data_8I0M # _entry.id 8I0M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8I0M pdb_00008i0m 10.2210/pdb8i0m/pdb WWPDB D_1300034715 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8I0M _pdbx_database_status.recvd_initial_deposition_date 2023-01-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email yuxin.leaf@icloud.com _pdbx_contact_author.name_first Yuxin _pdbx_contact_author.name_last Ye _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3951-5709 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jiang, C.' 1 ? 'Ye, Y.' 2 ? 'Huang, Y.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of CDK6 in complex with inhibitor' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jiang, C.' 1 ? primary 'Ye, Y.' 2 ? primary 'Huang, Y.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cyclin-dependent kinase 6' 34190.348 1 2.7.11.22 ? ? ? 2 non-polymer syn '2-[(4-azanylcyclohexyl)amino]-7-cyclopentyl-~{N},~{N}-dimethyl-pyrrolo[2,3-d]pyrimidine-6-carboxamide' 370.492 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cell division protein kinase 6,Serine/threonine-protein kinase PLSTIRE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLF DVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIK LADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLF DVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIK LADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '2-[(4-azanylcyclohexyl)amino]-7-cyclopentyl-~{N},~{N}-dimethyl-pyrrolo[2,3-d]pyrimidine-6-carboxamide' _pdbx_entity_nonpoly.comp_id NJ6 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LYS n 1 4 ASP n 1 5 GLY n 1 6 LEU n 1 7 CYS n 1 8 ARG n 1 9 ALA n 1 10 ASP n 1 11 GLN n 1 12 GLN n 1 13 TYR n 1 14 GLU n 1 15 CYS n 1 16 VAL n 1 17 ALA n 1 18 GLU n 1 19 ILE n 1 20 GLY n 1 21 GLU n 1 22 GLY n 1 23 ALA n 1 24 TYR n 1 25 GLY n 1 26 LYS n 1 27 VAL n 1 28 PHE n 1 29 LYS n 1 30 ALA n 1 31 ARG n 1 32 ASP n 1 33 LEU n 1 34 LYS n 1 35 ASN n 1 36 GLY n 1 37 GLY n 1 38 ARG n 1 39 PHE n 1 40 VAL n 1 41 ALA n 1 42 LEU n 1 43 LYS n 1 44 ARG n 1 45 VAL n 1 46 ARG n 1 47 VAL n 1 48 GLN n 1 49 THR n 1 50 GLY n 1 51 GLU n 1 52 GLU n 1 53 GLY n 1 54 MET n 1 55 PRO n 1 56 LEU n 1 57 SER n 1 58 THR n 1 59 ILE n 1 60 ARG n 1 61 GLU n 1 62 VAL n 1 63 ALA n 1 64 VAL n 1 65 LEU n 1 66 ARG n 1 67 HIS n 1 68 LEU n 1 69 GLU n 1 70 THR n 1 71 PHE n 1 72 GLU n 1 73 HIS n 1 74 PRO n 1 75 ASN n 1 76 VAL n 1 77 VAL n 1 78 ARG n 1 79 LEU n 1 80 PHE n 1 81 ASP n 1 82 VAL n 1 83 CYS n 1 84 THR n 1 85 VAL n 1 86 SER n 1 87 ARG n 1 88 THR n 1 89 ASP n 1 90 ARG n 1 91 GLU n 1 92 THR n 1 93 LYS n 1 94 LEU n 1 95 THR n 1 96 LEU n 1 97 VAL n 1 98 PHE n 1 99 GLU n 1 100 HIS n 1 101 VAL n 1 102 ASP n 1 103 GLN n 1 104 ASP n 1 105 LEU n 1 106 THR n 1 107 THR n 1 108 TYR n 1 109 LEU n 1 110 ASP n 1 111 LYS n 1 112 VAL n 1 113 PRO n 1 114 GLU n 1 115 PRO n 1 116 GLY n 1 117 VAL n 1 118 PRO n 1 119 THR n 1 120 GLU n 1 121 THR n 1 122 ILE n 1 123 LYS n 1 124 ASP n 1 125 MET n 1 126 MET n 1 127 PHE n 1 128 GLN n 1 129 LEU n 1 130 LEU n 1 131 ARG n 1 132 GLY n 1 133 LEU n 1 134 ASP n 1 135 PHE n 1 136 LEU n 1 137 HIS n 1 138 SER n 1 139 HIS n 1 140 ARG n 1 141 VAL n 1 142 VAL n 1 143 HIS n 1 144 ARG n 1 145 ASP n 1 146 LEU n 1 147 LYS n 1 148 PRO n 1 149 GLN n 1 150 ASN n 1 151 ILE n 1 152 LEU n 1 153 VAL n 1 154 THR n 1 155 SER n 1 156 SER n 1 157 GLY n 1 158 GLN n 1 159 ILE n 1 160 LYS n 1 161 LEU n 1 162 ALA n 1 163 ASP n 1 164 PHE n 1 165 GLY n 1 166 LEU n 1 167 ALA n 1 168 ARG n 1 169 ILE n 1 170 TYR n 1 171 SER n 1 172 PHE n 1 173 GLN n 1 174 MET n 1 175 ALA n 1 176 LEU n 1 177 THR n 1 178 SER n 1 179 VAL n 1 180 VAL n 1 181 VAL n 1 182 THR n 1 183 LEU n 1 184 TRP n 1 185 TYR n 1 186 ARG n 1 187 ALA n 1 188 PRO n 1 189 GLU n 1 190 VAL n 1 191 LEU n 1 192 LEU n 1 193 GLN n 1 194 SER n 1 195 SER n 1 196 TYR n 1 197 ALA n 1 198 THR n 1 199 PRO n 1 200 VAL n 1 201 ASP n 1 202 LEU n 1 203 TRP n 1 204 SER n 1 205 VAL n 1 206 GLY n 1 207 CYS n 1 208 ILE n 1 209 PHE n 1 210 ALA n 1 211 GLU n 1 212 MET n 1 213 PHE n 1 214 ARG n 1 215 ARG n 1 216 LYS n 1 217 PRO n 1 218 LEU n 1 219 PHE n 1 220 ARG n 1 221 GLY n 1 222 SER n 1 223 SER n 1 224 ASP n 1 225 VAL n 1 226 ASP n 1 227 GLN n 1 228 LEU n 1 229 GLY n 1 230 LYS n 1 231 ILE n 1 232 LEU n 1 233 ASP n 1 234 VAL n 1 235 ILE n 1 236 GLY n 1 237 LEU n 1 238 PRO n 1 239 GLY n 1 240 GLU n 1 241 GLU n 1 242 ASP n 1 243 TRP n 1 244 PRO n 1 245 ARG n 1 246 ASP n 1 247 VAL n 1 248 ALA n 1 249 LEU n 1 250 PRO n 1 251 ARG n 1 252 GLN n 1 253 ALA n 1 254 PHE n 1 255 HIS n 1 256 SER n 1 257 LYS n 1 258 SER n 1 259 ALA n 1 260 GLN n 1 261 PRO n 1 262 ILE n 1 263 GLU n 1 264 LYS n 1 265 PHE n 1 266 VAL n 1 267 THR n 1 268 ASP n 1 269 ILE n 1 270 ASP n 1 271 GLU n 1 272 LEU n 1 273 GLY n 1 274 LYS n 1 275 ASP n 1 276 LEU n 1 277 LEU n 1 278 LEU n 1 279 LYS n 1 280 CYS n 1 281 LEU n 1 282 THR n 1 283 PHE n 1 284 ASN n 1 285 PRO n 1 286 ALA n 1 287 LYS n 1 288 ARG n 1 289 ILE n 1 290 SER n 1 291 ALA n 1 292 TYR n 1 293 SER n 1 294 ALA n 1 295 LEU n 1 296 SER n 1 297 HIS n 1 298 PRO n 1 299 TYR n 1 300 PHE n 1 301 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 301 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CDK6, CDKN6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NJ6 non-polymer . '2-[(4-azanylcyclohexyl)amino]-7-cyclopentyl-~{N},~{N}-dimethyl-pyrrolo[2,3-d]pyrimidine-6-carboxamide' ? 'C20 H30 N6 O' 370.492 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 CYS 7 7 ? ? ? A . n A 1 8 ARG 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 ASP 10 10 ? ? ? A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ARG 46 46 ? ? ? A . n A 1 47 VAL 47 47 ? ? ? A . n A 1 48 GLN 48 48 ? ? ? A . n A 1 49 THR 49 49 ? ? ? A . n A 1 50 GLY 50 50 ? ? ? A . n A 1 51 GLU 51 51 ? ? ? A . n A 1 52 GLU 52 52 ? ? ? A . n A 1 53 GLY 53 53 ? ? ? A . n A 1 54 MET 54 54 ? ? ? A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 VAL 85 85 ? ? ? A . n A 1 86 SER 86 86 ? ? ? A . n A 1 87 ARG 87 87 ? ? ? A . n A 1 88 THR 88 88 ? ? ? A . n A 1 89 ASP 89 89 ? ? ? A . n A 1 90 ARG 90 90 ? ? ? A . n A 1 91 GLU 91 91 ? ? ? A . n A 1 92 THR 92 92 ? ? ? A . n A 1 93 LYS 93 93 ? ? ? A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 MET 125 125 125 MET MET A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ARG 168 168 ? ? ? A . n A 1 169 ILE 169 169 ? ? ? A . n A 1 170 TYR 170 170 ? ? ? A . n A 1 171 SER 171 171 ? ? ? A . n A 1 172 PHE 172 172 ? ? ? A . n A 1 173 GLN 173 173 ? ? ? A . n A 1 174 MET 174 174 ? ? ? A . n A 1 175 ALA 175 175 ? ? ? A . n A 1 176 LEU 176 176 ? ? ? A . n A 1 177 THR 177 177 ? ? ? A . n A 1 178 SER 178 178 ? ? ? A . n A 1 179 VAL 179 179 ? ? ? A . n A 1 180 VAL 180 180 ? ? ? A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 TRP 184 184 184 TRP TRP A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 GLN 193 193 193 GLN GLN A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 TYR 196 196 196 TYR TYR A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 TRP 203 203 203 TRP TRP A . n A 1 204 SER 204 204 204 SER SER A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 CYS 207 207 207 CYS CYS A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 PHE 209 209 209 PHE PHE A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 MET 212 212 212 MET MET A . n A 1 213 PHE 213 213 213 PHE PHE A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 ARG 215 215 215 ARG ARG A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 PRO 217 217 217 PRO PRO A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 SER 223 223 223 SER SER A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 ASP 226 226 226 ASP ASP A . n A 1 227 GLN 227 227 227 GLN GLN A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 LYS 230 230 230 LYS LYS A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 ASP 233 233 233 ASP ASP A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 PRO 238 238 238 PRO PRO A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 GLU 241 241 241 GLU GLU A . n A 1 242 ASP 242 242 242 ASP ASP A . n A 1 243 TRP 243 243 243 TRP TRP A . n A 1 244 PRO 244 244 244 PRO PRO A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 ASP 246 246 246 ASP ASP A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 PRO 250 250 250 PRO PRO A . n A 1 251 ARG 251 251 251 ARG ARG A . n A 1 252 GLN 252 252 252 GLN GLN A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 PHE 254 254 254 PHE PHE A . n A 1 255 HIS 255 255 255 HIS HIS A . n A 1 256 SER 256 256 256 SER SER A . n A 1 257 LYS 257 257 257 LYS LYS A . n A 1 258 SER 258 258 258 SER SER A . n A 1 259 ALA 259 259 259 ALA ALA A . n A 1 260 GLN 260 260 260 GLN GLN A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 ILE 262 262 262 ILE ILE A . n A 1 263 GLU 263 263 263 GLU GLU A . n A 1 264 LYS 264 264 264 LYS LYS A . n A 1 265 PHE 265 265 265 PHE PHE A . n A 1 266 VAL 266 266 266 VAL VAL A . n A 1 267 THR 267 267 267 THR THR A . n A 1 268 ASP 268 268 268 ASP ASP A . n A 1 269 ILE 269 269 269 ILE ILE A . n A 1 270 ASP 270 270 270 ASP ASP A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 GLY 273 273 273 GLY GLY A . n A 1 274 LYS 274 274 274 LYS LYS A . n A 1 275 ASP 275 275 275 ASP ASP A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 CYS 280 280 280 CYS CYS A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 THR 282 282 282 THR THR A . n A 1 283 PHE 283 283 283 PHE PHE A . n A 1 284 ASN 284 284 284 ASN ASN A . n A 1 285 PRO 285 285 285 PRO PRO A . n A 1 286 ALA 286 286 286 ALA ALA A . n A 1 287 LYS 287 287 287 LYS LYS A . n A 1 288 ARG 288 288 288 ARG ARG A . n A 1 289 ILE 289 289 289 ILE ILE A . n A 1 290 SER 290 290 290 SER SER A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 TYR 292 292 292 TYR TYR A . n A 1 293 SER 293 293 293 SER SER A . n A 1 294 ALA 294 294 294 ALA ALA A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 SER 296 296 296 SER SER A . n A 1 297 HIS 297 297 297 HIS HIS A . n A 1 298 PRO 298 298 298 PRO PRO A . n A 1 299 TYR 299 299 299 TYR TYR A . n A 1 300 PHE 300 300 300 PHE PHE A . n A 1 301 GLN 301 301 301 GLN GLN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id NJ6 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 401 _pdbx_nonpoly_scheme.auth_seq_num 401 _pdbx_nonpoly_scheme.pdb_mon_id NJ6 _pdbx_nonpoly_scheme.auth_mon_id LIG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 14 ? CG ? A GLU 14 CG 2 1 Y 1 A GLU 14 ? CD ? A GLU 14 CD 3 1 Y 1 A GLU 14 ? OE1 ? A GLU 14 OE1 4 1 Y 1 A GLU 14 ? OE2 ? A GLU 14 OE2 5 1 Y 1 A GLU 21 ? CG ? A GLU 21 CG 6 1 Y 1 A GLU 21 ? CD ? A GLU 21 CD 7 1 Y 1 A GLU 21 ? OE1 ? A GLU 21 OE1 8 1 Y 1 A GLU 21 ? OE2 ? A GLU 21 OE2 9 1 Y 1 A TYR 24 ? CG ? A TYR 24 CG 10 1 Y 1 A TYR 24 ? CD1 ? A TYR 24 CD1 11 1 Y 1 A TYR 24 ? CD2 ? A TYR 24 CD2 12 1 Y 1 A TYR 24 ? CE1 ? A TYR 24 CE1 13 1 Y 1 A TYR 24 ? CE2 ? A TYR 24 CE2 14 1 Y 1 A TYR 24 ? CZ ? A TYR 24 CZ 15 1 Y 1 A TYR 24 ? OH ? A TYR 24 OH 16 1 Y 1 A LYS 26 ? CG ? A LYS 26 CG 17 1 Y 1 A LYS 26 ? CD ? A LYS 26 CD 18 1 Y 1 A LYS 26 ? CE ? A LYS 26 CE 19 1 Y 1 A LYS 26 ? NZ ? A LYS 26 NZ 20 1 Y 1 A GLU 61 ? CG ? A GLU 61 CG 21 1 Y 1 A GLU 61 ? CD ? A GLU 61 CD 22 1 Y 1 A GLU 61 ? OE1 ? A GLU 61 OE1 23 1 Y 1 A GLU 61 ? OE2 ? A GLU 61 OE2 24 1 Y 1 A LYS 111 ? CG ? A LYS 111 CG 25 1 Y 1 A LYS 111 ? CD ? A LYS 111 CD 26 1 Y 1 A LYS 111 ? CE ? A LYS 111 CE 27 1 Y 1 A LYS 111 ? NZ ? A LYS 111 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 7.1.010 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8I0M _cell.details ? _cell.formula_units_Z ? _cell.length_a 100.870 _cell.length_a_esd ? _cell.length_b 100.870 _cell.length_b_esd ? _cell.length_c 59.480 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8I0M _symmetry.cell_setting ? _symmetry.Int_Tables_number 79 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8I0M _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M BIS-TRIS pH 7.0, 20% PEG 4,000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-10-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97910 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL02U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97910 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL02U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8I0M _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.772 _reflns.d_resolution_low 27.45 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7680 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.73 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.71 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1668 _reflns.pdbx_Rpim_I_all 0.04492 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1606 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.772 _reflns_shell.d_res_low 2.871 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.85 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 739 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.417 _reflns_shell.pdbx_Rpim_I_all 0.6895 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.565 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.53 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.314 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 2.47 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 2.47 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -4.94 _refine.B_iso_max ? _refine.B_iso_mean 76.013 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.952 _refine.correlation_coeff_Fo_to_Fc_free 0.918 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8I0M _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7772 _refine.ls_d_res_low 27.45 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7303 _refine.ls_number_reflns_R_free 382 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.74 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20665 _refine.ls_R_factor_R_free 0.28160 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20300 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.424 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 19.688 _refine.overall_SU_ML 0.387 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.7772 _refine_hist.d_res_low 27.45 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2080 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2053 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 2129 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2057 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.388 1.644 2889 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.222 1.579 4726 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.336 5.000 256 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 31.462 21.091 110 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 21.044 15.000 352 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.167 15.000 16 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.052 0.200 272 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 2350 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 488 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 6.094 7.809 1036 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 6.093 7.807 1035 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 8.780 11.724 1288 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 8.777 11.726 1289 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 6.910 8.344 1093 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 6.907 8.342 1094 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 10.391 12.266 1602 ? r_scangle_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.7772 _refine_ls_shell.d_res_low 2.844 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 29 _refine_ls_shell.number_reflns_R_work 530 _refine_ls_shell.percent_reflns_obs 98.07 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.387 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.423 # _struct.entry_id 8I0M _struct.title 'Structure of CDK6 in complex with inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8I0M _struct_keywords.text 'CDK6, inhibitor, complex, CELL CYCLE, CELL CYCLE-INHIBITOR complex' _struct_keywords.pdbx_keywords 'CELL CYCLE/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDK6_HUMAN _struct_ref.pdbx_db_accession Q00534 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLF DVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIK LADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8I0M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 301 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q00534 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 301 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 301 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 34 ? GLY A 36 ? LYS A 34 GLY A 36 5 ? 3 HELX_P HELX_P2 AA2 LEU A 56 ? THR A 70 ? LEU A 56 THR A 70 1 ? 15 HELX_P HELX_P3 AA3 ASP A 104 ? LYS A 111 ? ASP A 104 LYS A 111 1 ? 8 HELX_P HELX_P4 AA4 PRO A 118 ? HIS A 139 ? PRO A 118 HIS A 139 1 ? 22 HELX_P HELX_P5 AA5 ALA A 187 ? LEU A 192 ? ALA A 187 LEU A 192 1 ? 6 HELX_P HELX_P6 AA6 THR A 198 ? ARG A 215 ? THR A 198 ARG A 215 1 ? 18 HELX_P HELX_P7 AA7 SER A 223 ? GLY A 236 ? SER A 223 GLY A 236 1 ? 14 HELX_P HELX_P8 AA8 GLY A 239 ? TRP A 243 ? GLY A 239 TRP A 243 5 ? 5 HELX_P HELX_P9 AA9 PRO A 250 ? PHE A 254 ? PRO A 250 PHE A 254 5 ? 5 HELX_P HELX_P10 AB1 PRO A 261 ? PHE A 265 ? PRO A 261 PHE A 265 5 ? 5 HELX_P HELX_P11 AB2 ASP A 270 ? LEU A 281 ? ASP A 270 LEU A 281 1 ? 12 HELX_P HELX_P12 AB3 SER A 290 ? LEU A 295 ? SER A 290 LEU A 295 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 114 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 114 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 115 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 115 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 16.77 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 13 ? GLU A 21 ? TYR A 13 GLU A 21 AA1 2 LYS A 26 ? ASP A 32 ? LYS A 26 ASP A 32 AA1 3 PHE A 39 ? ARG A 44 ? PHE A 39 ARG A 44 AA1 4 THR A 95 ? GLU A 99 ? THR A 95 GLU A 99 AA1 5 LEU A 79 ? CYS A 83 ? LEU A 79 CYS A 83 AA2 1 ILE A 151 ? VAL A 153 ? ILE A 151 VAL A 153 AA2 2 ILE A 159 ? LEU A 161 ? ILE A 159 LEU A 161 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 17 ? N ALA A 17 O LYS A 29 ? O LYS A 29 AA1 2 3 N PHE A 28 ? N PHE A 28 O LEU A 42 ? O LEU A 42 AA1 3 4 N ALA A 41 ? N ALA A 41 O PHE A 98 ? O PHE A 98 AA1 4 5 O VAL A 97 ? O VAL A 97 N ASP A 81 ? N ASP A 81 AA2 1 2 N LEU A 152 ? N LEU A 152 O LYS A 160 ? O LYS A 160 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 21 ? ? 49.69 -91.76 2 1 GLU A 72 ? ? 28.41 69.86 3 1 ARG A 144 ? ? 79.68 -19.79 4 1 ASP A 145 ? ? -141.98 48.28 5 1 ASP A 163 ? ? 63.10 60.43 6 1 ASP A 246 ? ? 63.83 60.02 7 1 SER A 258 ? ? -87.83 -86.86 8 1 ALA A 259 ? ? 154.30 77.03 9 1 LEU A 281 ? ? -95.85 37.15 # _pdbx_entry_details.entry_id 8I0M _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A CYS 7 ? A CYS 7 8 1 Y 1 A ARG 8 ? A ARG 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A ASP 10 ? A ASP 10 11 1 Y 1 A ARG 46 ? A ARG 46 12 1 Y 1 A VAL 47 ? A VAL 47 13 1 Y 1 A GLN 48 ? A GLN 48 14 1 Y 1 A THR 49 ? A THR 49 15 1 Y 1 A GLY 50 ? A GLY 50 16 1 Y 1 A GLU 51 ? A GLU 51 17 1 Y 1 A GLU 52 ? A GLU 52 18 1 Y 1 A GLY 53 ? A GLY 53 19 1 Y 1 A MET 54 ? A MET 54 20 1 Y 1 A VAL 85 ? A VAL 85 21 1 Y 1 A SER 86 ? A SER 86 22 1 Y 1 A ARG 87 ? A ARG 87 23 1 Y 1 A THR 88 ? A THR 88 24 1 Y 1 A ASP 89 ? A ASP 89 25 1 Y 1 A ARG 90 ? A ARG 90 26 1 Y 1 A GLU 91 ? A GLU 91 27 1 Y 1 A THR 92 ? A THR 92 28 1 Y 1 A LYS 93 ? A LYS 93 29 1 Y 1 A ARG 168 ? A ARG 168 30 1 Y 1 A ILE 169 ? A ILE 169 31 1 Y 1 A TYR 170 ? A TYR 170 32 1 Y 1 A SER 171 ? A SER 171 33 1 Y 1 A PHE 172 ? A PHE 172 34 1 Y 1 A GLN 173 ? A GLN 173 35 1 Y 1 A MET 174 ? A MET 174 36 1 Y 1 A ALA 175 ? A ALA 175 37 1 Y 1 A LEU 176 ? A LEU 176 38 1 Y 1 A THR 177 ? A THR 177 39 1 Y 1 A SER 178 ? A SER 178 40 1 Y 1 A VAL 179 ? A VAL 179 41 1 Y 1 A VAL 180 ? A VAL 180 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 NJ6 N1 N N N 247 NJ6 N3 N Y N 248 NJ6 C4 C N N 249 NJ6 C5 C N N 250 NJ6 C6 C N N 251 NJ6 C7 C Y N 252 NJ6 C8 C Y N 253 NJ6 C10 C Y N 254 NJ6 C13 C N N 255 NJ6 C15 C N N 256 NJ6 C17 C N N 257 NJ6 C20 C N N 258 NJ6 C1 C N N 259 NJ6 C11 C Y N 260 NJ6 C12 C Y N 261 NJ6 C14 C N N 262 NJ6 C16 C N N 263 NJ6 C18 C N N 264 NJ6 C19 C N N 265 NJ6 C2 C N N 266 NJ6 C3 C N N 267 NJ6 C9 C Y N 268 NJ6 N2 N N N 269 NJ6 N4 N Y N 270 NJ6 N5 N Y N 271 NJ6 N6 N N N 272 NJ6 O1 O N N 273 NJ6 H1 H N N 274 NJ6 H2 H N N 275 NJ6 H3 H N N 276 NJ6 H4 H N N 277 NJ6 H5 H N N 278 NJ6 H6 H N N 279 NJ6 H7 H N N 280 NJ6 H8 H N N 281 NJ6 H9 H N N 282 NJ6 H10 H N N 283 NJ6 H11 H N N 284 NJ6 H12 H N N 285 NJ6 H13 H N N 286 NJ6 H14 H N N 287 NJ6 H15 H N N 288 NJ6 H16 H N N 289 NJ6 H17 H N N 290 NJ6 H18 H N N 291 NJ6 H19 H N N 292 NJ6 H20 H N N 293 NJ6 H21 H N N 294 NJ6 H22 H N N 295 NJ6 H23 H N N 296 NJ6 H24 H N N 297 NJ6 H25 H N N 298 NJ6 H26 H N N 299 NJ6 H27 H N N 300 NJ6 H28 H N N 301 NJ6 H29 H N N 302 NJ6 H30 H N N 303 PHE N N N N 304 PHE CA C N S 305 PHE C C N N 306 PHE O O N N 307 PHE CB C N N 308 PHE CG C Y N 309 PHE CD1 C Y N 310 PHE CD2 C Y N 311 PHE CE1 C Y N 312 PHE CE2 C Y N 313 PHE CZ C Y N 314 PHE OXT O N N 315 PHE H H N N 316 PHE H2 H N N 317 PHE HA H N N 318 PHE HB2 H N N 319 PHE HB3 H N N 320 PHE HD1 H N N 321 PHE HD2 H N N 322 PHE HE1 H N N 323 PHE HE2 H N N 324 PHE HZ H N N 325 PHE HXT H N N 326 PRO N N N N 327 PRO CA C N S 328 PRO C C N N 329 PRO O O N N 330 PRO CB C N N 331 PRO CG C N N 332 PRO CD C N N 333 PRO OXT O N N 334 PRO H H N N 335 PRO HA H N N 336 PRO HB2 H N N 337 PRO HB3 H N N 338 PRO HG2 H N N 339 PRO HG3 H N N 340 PRO HD2 H N N 341 PRO HD3 H N N 342 PRO HXT H N N 343 SER N N N N 344 SER CA C N S 345 SER C C N N 346 SER O O N N 347 SER CB C N N 348 SER OG O N N 349 SER OXT O N N 350 SER H H N N 351 SER H2 H N N 352 SER HA H N N 353 SER HB2 H N N 354 SER HB3 H N N 355 SER HG H N N 356 SER HXT H N N 357 THR N N N N 358 THR CA C N S 359 THR C C N N 360 THR O O N N 361 THR CB C N R 362 THR OG1 O N N 363 THR CG2 C N N 364 THR OXT O N N 365 THR H H N N 366 THR H2 H N N 367 THR HA H N N 368 THR HB H N N 369 THR HG1 H N N 370 THR HG21 H N N 371 THR HG22 H N N 372 THR HG23 H N N 373 THR HXT H N N 374 TRP N N N N 375 TRP CA C N S 376 TRP C C N N 377 TRP O O N N 378 TRP CB C N N 379 TRP CG C Y N 380 TRP CD1 C Y N 381 TRP CD2 C Y N 382 TRP NE1 N Y N 383 TRP CE2 C Y N 384 TRP CE3 C Y N 385 TRP CZ2 C Y N 386 TRP CZ3 C Y N 387 TRP CH2 C Y N 388 TRP OXT O N N 389 TRP H H N N 390 TRP H2 H N N 391 TRP HA H N N 392 TRP HB2 H N N 393 TRP HB3 H N N 394 TRP HD1 H N N 395 TRP HE1 H N N 396 TRP HE3 H N N 397 TRP HZ2 H N N 398 TRP HZ3 H N N 399 TRP HH2 H N N 400 TRP HXT H N N 401 TYR N N N N 402 TYR CA C N S 403 TYR C C N N 404 TYR O O N N 405 TYR CB C N N 406 TYR CG C Y N 407 TYR CD1 C Y N 408 TYR CD2 C Y N 409 TYR CE1 C Y N 410 TYR CE2 C Y N 411 TYR CZ C Y N 412 TYR OH O N N 413 TYR OXT O N N 414 TYR H H N N 415 TYR H2 H N N 416 TYR HA H N N 417 TYR HB2 H N N 418 TYR HB3 H N N 419 TYR HD1 H N N 420 TYR HD2 H N N 421 TYR HE1 H N N 422 TYR HE2 H N N 423 TYR HH H N N 424 TYR HXT H N N 425 VAL N N N N 426 VAL CA C N S 427 VAL C C N N 428 VAL O O N N 429 VAL CB C N N 430 VAL CG1 C N N 431 VAL CG2 C N N 432 VAL OXT O N N 433 VAL H H N N 434 VAL H2 H N N 435 VAL HA H N N 436 VAL HB H N N 437 VAL HG11 H N N 438 VAL HG12 H N N 439 VAL HG13 H N N 440 VAL HG21 H N N 441 VAL HG22 H N N 442 VAL HG23 H N N 443 VAL HXT H N N 444 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 NJ6 C20 N6 sing N N 235 NJ6 C17 C16 sing N N 236 NJ6 C17 C13 sing N N 237 NJ6 C4 C3 sing N N 238 NJ6 C4 C5 sing N N 239 NJ6 N6 C19 sing N N 240 NJ6 N6 C18 sing N N 241 NJ6 N4 C10 doub Y N 242 NJ6 N4 C7 sing Y N 243 NJ6 C10 C9 sing Y N 244 NJ6 N1 C7 sing N N 245 NJ6 N1 C5 sing N N 246 NJ6 C3 C2 sing N N 247 NJ6 C7 N3 doub Y N 248 NJ6 C16 C15 sing N N 249 NJ6 C9 C12 sing Y N 250 NJ6 C9 C8 doub Y N 251 NJ6 C12 C11 doub Y N 252 NJ6 N3 C8 sing Y N 253 NJ6 C8 N5 sing Y N 254 NJ6 C11 N5 sing Y N 255 NJ6 C11 C18 sing N N 256 NJ6 N5 C13 sing N N 257 NJ6 C5 C6 sing N N 258 NJ6 C18 O1 doub N N 259 NJ6 C13 C14 sing N N 260 NJ6 C15 C14 sing N N 261 NJ6 C2 N2 sing N N 262 NJ6 C2 C1 sing N N 263 NJ6 C6 C1 sing N N 264 NJ6 N1 H1 sing N N 265 NJ6 C4 H2 sing N N 266 NJ6 C4 H3 sing N N 267 NJ6 C5 H4 sing N N 268 NJ6 C6 H5 sing N N 269 NJ6 C6 H6 sing N N 270 NJ6 C10 H7 sing N N 271 NJ6 C13 H8 sing N N 272 NJ6 C15 H9 sing N N 273 NJ6 C15 H10 sing N N 274 NJ6 C17 H11 sing N N 275 NJ6 C17 H12 sing N N 276 NJ6 C20 H13 sing N N 277 NJ6 C20 H14 sing N N 278 NJ6 C20 H15 sing N N 279 NJ6 C1 H16 sing N N 280 NJ6 C1 H17 sing N N 281 NJ6 C12 H18 sing N N 282 NJ6 C14 H19 sing N N 283 NJ6 C14 H20 sing N N 284 NJ6 C16 H21 sing N N 285 NJ6 C16 H22 sing N N 286 NJ6 C19 H23 sing N N 287 NJ6 C19 H24 sing N N 288 NJ6 C19 H25 sing N N 289 NJ6 C2 H26 sing N N 290 NJ6 C3 H27 sing N N 291 NJ6 C3 H28 sing N N 292 NJ6 N2 H29 sing N N 293 NJ6 N2 H30 sing N N 294 PHE N CA sing N N 295 PHE N H sing N N 296 PHE N H2 sing N N 297 PHE CA C sing N N 298 PHE CA CB sing N N 299 PHE CA HA sing N N 300 PHE C O doub N N 301 PHE C OXT sing N N 302 PHE CB CG sing N N 303 PHE CB HB2 sing N N 304 PHE CB HB3 sing N N 305 PHE CG CD1 doub Y N 306 PHE CG CD2 sing Y N 307 PHE CD1 CE1 sing Y N 308 PHE CD1 HD1 sing N N 309 PHE CD2 CE2 doub Y N 310 PHE CD2 HD2 sing N N 311 PHE CE1 CZ doub Y N 312 PHE CE1 HE1 sing N N 313 PHE CE2 CZ sing Y N 314 PHE CE2 HE2 sing N N 315 PHE CZ HZ sing N N 316 PHE OXT HXT sing N N 317 PRO N CA sing N N 318 PRO N CD sing N N 319 PRO N H sing N N 320 PRO CA C sing N N 321 PRO CA CB sing N N 322 PRO CA HA sing N N 323 PRO C O doub N N 324 PRO C OXT sing N N 325 PRO CB CG sing N N 326 PRO CB HB2 sing N N 327 PRO CB HB3 sing N N 328 PRO CG CD sing N N 329 PRO CG HG2 sing N N 330 PRO CG HG3 sing N N 331 PRO CD HD2 sing N N 332 PRO CD HD3 sing N N 333 PRO OXT HXT sing N N 334 SER N CA sing N N 335 SER N H sing N N 336 SER N H2 sing N N 337 SER CA C sing N N 338 SER CA CB sing N N 339 SER CA HA sing N N 340 SER C O doub N N 341 SER C OXT sing N N 342 SER CB OG sing N N 343 SER CB HB2 sing N N 344 SER CB HB3 sing N N 345 SER OG HG sing N N 346 SER OXT HXT sing N N 347 THR N CA sing N N 348 THR N H sing N N 349 THR N H2 sing N N 350 THR CA C sing N N 351 THR CA CB sing N N 352 THR CA HA sing N N 353 THR C O doub N N 354 THR C OXT sing N N 355 THR CB OG1 sing N N 356 THR CB CG2 sing N N 357 THR CB HB sing N N 358 THR OG1 HG1 sing N N 359 THR CG2 HG21 sing N N 360 THR CG2 HG22 sing N N 361 THR CG2 HG23 sing N N 362 THR OXT HXT sing N N 363 TRP N CA sing N N 364 TRP N H sing N N 365 TRP N H2 sing N N 366 TRP CA C sing N N 367 TRP CA CB sing N N 368 TRP CA HA sing N N 369 TRP C O doub N N 370 TRP C OXT sing N N 371 TRP CB CG sing N N 372 TRP CB HB2 sing N N 373 TRP CB HB3 sing N N 374 TRP CG CD1 doub Y N 375 TRP CG CD2 sing Y N 376 TRP CD1 NE1 sing Y N 377 TRP CD1 HD1 sing N N 378 TRP CD2 CE2 doub Y N 379 TRP CD2 CE3 sing Y N 380 TRP NE1 CE2 sing Y N 381 TRP NE1 HE1 sing N N 382 TRP CE2 CZ2 sing Y N 383 TRP CE3 CZ3 doub Y N 384 TRP CE3 HE3 sing N N 385 TRP CZ2 CH2 doub Y N 386 TRP CZ2 HZ2 sing N N 387 TRP CZ3 CH2 sing Y N 388 TRP CZ3 HZ3 sing N N 389 TRP CH2 HH2 sing N N 390 TRP OXT HXT sing N N 391 TYR N CA sing N N 392 TYR N H sing N N 393 TYR N H2 sing N N 394 TYR CA C sing N N 395 TYR CA CB sing N N 396 TYR CA HA sing N N 397 TYR C O doub N N 398 TYR C OXT sing N N 399 TYR CB CG sing N N 400 TYR CB HB2 sing N N 401 TYR CB HB3 sing N N 402 TYR CG CD1 doub Y N 403 TYR CG CD2 sing Y N 404 TYR CD1 CE1 sing Y N 405 TYR CD1 HD1 sing N N 406 TYR CD2 CE2 doub Y N 407 TYR CD2 HD2 sing N N 408 TYR CE1 CZ doub Y N 409 TYR CE1 HE1 sing N N 410 TYR CE2 CZ sing Y N 411 TYR CE2 HE2 sing N N 412 TYR CZ OH sing N N 413 TYR OH HH sing N N 414 TYR OXT HXT sing N N 415 VAL N CA sing N N 416 VAL N H sing N N 417 VAL N H2 sing N N 418 VAL CA C sing N N 419 VAL CA CB sing N N 420 VAL CA HA sing N N 421 VAL C O doub N N 422 VAL C OXT sing N N 423 VAL CB CG1 sing N N 424 VAL CB CG2 sing N N 425 VAL CB HB sing N N 426 VAL CG1 HG11 sing N N 427 VAL CG1 HG12 sing N N 428 VAL CG1 HG13 sing N N 429 VAL CG2 HG21 sing N N 430 VAL CG2 HG22 sing N N 431 VAL CG2 HG23 sing N N 432 VAL OXT HXT sing N N 433 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NJ6 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NJ6 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8I0M _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009914 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009914 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016812 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_