 ARG ARG A . n A 1 142 LEU 142 833 833 LEU LEU A . n A 1 143 VAL 143 834 834 VAL VAL A . n A 1 144 HIS 144 835 835 HIS HIS A . n A 1 145 ARG 145 836 836 ARG ARG A . n A 1 146 ASP 146 837 837 ASP ASP A . n A 1 147 LEU 147 838 838 LEU LEU A . n A 1 148 ALA 148 839 839 ALA ALA A . n A 1 149 ALA 149 840 840 ALA ALA A . n A 1 150 ARG 150 841 841 ARG ARG A . n A 1 151 ASN 151 842 842 ASN ASN A . n A 1 152 VAL 152 843 843 VAL VAL A . n A 1 153 LEU 153 844 844 LEU LEU A . n A 1 154 VAL 154 845 845 VAL VAL A . n A 1 155 LYS 155 846 846 LYS LYS A . n A 1 156 THR 156 847 847 THR THR A . n A 1 157 PRO 157 848 848 PRO PRO A . n A 1 158 GLN 158 849 849 GLN GLN A . n A 1 159 HIS 159 850 850 HIS HIS A . n A 1 160 VAL 160 851 851 VAL VAL A . n A 1 161 LYS 161 852 852 LYS LYS A . n A 1 162 ILE 162 853 853 ILE ILE A . n A 1 163 THR 163 854 854 THR THR A . n A 1 164 ASP 164 855 855 ASP ASP A . n A 1 165 PHE 165 856 856 PHE PHE A . n A 1 166 GLY 166 857 857 GLY GLY A . n A 1 167 LEU 167 858 858 LEU LEU A . n A 1 168 ALA 168 859 859 ALA ALA A . n A 1 169 LYS 169 860 860 LYS LYS A . n A 1 170 LEU 170 861 861 LEU LEU A . n A 1 171 LEU 171 862 862 LEU LEU A . n A 1 172 GLY 172 863 ? ? ? A . n A 1 173 ALA 173 864 ? ? ? A . n A 1 174 GLU 174 865 ? ? ? A . n A 1 175 GLU 175 866 ? ? ? A . n A 1 176 LYS 176 867 ? ? ? A . n A 1 177 GLU 177 868 868 GLU GLU A . n A 1 178 TYR 178 869 869 TYR TYR A . n A 1 179 HIS 179 870 870 HIS HIS A . n A 1 180 ALA 180 871 871 ALA ALA A . n A 1 181 GLU 181 872 872 GLU GLU A . n A 1 182 GLY 182 873 873 GLY GLY A . n A 1 183 GLY 183 874 874 GLY GLY A . n A 1 184 LYS 184 875 875 LYS LYS A . n A 1 185 VAL 185 876 876 VAL VAL A . n A 1 186 PRO 186 877 877 PRO PRO A . n A 1 187 ILE 187 878 878 ILE ILE A . n A 1 188 LYS 188 879 879 LYS LYS A . n A 1 189 TRP 189 880 880 TRP TRP A . n A 1 190 MET 190 881 881 MET MET A . n A 1 191 ALA 191 882 882 ALA ALA A . n A 1 192 LEU 192 883 883 LEU LEU A . n A 1 193 GLU 193 884 884 GLU GLU A . n A 1 194 SER 194 885 885 SER SER A . n A 1 195 ILE 195 886 886 ILE ILE A . n A 1 196 LEU 196 887 887 LEU LEU A . n A 1 197 HIS 197 888 888 HIS HIS A . n A 1 198 ARG 198 889 889 ARG ARG A . n A 1 199 ILE 199 890 890 ILE ILE A . n A 1 200 TYR 200 891 891 TYR TYR A . n A 1 201 THR 201 892 892 THR THR A . n A 1 202 HIS 202 893 893 HIS HIS A . n A 1 203 GLN 203 894 894 GLN GLN A . n A 1 204 SER 204 895 895 SER SER A . n A 1 205 ASP 205 896 896 ASP ASP A . n A 1 206 VAL 206 897 897 VAL VAL A . n A 1 207 TRP 207 898 898 TRP TRP A . n A 1 208 SER 208 899 899 SER SER A . n A 1 209 TYR 209 900 900 TYR TYR A . n A 1 210 GLY 210 901 901 GLY GLY A . n A 1 211 VAL 211 902 902 VAL VAL A . n A 1 212 THR 212 903 903 THR THR A . n A 1 213 VAL 213 904 904 VAL VAL A . n A 1 214 TRP 214 905 905 TRP TRP A . n A 1 215 GLU 215 906 906 GLU GLU A . n A 1 216 LEU 216 907 907 LEU LEU A . n A 1 217 MET 217 908 908 MET MET A . n A 1 218 THR 218 909 909 THR THR A . n A 1 219 PHE 219 910 910 PHE PHE A . n A 1 220 GLY 220 911 911 GLY GLY A . n A 1 221 SER 221 912 912 SER SER A . n A 1 222 LYS 222 913 913 LYS LYS A . n A 1 223 PRO 223 914 914 PRO PRO A . n A 1 224 TYR 224 915 915 TYR TYR A . n A 1 225 ASP 225 916 916 ASP ASP A . n A 1 226 GLY 226 917 917 GLY GLY A . n A 1 227 ILE 227 918 918 ILE ILE A . n A 1 228 PRO 228 919 919 PRO PRO A . n A 1 229 ALA 229 920 920 ALA ALA A . n A 1 230 SER 230 921 921 SER SER A . n A 1 231 GLU 231 922 922 GLU GLU A . n A 1 232 ILE 232 923 923 ILE ILE A . n A 1 233 SER 233 924 924 SER SER A . n A 1 234 SER 234 925 925 SER SER A . n A 1 235 ILE 235 926 926 ILE ILE A . n A 1 236 LEU 236 927 927 LEU LEU A . n A 1 237 GLU 237 928 928 GLU GLU A . n A 1 238 LYS 238 929 929 LYS LYS A . n A 1 239 GLY 239 930 930 GLY GLY A . n A 1 240 GLU 240 931 931 GLU GLU A . n A 1 241 ARG 241 932 932 ARG ARG A . n A 1 242 LEU 242 933 933 LEU LEU A . n A 1 243 PRO 243 934 934 PRO PRO A . n A 1 244 GLN 244 935 935 GLN GLN A . n A 1 245 PRO 245 936 936 PRO PRO A . n A 1 246 PRO 246 937 937 PRO PRO A . n A 1 247 ILE 247 938 938 ILE ILE A . n A 1 248 CYS 248 939 939 CYS CYS A . n A 1 249 THR 249 940 940 THR THR A . n A 1 250 ILE 250 941 941 ILE ILE A . n A 1 251 ASP 251 942 942 ASP ASP A . n A 1 252 VAL 252 943 943 VAL VAL A . n A 1 253 TYR 253 944 944 TYR TYR A . n A 1 254 MET 254 945 945 MET MET A . n A 1 255 ILE 255 946 946 ILE ILE A . n A 1 256 MET 256 947 947 MET MET A . n A 1 257 VAL 257 948 948 VAL VAL A . n A 1 258 LYS 258 949 949 LYS LYS A . n A 1 259 CYS 259 950 950 CYS CYS A . n A 1 260 TRP 260 951 951 TRP TRP A . n A 1 261 MET 261 952 952 MET MET A . n A 1 262 ILE 262 953 953 ILE ILE A . n A 1 263 ASP 263 954 954 ASP ASP A . n A 1 264 ALA 264 955 955 ALA ALA A . n A 1 265 ASP 265 956 956 ASP ASP A . n A 1 266 SER 266 957 957 SER SER A . n A 1 267 ARG 267 958 958 ARG ARG A . n A 1 268 PRO 268 959 959 PRO PRO A . n A 1 269 LYS 269 960 960 LYS LYS A . n A 1 270 PHE 270 961 961 PHE PHE A . n A 1 271 ARG 271 962 962 ARG ARG A . n A 1 272 GLU 272 963 963 GLU GLU A . n A 1 273 LEU 273 964 964 LEU LEU A . n A 1 274 ILE 274 965 965 ILE ILE A . n A 1 275 ILE 275 966 966 ILE ILE A . n A 1 276 GLU 276 967 967 GLU GLU A . n A 1 277 PHE 277 968 968 PHE PHE A . n A 1 278 SER 278 969 969 SER SER A . n A 1 279 LYS 279 970 970 LYS LYS A . n A 1 280 MET 280 971 971 MET MET A . n A 1 281 ALA 281 972 972 ALA ALA A . n A 1 282 ARG 282 973 973 ARG ARG A . n A 1 283 ASP 283 974 974 ASP ASP A . n A 1 284 PRO 284 975 975 PRO PRO A . n A 1 285 GLN 285 976 976 GLN GLN A . n A 1 286 ARG 286 977 977 ARG ARG A . n A 1 287 TYR 287 978 978 TYR TYR A . n A 1 288 LEU 288 979 979 LEU LEU A . n A 1 289 VAL 289 980 980 VAL VAL A . n A 1 290 ILE 290 981 981 ILE ILE A . n A 1 291 GLN 291 982 982 GLN GLN A . n A 1 292 GLY 292 983 983 GLY GLY A . n A 1 293 ASP 293 984 984 ASP ASP A . n A 1 294 GLU 294 985 985 GLU GLU A . n A 1 295 ARG 295 986 986 ARG ARG A . n A 1 296 MET 296 987 987 MET MET A . n A 1 297 HIS 297 988 ? ? ? A . n A 1 298 LEU 298 989 ? ? ? A . n A 1 299 PRO 299 990 ? ? ? A . n A 1 300 SER 300 991 ? ? ? A . n A 1 301 PRO 301 992 ? ? ? A . n A 1 302 THR 302 993 ? ? ? A . n A 1 303 ASP 303 994 ? ? ? A . n A 1 304 SER 304 995 ? ? ? A . n A 1 305 ASN 305 996 ? ? ? A . n A 1 306 PHE 306 997 ? ? ? A . n A 1 307 TYR 307 998 ? ? ? A . n A 1 308 ARG 308 999 ? ? ? A . n A 1 309 ALA 309 1000 ? ? ? A . n A 1 310 LEU 310 1001 ? ? ? A . n A 1 311 MET 311 1002 ? ? ? A . n A 1 312 ASP 312 1003 ? ? ? A . n A 1 313 GLU 313 1004 1004 GLU GLU A . n A 1 314 GLU 314 1005 1005 GLU GLU A . n A 1 315 ASP 315 1006 1006 ASP ASP A . n A 1 316 MET 316 1007 1007 MET MET A . n A 1 317 ASP 317 1008 1008 ASP ASP A . n A 1 318 ASP 318 1009 1009 ASP ASP A . n A 1 319 VAL 319 1010 1010 VAL VAL A . n A 1 320 VAL 320 1011 1011 VAL VAL A . n A 1 321 ASP 321 1012 1012 ASP ASP A . n A 1 322 ALA 322 1013 1013 ALA ALA A . n A 1 323 ASP 323 1014 1014 ASP ASP A . n A 1 324 GLU 324 1015 1015 GLU GLU A . n A 1 325 TYR 325 1016 1016 TYR TYR A . n A 1 326 LEU 326 1017 1017 LEU LEU A . n A 1 327 ILE 327 1018 1018 ILE ILE A . n A 1 328 PRO 328 1019 1019 PRO PRO A . n A 1 329 GLN 329 1020 ? ? ? A . n A 1 330 GLN 330 1021 ? ? ? A . n A 1 331 GLY 331 1022 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MWU _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MWU _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MWU 1 1101 3030 MWU UNL A . C 3 HOH 1 1201 3028 HOH HOH A . C 3 HOH 2 1202 3012 HOH HOH A . C 3 HOH 3 1203 3013 HOH HOH A . C 3 HOH 4 1204 3021 HOH HOH A . C 3 HOH 5 1205 3001 HOH HOH A . C 3 HOH 6 1206 3023 HOH HOH A . C 3 HOH 7 1207 3025 HOH HOH A . C 3 HOH 8 1208 3018 HOH HOH A . C 3 HOH 9 1209 3009 HOH HOH A . C 3 HOH 10 1210 3004 HOH HOH A . C 3 HOH 11 1211 3003 HOH HOH A . C 3 HOH 12 1212 3020 HOH HOH A . C 3 HOH 13 1213 3022 HOH HOH A . C 3 HOH 14 1214 3019 HOH HOH A . C 3 HOH 15 1215 3017 HOH HOH A . C 3 HOH 16 1216 3006 HOH HOH A . C 3 HOH 17 1217 3026 HOH HOH A . C 3 HOH 18 1218 3016 HOH HOH A . C 3 HOH 19 1219 3010 HOH HOH A . C 3 HOH 20 1220 3005 HOH HOH A . C 3 HOH 21 1221 3015 HOH HOH A . C 3 HOH 22 1222 3027 HOH HOH A . C 3 HOH 23 1223 3014 HOH HOH A . C 3 HOH 24 1224 3002 HOH HOH A . C 3 HOH 25 1225 3008 HOH HOH A . C 3 HOH 26 1226 3007 HOH HOH A . C 3 HOH 27 1227 3024 HOH HOH A . C 3 HOH 28 1228 3011 HOH HOH A . C 3 HOH 29 1229 3029 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 734 ? CG ? A GLU 43 CG 2 1 Y 1 A GLU 734 ? CD ? A GLU 43 CD 3 1 Y 1 A GLU 734 ? OE1 ? A GLU 43 OE1 4 1 Y 1 A GLU 734 ? OE2 ? A GLU 43 OE2 5 1 Y 1 A LEU 747 ? CG ? A LEU 56 CG 6 1 Y 1 A LEU 747 ? CD1 ? A LEU 56 CD1 7 1 Y 1 A LEU 747 ? CD2 ? A LEU 56 CD2 8 1 Y 1 A ARG 748 ? CG ? A ARG 57 CG 9 1 Y 1 A ARG 748 ? CD ? A ARG 57 CD 10 1 Y 1 A ARG 748 ? NE ? A ARG 57 NE 11 1 Y 1 A ARG 748 ? CZ ? A ARG 57 CZ 12 1 Y 1 A ARG 748 ? NH1 ? A ARG 57 NH1 13 1 Y 1 A ARG 748 ? NH2 ? A ARG 57 NH2 14 1 Y 1 A GLU 749 ? CG ? A GLU 58 CG 15 1 Y 1 A GLU 749 ? CD ? A GLU 58 CD 16 1 Y 1 A GLU 749 ? OE1 ? A GLU 58 OE1 17 1 Y 1 A GLU 749 ? OE2 ? A GLU 58 OE2 18 1 Y 1 A LYS 754 ? CG ? A LYS 63 CG 19 1 Y 1 A LYS 754 ? CD ? A LYS 63 CD 20 1 Y 1 A LYS 754 ? CE ? A LYS 63 CE 21 1 Y 1 A LYS 754 ? NZ ? A LYS 63 NZ 22 1 Y 1 A LYS 757 ? CG ? A LYS 66 CG 23 1 Y 1 A LYS 757 ? CD ? A LYS 66 CD 24 1 Y 1 A LYS 757 ? CE ? A LYS 66 CE 25 1 Y 1 A LYS 757 ? NZ ? A LYS 66 NZ 26 1 Y 1 A LYS 875 ? CG ? A LYS 184 CG 27 1 Y 1 A LYS 875 ? CD ? A LYS 184 CD 28 1 Y 1 A LYS 875 ? CE ? A LYS 184 CE 29 1 Y 1 A LYS 875 ? NZ ? A LYS 184 NZ 30 1 Y 1 A LYS 929 ? CG ? A LYS 238 CG 31 1 Y 1 A LYS 929 ? CD ? A LYS 238 CD 32 1 Y 1 A LYS 929 ? CE ? A LYS 238 CE 33 1 Y 1 A LYS 929 ? NZ ? A LYS 238 NZ 34 1 Y 1 A GLN 982 ? CG ? A GLN 291 CG 35 1 Y 1 A GLN 982 ? CD ? A GLN 291 CD 36 1 Y 1 A GLN 982 ? OE1 ? A GLN 291 OE1 37 1 Y 1 A GLN 982 ? NE2 ? A GLN 291 NE2 38 1 Y 1 A GLU 985 ? CG ? A GLU 294 CG 39 1 Y 1 A GLU 985 ? CD ? A GLU 294 CD 40 1 Y 1 A GLU 985 ? OE1 ? A GLU 294 OE1 41 1 Y 1 A GLU 985 ? OE2 ? A GLU 294 OE2 42 1 Y 1 A ARG 986 ? CG ? A ARG 295 CG 43 1 Y 1 A ARG 986 ? CD ? A ARG 295 CD 44 1 Y 1 A ARG 986 ? NE ? A ARG 295 NE 45 1 Y 1 A ARG 986 ? CZ ? A ARG 295 CZ 46 1 Y 1 A ARG 986 ? NH1 ? A ARG 295 NH1 47 1 Y 1 A ARG 986 ? NH2 ? A ARG 295 NH2 48 1 Y 1 A GLU 1004 ? CG ? A GLU 313 CG 49 1 Y 1 A GLU 1004 ? CD ? A GLU 313 CD 50 1 Y 1 A GLU 1004 ? OE1 ? A GLU 313 OE1 51 1 Y 1 A GLU 1004 ? OE2 ? A GLU 313 OE2 52 1 Y 1 A ASP 1006 ? CG ? A ASP 315 CG 53 1 Y 1 A ASP 1006 ? OD1 ? A ASP 315 OD1 54 1 Y 1 A ASP 1006 ? OD2 ? A ASP 315 OD2 55 1 Y 1 A MET 1007 ? CG ? A MET 316 CG 56 1 Y 1 A MET 1007 ? SD ? A MET 316 SD 57 1 Y 1 A MET 1007 ? CE ? A MET 316 CE # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8HV2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 145.453 _cell.length_a_esd ? _cell.length_b 145.453 _cell.length_b_esd ? _cell.length_c 145.453 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8HV2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8HV2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.41 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.90 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M TRIS pH 7.0, 1.2M Sodium citrate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 292 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.91587 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.91587 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8HV2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.798 _reflns.d_resolution_low 59.381 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11590 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 90.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.130 _reflns.pdbx_Rpim_I_all 0.039 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.124 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.798 _reflns_shell.d_res_low 2.880 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 584 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.9 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.219 _reflns_shell.pdbx_Rpim_I_all 0.641 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.480 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 56.2 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.124 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.00 _refine.B_iso_max ? _refine.B_iso_mean 80.348 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.965 _refine.correlation_coeff_Fo_to_Fc_free 0.948 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8HV2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.80 _refine.ls_d_res_low 25.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11019 _refine.ls_number_reflns_R_free 545 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 90.58 _refine.ls_percent_reflns_R_free 4.7 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.17940 _refine.ls_R_factor_R_free 0.21645 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.17741 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5EDQ _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.669 _refine.pdbx_overall_ESU_R_Free 0.297 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 14.833 _refine.overall_SU_ML 0.267 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 25.00 _refine_hist.number_atoms_solvent 29 _refine_hist.number_atoms_total 2386 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2346 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 2413 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2325 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.478 1.638 3273 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.243 1.579 5351 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.489 5.000 297 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 39.065 22.478 113 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.542 15.000 421 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.512 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.063 0.200 321 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2661 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 512 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 6.503 8.523 1194 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 6.470 8.521 1193 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 9.775 12.769 1486 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 9.775 12.774 1487 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 6.578 8.800 1219 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 6.576 8.799 1220 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 10.196 12.991 1787 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 15.083 ? 9945 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 15.082 ? 9946 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.800 _refine_ls_shell.d_res_low 2.949 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 56 _refine_ls_shell.number_reflns_R_work 1270 _refine_ls_shell.percent_reflns_obs 73.63 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.314 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.387 # _struct.entry_id 8HV2 _struct.title 'Crystal structure of EGFR_wt in complex with covalently bound fragment 4' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8HV2 _struct_keywords.text 'Epidermal growth factor receptor kinase, covalent fragments, mutant EGFR, anti-cancer, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH VCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKI TDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERL PQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDA DEYLIPQQG ; _struct_ref.pdbx_align_begin 694 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8HV2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 331 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 694 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 694 _struct_ref_seq.pdbx_auth_seq_align_end 1022 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8HV2 GLY A 1 ? UNP P00533 ? ? 'expression tag' 692 1 1 8HV2 SER A 2 ? UNP P00533 ? ? 'expression tag' 693 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 17 ? THR A 19 ? LYS A 708 THR A 710 5 ? 3 HELX_P HELX_P2 AA2 SER A 61 ? SER A 77 ? SER A 752 SER A 768 1 ? 17 HELX_P HELX_P3 AA3 CYS A 106 ? LYS A 115 ? CYS A 797 LYS A 806 1 ? 10 HELX_P HELX_P4 AA4 ASP A 116 ? ILE A 118 ? ASP A 807 ILE A 809 5 ? 3 HELX_P HELX_P5 AA5 GLY A 119 ? ARG A 140 ? GLY A 810 ARG A 831 1 ? 22 HELX_P HELX_P6 AA6 ALA A 148 ? ARG A 150 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P7 AA7 PRO A 186 ? MET A 190 ? PRO A 877 MET A 881 5 ? 5 HELX_P HELX_P8 AA8 ALA A 191 ? ARG A 198 ? ALA A 882 ARG A 889 1 ? 8 HELX_P HELX_P9 AA9 THR A 201 ? THR A 218 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P10 AB1 PRO A 228 ? LYS A 238 ? PRO A 919 LYS A 929 1 ? 11 HELX_P HELX_P11 AB2 THR A 249 ? CYS A 259 ? THR A 940 CYS A 950 1 ? 11 HELX_P HELX_P12 AB3 ASP A 263 ? ARG A 267 ? ASP A 954 ARG A 958 5 ? 5 HELX_P HELX_P13 AB4 LYS A 269 ? ARG A 282 ? LYS A 960 ARG A 973 1 ? 14 HELX_P HELX_P14 AB5 ASP A 283 ? TYR A 287 ? ASP A 974 TYR A 978 5 ? 5 HELX_P HELX_P15 AB6 ASP A 321 ? TYR A 325 ? ASP A 1012 TYR A 1016 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 84 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id MWU _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 775 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id MWU _struct_conn.ptnr2_auth_seq_id 1101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.822 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id MWU _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 84 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id MWU _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 1101 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 775 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C1 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id MWU _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 21 ? GLY A 28 ? PHE A 712 GLY A 719 AA1 2 THR A 34 ? TRP A 40 ? THR A 725 TRP A 731 AA1 3 ILE A 49 ? GLU A 55 ? ILE A 740 GLU A 746 AA1 4 VAL A 95 ? GLN A 100 ? VAL A 786 GLN A 791 AA1 5 LEU A 86 ? LEU A 91 ? LEU A 777 LEU A 782 AA2 1 LEU A 142 ? VAL A 143 ? LEU A 833 VAL A 834 AA2 2 LYS A 169 ? LEU A 170 ? LYS A 860 LEU A 861 AA3 1 VAL A 152 ? THR A 156 ? VAL A 843 THR A 847 AA3 2 HIS A 159 ? ILE A 162 ? HIS A 850 ILE A 853 AA4 1 TYR A 178 ? HIS A 179 ? TYR A 869 HIS A 870 AA4 2 ILE A 199 ? TYR A 200 ? ILE A 890 TYR A 891 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 27 ? N LEU A 718 O VAL A 35 ? O VAL A 726 AA1 2 3 N TYR A 36 ? N TYR A 727 O ILE A 53 ? O ILE A 744 AA1 3 4 N LYS A 54 ? N LYS A 745 O LEU A 97 ? O LEU A 788 AA1 4 5 O ILE A 98 ? O ILE A 789 N GLY A 88 ? N GLY A 779 AA2 1 2 N VAL A 143 ? N VAL A 834 O LYS A 169 ? O LYS A 860 AA3 1 2 N LEU A 153 ? N LEU A 844 O LYS A 161 ? O LYS A 852 AA4 1 2 N TYR A 178 ? N TYR A 869 O TYR A 200 ? O TYR A 891 # _pdbx_entry_details.entry_id 8HV2 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 736 ? ? OH A TYR 1016 ? ? 2.07 2 1 NH1 A ARG 776 ? ? O A HOH 1201 ? ? 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 836 ? ? 65.82 -1.03 2 1 ASP A 837 ? ? -147.28 39.06 3 1 ASP A 855 ? ? 59.04 78.19 4 1 GLU A 872 ? ? -150.68 72.36 5 1 LYS A 875 ? ? -56.70 109.65 6 1 ASP A 1006 ? ? -61.50 92.34 7 1 ALA A 1013 ? ? -39.98 -38.30 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 692 ? A GLY 1 2 1 Y 1 A SER 693 ? A SER 2 3 1 Y 1 A PRO 694 ? A PRO 3 4 1 Y 1 A SER 695 ? A SER 4 5 1 Y 1 A GLY 696 ? A GLY 5 6 1 Y 1 A GLY 721 ? A GLY 30 7 1 Y 1 A ALA 722 ? A ALA 31 8 1 Y 1 A PHE 723 ? A PHE 32 9 1 Y 1 A GLY 863 ? A GLY 172 10 1 Y 1 A ALA 864 ? A ALA 173 11 1 Y 1 A GLU 865 ? A GLU 174 12 1 Y 1 A GLU 866 ? A GLU 175 13 1 Y 1 A LYS 867 ? A LYS 176 14 1 Y 1 A HIS 988 ? A HIS 297 15 1 Y 1 A LEU 989 ? A LEU 298 16 1 Y 1 A PRO 990 ? A PRO 299 17 1 Y 1 A SER 991 ? A SER 300 18 1 Y 1 A PRO 992 ? A PRO 301 19 1 Y 1 A THR 993 ? A THR 302 20 1 Y 1 A ASP 994 ? A ASP 303 21 1 Y 1 A SER 995 ? A SER 304 22 1 Y 1 A ASN 996 ? A ASN 305 23 1 Y 1 A PHE 997 ? A PHE 306 24 1 Y 1 A TYR 998 ? A TYR 307 25 1 Y 1 A ARG 999 ? A ARG 308 26 1 Y 1 A ALA 1000 ? A ALA 309 27 1 Y 1 A LEU 1001 ? A LEU 310 28 1 Y 1 A MET 1002 ? A MET 311 29 1 Y 1 A ASP 1003 ? A ASP 312 30 1 Y 1 A GLN 1020 ? A GLN 329 31 1 Y 1 A GLN 1021 ? A GLN 330 32 1 Y 1 A GLY 1022 ? A GLY 331 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MWU C1 C N N 250 MWU C2 C N N 251 MWU C3 C N N 252 MWU O1 O N N 253 MWU N1 N N N 254 MWU C4 C Y N 255 MWU N2 N Y N 256 MWU C5 C Y N 257 MWU C6 C Y N 258 MWU C7 C Y N 259 MWU C8 C Y N 260 MWU H1 H N N 261 MWU H2 H N N 262 MWU H4 H N N 263 MWU H6 H N N 264 MWU H7 H N N 265 MWU H8 H N N 266 MWU H9 H N N 267 MWU H10 H N N 268 PHE N N N N 269 PHE CA C N S 270 PHE C C N N 271 PHE O O N N 272 PHE CB C N N 273 PHE CG C Y N 274 PHE CD1 C Y N 275 PHE CD2 C Y N 276 PHE CE1 C Y N 277 PHE CE2 C Y N 278 PHE CZ C Y N 279 PHE OXT O N N 280 PHE H H N N 281 PHE H2 H N N 282 PHE HA H N N 283 PHE HB2 H N N 284 PHE HB3 H N N 285 PHE HD1 H N N 286 PHE HD2 H N N 287 PHE HE1 H N N 288 PHE HE2 H N N 289 PHE HZ H N N 290 PHE HXT H N N 291 PRO N N N N 292 PRO CA C N S 293 PRO C C N N 294 PRO O O N N 295 PRO CB C N N 296 PRO CG C N N 297 PRO CD C N N 298 PRO OXT O N N 299 PRO H H N N 300 PRO HA H N N 301 PRO HB2 H N N 302 PRO HB3 H N N 303 PRO HG2 H N N 304 PRO HG3 H N N 305 PRO HD2 H N N 306 PRO HD3 H N N 307 PRO HXT H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 MWU C1 C2 doub N N 237 MWU C2 C3 sing N N 238 MWU C3 N1 sing N N 239 MWU C3 O1 doub N N 240 MWU N1 C4 sing N N 241 MWU N2 C4 doub Y N 242 MWU N2 C5 sing Y N 243 MWU C4 C8 sing Y N 244 MWU C5 C6 doub Y N 245 MWU C8 C7 doub Y N 246 MWU C6 C7 sing Y N 247 MWU C1 H1 sing N N 248 MWU C1 H2 sing N N 249 MWU C2 H4 sing N N 250 MWU N1 H6 sing N N 251 MWU C5 H7 sing N N 252 MWU C6 H8 sing N N 253 MWU C7 H9 sing N N 254 MWU C8 H10 sing N N 255 PHE N CA sing N N 256 PHE N H sing N N 257 PHE N H2 sing N N 258 PHE CA C sing N N 259 PHE CA CB sing N N 260 PHE CA HA sing N N 261 PHE C O doub N N 262 PHE C OXT sing N N 263 PHE CB CG sing N N 264 PHE CB HB2 sing N N 265 PHE CB HB3 sing N N 266 PHE CG CD1 doub Y N 267 PHE CG CD2 sing Y N 268 PHE CD1 CE1 sing Y N 269 PHE CD1 HD1 sing N N 270 PHE CD2 CE2 doub Y N 271 PHE CD2 HD2 sing N N 272 PHE CE1 CZ doub Y N 273 PHE CE1 HE1 sing N N 274 PHE CE2 CZ sing Y N 275 PHE CE2 HE2 sing N N 276 PHE CZ HZ sing N N 277 PHE OXT HXT sing N N 278 PRO N CA sing N N 279 PRO N CD sing N N 280 PRO N H sing N N 281 PRO CA C sing N N 282 PRO CA CB sing N N 283 PRO CA HA sing N N 284 PRO C O doub N N 285 PRO C OXT sing N N 286 PRO CB CG sing N N 287 PRO CB HB2 sing N N 288 PRO CB HB3 sing N N 289 PRO CG CD sing N N 290 PRO CG HG2 sing N N 291 PRO CG HG3 sing N N 292 PRO CD HD2 sing N N 293 PRO CD HD3 sing N N 294 PRO OXT HXT sing N N 295 SER N CA sing N N 296 SER N H sing N N 297 SER N H2 sing N N 298 SER CA C sing N N 299 SER CA CB sing N N 300 SER CA HA sing N N 301 SER C O doub N N 302 SER C OXT sing N N 303 SER CB OG sing N N 304 SER CB HB2 sing N N 305 SER CB HB3 sing N N 306 SER OG HG sing N N 307 SER OXT HXT sing N N 308 THR N CA sing N N 309 THR N H sing N N 310 THR N H2 sing N N 311 THR CA C sing N N 312 THR CA CB sing N N 313 THR CA HA sing N N 314 THR C O doub N N 315 THR C OXT sing N N 316 THR CB OG1 sing N N 317 THR CB CG2 sing N N 318 THR CB HB sing N N 319 THR OG1 HG1 sing N N 320 THR CG2 HG21 sing N N 321 THR CG2 HG22 sing N N 322 THR CG2 HG23 sing N N 323 THR OXT HXT sing N N 324 TRP N CA sing N N 325 TRP N H sing N N 326 TRP N H2 sing N N 327 TRP CA C sing N N 328 TRP CA CB sing N N 329 TRP CA HA sing N N 330 TRP C O doub N N 331 TRP C OXT sing N N 332 TRP CB CG sing N N 333 TRP CB HB2 sing N N 334 TRP CB HB3 sing N N 335 TRP CG CD1 doub Y N 336 TRP CG CD2 sing Y N 337 TRP CD1 NE1 sing Y N 338 TRP CD1 HD1 sing N N 339 TRP CD2 CE2 doub Y N 340 TRP CD2 CE3 sing Y N 341 TRP NE1 CE2 sing Y N 342 TRP NE1 HE1 sing N N 343 TRP CE2 CZ2 sing Y N 344 TRP CE3 CZ3 doub Y N 345 TRP CE3 HE3 sing N N 346 TRP CZ2 CH2 doub Y N 347 TRP CZ2 HZ2 sing N N 348 TRP CZ3 CH2 sing Y N 349 TRP CZ3 HZ3 sing N N 350 TRP CH2 HH2 sing N N 351 TRP OXT HXT sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5EDQ _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8HV2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006875 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006875 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006875 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_