data_8I3J # _entry.id 8I3J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8I3J pdb_00008i3j 10.2210/pdb8i3j/pdb WWPDB D_1300034699 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8I3J _pdbx_database_status.recvd_initial_deposition_date 2023-01-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ko, S.' 1 0000-0002-2263-0017 'Yu, J.' 2 0000-0003-2854-9225 'Toda, A.' 3 ? 'Tanaka, H.' 4 ? 'Kurisu, G.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Febs Lett.' _citation.journal_id_ASTM FEBLAL _citation.journal_id_CSD 0165 _citation.journal_id_ISSN 0014-5793 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 597 _citation.language ? _citation.page_first 2149 _citation.page_last 2160 _citation.title ;Crystal structure of the stalk region of axonemal inner-arm dynein-d reveals unique features in the coiled-coil and microtubule-binding domain. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/1873-3468.14690 _citation.pdbx_database_id_PubMed 37400274 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ko, S.' 1 ? primary 'Toda, A.' 2 ? primary 'Tanaka, H.' 3 ? primary 'Yu, J.' 4 ? primary 'Kurisu, G.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8I3J _cell.details ? _cell.formula_units_Z ? _cell.length_a 147.468 _cell.length_a_esd ? _cell.length_b 147.468 _cell.length_b_esd ? _cell.length_c 85.075 _cell.length_c_esd ? _cell.volume 1602242.215 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8I3J _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall 'P 61 2 (x,y,z+5/12)' _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Dynein axonemal heavy chain 1' _entity.formula_weight 31487.836 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Axonemal beta dynein heavy chain 1,Ciliary dynein heavy chain 1,Heat shock regulated protein 1,HSRF-1,hDHC7' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;EDVAK(MSE)QEDLES(MSE)HPLLEEAAKDT(MSE)LT(MSE)EQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIAD DAQKDLDEALPALDAALASLRNLNKNDVTEVRA(MSE)QRPPPGVKLVIEAVCI(MSE)KGIKPKKVPGEKPGTKVDDYW EPGKGLLQDPGHFLESLFKFDKDNIGDVVIKAIQPYIDNEEFQPATIAKVSKACTSICQWVRA(MSE)HKYHFVAKAVEP KRQALLEAQDDLGVTQRILDEAKQRLREVEDGIAT(MSE)QAKYRECITKKEELELKCEQCEQRLGRAG ; _entity_poly.pdbx_seq_one_letter_code_can ;EDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAA LASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDN IGDVVIKAIQPYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLRE VEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ASP n 1 3 VAL n 1 4 ALA n 1 5 LYS n 1 6 MSE n 1 7 GLN n 1 8 GLU n 1 9 ASP n 1 10 LEU n 1 11 GLU n 1 12 SER n 1 13 MSE n 1 14 HIS n 1 15 PRO n 1 16 LEU n 1 17 LEU n 1 18 GLU n 1 19 GLU n 1 20 ALA n 1 21 ALA n 1 22 LYS n 1 23 ASP n 1 24 THR n 1 25 MSE n 1 26 LEU n 1 27 THR n 1 28 MSE n 1 29 GLU n 1 30 GLN n 1 31 ILE n 1 32 LYS n 1 33 VAL n 1 34 ASP n 1 35 THR n 1 36 ALA n 1 37 ILE n 1 38 ALA n 1 39 GLU n 1 40 GLU n 1 41 THR n 1 42 ARG n 1 43 ASN n 1 44 SER n 1 45 VAL n 1 46 GLN n 1 47 THR n 1 48 GLU n 1 49 GLU n 1 50 ILE n 1 51 LYS n 1 52 ALA n 1 53 ASN n 1 54 GLU n 1 55 LYS n 1 56 ALA n 1 57 LYS n 1 58 LYS n 1 59 ALA n 1 60 GLN n 1 61 ALA n 1 62 ILE n 1 63 ALA n 1 64 ASP n 1 65 ASP n 1 66 ALA n 1 67 GLN n 1 68 LYS n 1 69 ASP n 1 70 LEU n 1 71 ASP n 1 72 GLU n 1 73 ALA n 1 74 LEU n 1 75 PRO n 1 76 ALA n 1 77 LEU n 1 78 ASP n 1 79 ALA n 1 80 ALA n 1 81 LEU n 1 82 ALA n 1 83 SER n 1 84 LEU n 1 85 ARG n 1 86 ASN n 1 87 LEU n 1 88 ASN n 1 89 LYS n 1 90 ASN n 1 91 ASP n 1 92 VAL n 1 93 THR n 1 94 GLU n 1 95 VAL n 1 96 ARG n 1 97 ALA n 1 98 MSE n 1 99 GLN n 1 100 ARG n 1 101 PRO n 1 102 PRO n 1 103 PRO n 1 104 GLY n 1 105 VAL n 1 106 LYS n 1 107 LEU n 1 108 VAL n 1 109 ILE n 1 110 GLU n 1 111 ALA n 1 112 VAL n 1 113 CYS n 1 114 ILE n 1 115 MSE n 1 116 LYS n 1 117 GLY n 1 118 ILE n 1 119 LYS n 1 120 PRO n 1 121 LYS n 1 122 LYS n 1 123 VAL n 1 124 PRO n 1 125 GLY n 1 126 GLU n 1 127 LYS n 1 128 PRO n 1 129 GLY n 1 130 THR n 1 131 LYS n 1 132 VAL n 1 133 ASP n 1 134 ASP n 1 135 TYR n 1 136 TRP n 1 137 GLU n 1 138 PRO n 1 139 GLY n 1 140 LYS n 1 141 GLY n 1 142 LEU n 1 143 LEU n 1 144 GLN n 1 145 ASP n 1 146 PRO n 1 147 GLY n 1 148 HIS n 1 149 PHE n 1 150 LEU n 1 151 GLU n 1 152 SER n 1 153 LEU n 1 154 PHE n 1 155 LYS n 1 156 PHE n 1 157 ASP n 1 158 LYS n 1 159 ASP n 1 160 ASN n 1 161 ILE n 1 162 GLY n 1 163 ASP n 1 164 VAL n 1 165 VAL n 1 166 ILE n 1 167 LYS n 1 168 ALA n 1 169 ILE n 1 170 GLN n 1 171 PRO n 1 172 TYR n 1 173 ILE n 1 174 ASP n 1 175 ASN n 1 176 GLU n 1 177 GLU n 1 178 PHE n 1 179 GLN n 1 180 PRO n 1 181 ALA n 1 182 THR n 1 183 ILE n 1 184 ALA n 1 185 LYS n 1 186 VAL n 1 187 SER n 1 188 LYS n 1 189 ALA n 1 190 CYS n 1 191 THR n 1 192 SER n 1 193 ILE n 1 194 CYS n 1 195 GLN n 1 196 TRP n 1 197 VAL n 1 198 ARG n 1 199 ALA n 1 200 MSE n 1 201 HIS n 1 202 LYS n 1 203 TYR n 1 204 HIS n 1 205 PHE n 1 206 VAL n 1 207 ALA n 1 208 LYS n 1 209 ALA n 1 210 VAL n 1 211 GLU n 1 212 PRO n 1 213 LYS n 1 214 ARG n 1 215 GLN n 1 216 ALA n 1 217 LEU n 1 218 LEU n 1 219 GLU n 1 220 ALA n 1 221 GLN n 1 222 ASP n 1 223 ASP n 1 224 LEU n 1 225 GLY n 1 226 VAL n 1 227 THR n 1 228 GLN n 1 229 ARG n 1 230 ILE n 1 231 LEU n 1 232 ASP n 1 233 GLU n 1 234 ALA n 1 235 LYS n 1 236 GLN n 1 237 ARG n 1 238 LEU n 1 239 ARG n 1 240 GLU n 1 241 VAL n 1 242 GLU n 1 243 ASP n 1 244 GLY n 1 245 ILE n 1 246 ALA n 1 247 THR n 1 248 MSE n 1 249 GLN n 1 250 ALA n 1 251 LYS n 1 252 TYR n 1 253 ARG n 1 254 GLU n 1 255 CYS n 1 256 ILE n 1 257 THR n 1 258 LYS n 1 259 LYS n 1 260 GLU n 1 261 GLU n 1 262 LEU n 1 263 GLU n 1 264 LEU n 1 265 LYS n 1 266 CYS n 1 267 GLU n 1 268 GLN n 1 269 CYS n 1 270 GLU n 1 271 GLN n 1 272 ARG n 1 273 LEU n 1 274 GLY n 1 275 ARG n 1 276 ALA n 1 277 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 277 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DNAH1, DHC7, DNAHC1, KIAA1410' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DYH1_HUMAN _struct_ref.pdbx_db_accession Q9P2D7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAA LASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDN IGDVVIKAIQPYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLRE VEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAG ; _struct_ref.pdbx_align_begin 2844 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8I3J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 277 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9P2D7 _struct_ref_seq.db_align_beg 2844 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 3120 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 280 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8I3J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.3 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 71.38 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Potassium sodium tartrate tetrahydrate, PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-08-05 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97938 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL44XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97938 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL44XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 83.35 _reflns.entry_id 8I3J _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.69 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 28811 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.66 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.83 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1248 _reflns.pdbx_Rpim_I_all 0.02019 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1231 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.69 _reflns_shell.d_res_low 2.85 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.12 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4588 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 19.4 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.062 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.975 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.3 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 121.64 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8I3J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.69 _refine.ls_d_res_low 42.57 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 28437 _refine.ls_number_reflns_R_free 1450 _refine.ls_number_reflns_R_work 26987 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.41 _refine.ls_percent_reflns_R_free 5.10 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2582 _refine.ls_R_factor_R_free 0.2679 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2577 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 40.8169 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4326 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.69 _refine_hist.d_res_low 42.57 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2172 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2172 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0103 ? 2201 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.4219 ? 2963 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0712 ? 334 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0121 ? 391 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 21.3423 ? 870 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.69 2.78 . . 111 2663 94.74 . . . . 0.4628 . . . . . . . . . . . 0.4576 'X-RAY DIFFRACTION' 2.78 2.89 . . 153 2672 97.78 . . . . 0.4213 . . . . . . . . . . . 0.3995 'X-RAY DIFFRACTION' 2.89 3.03 . . 153 2626 97.58 . . . . 0.3772 . . . . . . . . . . . 0.4284 'X-RAY DIFFRACTION' 3.03 3.18 . . 166 2646 98.12 . . . . 0.3756 . . . . . . . . . . . 0.3922 'X-RAY DIFFRACTION' 3.18 3.38 . . 154 2736 99.18 . . . . 0.3592 . . . . . . . . . . . 0.3638 'X-RAY DIFFRACTION' 3.38 3.65 . . 123 2729 98.51 . . . . 0.3149 . . . . . . . . . . . 0.3872 'X-RAY DIFFRACTION' 3.65 4.01 . . 148 2696 98.99 . . . . 0.2811 . . . . . . . . . . . 0.2967 'X-RAY DIFFRACTION' 4.01 4.59 . . 155 2728 99.62 . . . . 0.2350 . . . . . . . . . . . 0.2644 'X-RAY DIFFRACTION' 4.59 5.78 . . 158 2727 99.90 . . . . 0.2334 . . . . . . . . . . . 0.3195 'X-RAY DIFFRACTION' 5.78 42.57 . . 129 2764 99.76 . . . . 0.1926 . . . . . . . . . . . 0.1360 # _struct.entry_id 8I3J _struct.title 'Crystal structure of human inner-arm dynein heavy chain d stalk and microtubule binding domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8I3J _struct_keywords.text 'CONTRACTILE PROTEIN, MOTOR PROTEIN' _struct_keywords.pdbx_keywords 'MOTOR PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 1 ? ASP A 71 ? GLU A 4 ASP A 74 1 ? 71 HELX_P HELX_P2 AA2 ALA A 73 ? ASN A 86 ? ALA A 76 ASN A 89 1 ? 14 HELX_P HELX_P3 AA3 ASN A 88 ? MSE A 98 ? ASN A 91 MSE A 101 1 ? 11 HELX_P HELX_P4 AA4 PRO A 102 ? LYS A 116 ? PRO A 105 LYS A 119 1 ? 15 HELX_P HELX_P5 AA5 TYR A 135 ? LEU A 143 ? TYR A 138 LEU A 146 1 ? 9 HELX_P HELX_P6 AA6 ASP A 145 ? LYS A 155 ? ASP A 148 LYS A 158 1 ? 11 HELX_P HELX_P7 AA7 GLY A 162 ? ILE A 169 ? GLY A 165 ILE A 172 1 ? 8 HELX_P HELX_P8 AA8 ILE A 169 ? ASP A 174 ? ILE A 172 ASP A 177 1 ? 6 HELX_P HELX_P9 AA9 GLN A 179 ? SER A 187 ? GLN A 182 SER A 190 1 ? 9 HELX_P HELX_P10 AB1 LYS A 188 ? VAL A 210 ? LYS A 191 VAL A 213 1 ? 23 HELX_P HELX_P11 AB2 VAL A 210 ? ARG A 272 ? VAL A 213 ARG A 275 1 ? 63 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LYS 5 C ? ? ? 1_555 A MSE 6 N ? ? A LYS 8 A MSE 9 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale2 covale both ? A MSE 6 C ? ? ? 1_555 A GLN 7 N ? ? A MSE 9 A GLN 10 1_555 ? ? ? ? ? ? ? 1.319 ? ? covale3 covale both ? A SER 12 C ? ? ? 1_555 A MSE 13 N ? ? A SER 15 A MSE 16 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A MSE 13 C ? ? ? 1_555 A HIS 14 N ? ? A MSE 16 A HIS 17 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale5 covale both ? A THR 24 C ? ? ? 1_555 A MSE 25 N ? ? A THR 27 A MSE 28 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A MSE 25 C ? ? ? 1_555 A LEU 26 N ? ? A MSE 28 A LEU 29 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale7 covale both ? A THR 27 C ? ? ? 1_555 A MSE 28 N ? ? A THR 30 A MSE 31 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale8 covale both ? A MSE 28 C ? ? ? 1_555 A GLU 29 N ? ? A MSE 31 A GLU 32 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale9 covale both ? A ALA 97 C ? ? ? 1_555 A MSE 98 N ? ? A ALA 100 A MSE 101 1_555 ? ? ? ? ? ? ? 1.318 ? ? covale10 covale both ? A MSE 98 C ? ? ? 1_555 A GLN 99 N ? ? A MSE 101 A GLN 102 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale11 covale both ? A ILE 114 C ? ? ? 1_555 A MSE 115 N ? ? A ILE 117 A MSE 118 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale12 covale both ? A MSE 115 C ? ? ? 1_555 A LYS 116 N ? ? A MSE 118 A LYS 119 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale13 covale both ? A ALA 199 C ? ? ? 1_555 A MSE 200 N ? ? A ALA 202 A MSE 203 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale14 covale both ? A MSE 200 C ? ? ? 1_555 A HIS 201 N ? ? A MSE 203 A HIS 204 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale15 covale both ? A THR 247 C ? ? ? 1_555 A MSE 248 N ? ? A THR 250 A MSE 251 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale16 covale both ? A MSE 248 C ? ? ? 1_555 A GLN 249 N ? ? A MSE 251 A GLN 252 1_555 ? ? ? ? ? ? ? 1.331 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 122 ? VAL A 123 ? LYS A 125 VAL A 126 AA1 2 VAL A 132 ? ASP A 133 ? VAL A 135 ASP A 136 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 123 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 126 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 132 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 135 # _atom_sites.entry_id 8I3J _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006781 _atom_sites.fract_transf_matrix[1][2] 0.003915 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007830 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011754 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SE ? ? 26.02326 7.89457 ? ? 1.54240 29.12501 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 4 4 GLU GLU A . n A 1 2 ASP 2 5 5 ASP ASP A . n A 1 3 VAL 3 6 6 VAL VAL A . n A 1 4 ALA 4 7 7 ALA ALA A . n A 1 5 LYS 5 8 8 LYS LYS A . n A 1 6 MSE 6 9 9 MSE MSE A . n A 1 7 GLN 7 10 10 GLN GLN A . n A 1 8 GLU 8 11 11 GLU GLU A . n A 1 9 ASP 9 12 12 ASP ASP A . n A 1 10 LEU 10 13 13 LEU LEU A . n A 1 11 GLU 11 14 14 GLU GLU A . n A 1 12 SER 12 15 15 SER SER A . n A 1 13 MSE 13 16 16 MSE MSE A . n A 1 14 HIS 14 17 17 HIS HIS A . n A 1 15 PRO 15 18 18 PRO PRO A . n A 1 16 LEU 16 19 19 LEU LEU A . n A 1 17 LEU 17 20 20 LEU LEU A . n A 1 18 GLU 18 21 21 GLU GLU A . n A 1 19 GLU 19 22 22 GLU GLU A . n A 1 20 ALA 20 23 23 ALA ALA A . n A 1 21 ALA 21 24 24 ALA ALA A . n A 1 22 LYS 22 25 25 LYS LYS A . n A 1 23 ASP 23 26 26 ASP ASP A . n A 1 24 THR 24 27 27 THR THR A . n A 1 25 MSE 25 28 28 MSE MSE A . n A 1 26 LEU 26 29 29 LEU LEU A . n A 1 27 THR 27 30 30 THR THR A . n A 1 28 MSE 28 31 31 MSE MSE A . n A 1 29 GLU 29 32 32 GLU GLU A . n A 1 30 GLN 30 33 33 GLN GLN A . n A 1 31 ILE 31 34 34 ILE ILE A . n A 1 32 LYS 32 35 35 LYS LYS A . n A 1 33 VAL 33 36 36 VAL VAL A . n A 1 34 ASP 34 37 37 ASP ASP A . n A 1 35 THR 35 38 38 THR THR A . n A 1 36 ALA 36 39 39 ALA ALA A . n A 1 37 ILE 37 40 40 ILE ILE A . n A 1 38 ALA 38 41 41 ALA ALA A . n A 1 39 GLU 39 42 42 GLU GLU A . n A 1 40 GLU 40 43 43 GLU GLU A . n A 1 41 THR 41 44 44 THR THR A . n A 1 42 ARG 42 45 45 ARG ARG A . n A 1 43 ASN 43 46 46 ASN ASN A . n A 1 44 SER 44 47 47 SER SER A . n A 1 45 VAL 45 48 48 VAL VAL A . n A 1 46 GLN 46 49 49 GLN GLN A . n A 1 47 THR 47 50 50 THR THR A . n A 1 48 GLU 48 51 51 GLU GLU A . n A 1 49 GLU 49 52 52 GLU GLU A . n A 1 50 ILE 50 53 53 ILE ILE A . n A 1 51 LYS 51 54 54 LYS LYS A . n A 1 52 ALA 52 55 55 ALA ALA A . n A 1 53 ASN 53 56 56 ASN ASN A . n A 1 54 GLU 54 57 57 GLU GLU A . n A 1 55 LYS 55 58 58 LYS LYS A . n A 1 56 ALA 56 59 59 ALA ALA A . n A 1 57 LYS 57 60 60 LYS LYS A . n A 1 58 LYS 58 61 61 LYS LYS A . n A 1 59 ALA 59 62 62 ALA ALA A . n A 1 60 GLN 60 63 63 GLN GLN A . n A 1 61 ALA 61 64 64 ALA ALA A . n A 1 62 ILE 62 65 65 ILE ILE A . n A 1 63 ALA 63 66 66 ALA ALA A . n A 1 64 ASP 64 67 67 ASP ASP A . n A 1 65 ASP 65 68 68 ASP ASP A . n A 1 66 ALA 66 69 69 ALA ALA A . n A 1 67 GLN 67 70 70 GLN GLN A . n A 1 68 LYS 68 71 71 LYS LYS A . n A 1 69 ASP 69 72 72 ASP ASP A . n A 1 70 LEU 70 73 73 LEU LEU A . n A 1 71 ASP 71 74 74 ASP ASP A . n A 1 72 GLU 72 75 75 GLU GLU A . n A 1 73 ALA 73 76 76 ALA ALA A . n A 1 74 LEU 74 77 77 LEU LEU A . n A 1 75 PRO 75 78 78 PRO PRO A . n A 1 76 ALA 76 79 79 ALA ALA A . n A 1 77 LEU 77 80 80 LEU LEU A . n A 1 78 ASP 78 81 81 ASP ASP A . n A 1 79 ALA 79 82 82 ALA ALA A . n A 1 80 ALA 80 83 83 ALA ALA A . n A 1 81 LEU 81 84 84 LEU LEU A . n A 1 82 ALA 82 85 85 ALA ALA A . n A 1 83 SER 83 86 86 SER SER A . n A 1 84 LEU 84 87 87 LEU LEU A . n A 1 85 ARG 85 88 88 ARG ARG A . n A 1 86 ASN 86 89 89 ASN ASN A . n A 1 87 LEU 87 90 90 LEU LEU A . n A 1 88 ASN 88 91 91 ASN ASN A . n A 1 89 LYS 89 92 92 LYS LYS A . n A 1 90 ASN 90 93 93 ASN ASN A . n A 1 91 ASP 91 94 94 ASP ASP A . n A 1 92 VAL 92 95 95 VAL VAL A . n A 1 93 THR 93 96 96 THR THR A . n A 1 94 GLU 94 97 97 GLU GLU A . n A 1 95 VAL 95 98 98 VAL VAL A . n A 1 96 ARG 96 99 99 ARG ARG A . n A 1 97 ALA 97 100 100 ALA ALA A . n A 1 98 MSE 98 101 101 MSE MSE A . n A 1 99 GLN 99 102 102 GLN GLN A . n A 1 100 ARG 100 103 103 ARG ARG A . n A 1 101 PRO 101 104 104 PRO PRO A . n A 1 102 PRO 102 105 105 PRO PRO A . n A 1 103 PRO 103 106 106 PRO PRO A . n A 1 104 GLY 104 107 107 GLY GLY A . n A 1 105 VAL 105 108 108 VAL VAL A . n A 1 106 LYS 106 109 109 LYS LYS A . n A 1 107 LEU 107 110 110 LEU LEU A . n A 1 108 VAL 108 111 111 VAL VAL A . n A 1 109 ILE 109 112 112 ILE ILE A . n A 1 110 GLU 110 113 113 GLU GLU A . n A 1 111 ALA 111 114 114 ALA ALA A . n A 1 112 VAL 112 115 115 VAL VAL A . n A 1 113 CYS 113 116 116 CYS CYS A . n A 1 114 ILE 114 117 117 ILE ILE A . n A 1 115 MSE 115 118 118 MSE MSE A . n A 1 116 LYS 116 119 119 LYS LYS A . n A 1 117 GLY 117 120 120 GLY GLY A . n A 1 118 ILE 118 121 121 ILE ILE A . n A 1 119 LYS 119 122 122 LYS LYS A . n A 1 120 PRO 120 123 123 PRO PRO A . n A 1 121 LYS 121 124 124 LYS LYS A . n A 1 122 LYS 122 125 125 LYS LYS A . n A 1 123 VAL 123 126 126 VAL VAL A . n A 1 124 PRO 124 127 127 PRO PRO A . n A 1 125 GLY 125 128 128 GLY GLY A . n A 1 126 GLU 126 129 129 GLU GLU A . n A 1 127 LYS 127 130 130 LYS LYS A . n A 1 128 PRO 128 131 131 PRO PRO A . n A 1 129 GLY 129 132 132 GLY GLY A . n A 1 130 THR 130 133 133 THR THR A . n A 1 131 LYS 131 134 134 LYS LYS A . n A 1 132 VAL 132 135 135 VAL VAL A . n A 1 133 ASP 133 136 136 ASP ASP A . n A 1 134 ASP 134 137 137 ASP ASP A . n A 1 135 TYR 135 138 138 TYR TYR A . n A 1 136 TRP 136 139 139 TRP TRP A . n A 1 137 GLU 137 140 140 GLU GLU A . n A 1 138 PRO 138 141 141 PRO PRO A . n A 1 139 GLY 139 142 142 GLY GLY A . n A 1 140 LYS 140 143 143 LYS LYS A . n A 1 141 GLY 141 144 144 GLY GLY A . n A 1 142 LEU 142 145 145 LEU LEU A . n A 1 143 LEU 143 146 146 LEU LEU A . n A 1 144 GLN 144 147 147 GLN GLN A . n A 1 145 ASP 145 148 148 ASP ASP A . n A 1 146 PRO 146 149 149 PRO PRO A . n A 1 147 GLY 147 150 150 GLY GLY A . n A 1 148 HIS 148 151 151 HIS HIS A . n A 1 149 PHE 149 152 152 PHE PHE A . n A 1 150 LEU 150 153 153 LEU LEU A . n A 1 151 GLU 151 154 154 GLU GLU A . n A 1 152 SER 152 155 155 SER SER A . n A 1 153 LEU 153 156 156 LEU LEU A . n A 1 154 PHE 154 157 157 PHE PHE A . n A 1 155 LYS 155 158 158 LYS LYS A . n A 1 156 PHE 156 159 159 PHE PHE A . n A 1 157 ASP 157 160 160 ASP ASP A . n A 1 158 LYS 158 161 161 LYS LYS A . n A 1 159 ASP 159 162 162 ASP ASP A . n A 1 160 ASN 160 163 163 ASN ASN A . n A 1 161 ILE 161 164 164 ILE ILE A . n A 1 162 GLY 162 165 165 GLY GLY A . n A 1 163 ASP 163 166 166 ASP ASP A . n A 1 164 VAL 164 167 167 VAL VAL A . n A 1 165 VAL 165 168 168 VAL VAL A . n A 1 166 ILE 166 169 169 ILE ILE A . n A 1 167 LYS 167 170 170 LYS LYS A . n A 1 168 ALA 168 171 171 ALA ALA A . n A 1 169 ILE 169 172 172 ILE ILE A . n A 1 170 GLN 170 173 173 GLN GLN A . n A 1 171 PRO 171 174 174 PRO PRO A . n A 1 172 TYR 172 175 175 TYR TYR A . n A 1 173 ILE 173 176 176 ILE ILE A . n A 1 174 ASP 174 177 177 ASP ASP A . n A 1 175 ASN 175 178 178 ASN ASN A . n A 1 176 GLU 176 179 179 GLU GLU A . n A 1 177 GLU 177 180 180 GLU GLU A . n A 1 178 PHE 178 181 181 PHE PHE A . n A 1 179 GLN 179 182 182 GLN GLN A . n A 1 180 PRO 180 183 183 PRO PRO A . n A 1 181 ALA 181 184 184 ALA ALA A . n A 1 182 THR 182 185 185 THR THR A . n A 1 183 ILE 183 186 186 ILE ILE A . n A 1 184 ALA 184 187 187 ALA ALA A . n A 1 185 LYS 185 188 188 LYS LYS A . n A 1 186 VAL 186 189 189 VAL VAL A . n A 1 187 SER 187 190 190 SER SER A . n A 1 188 LYS 188 191 191 LYS LYS A . n A 1 189 ALA 189 192 192 ALA ALA A . n A 1 190 CYS 190 193 193 CYS CYS A . n A 1 191 THR 191 194 194 THR THR A . n A 1 192 SER 192 195 195 SER SER A . n A 1 193 ILE 193 196 196 ILE ILE A . n A 1 194 CYS 194 197 197 CYS CYS A . n A 1 195 GLN 195 198 198 GLN GLN A . n A 1 196 TRP 196 199 199 TRP TRP A . n A 1 197 VAL 197 200 200 VAL VAL A . n A 1 198 ARG 198 201 201 ARG ARG A . n A 1 199 ALA 199 202 202 ALA ALA A . n A 1 200 MSE 200 203 203 MSE MSE A . n A 1 201 HIS 201 204 204 HIS HIS A . n A 1 202 LYS 202 205 205 LYS LYS A . n A 1 203 TYR 203 206 206 TYR TYR A . n A 1 204 HIS 204 207 207 HIS HIS A . n A 1 205 PHE 205 208 208 PHE PHE A . n A 1 206 VAL 206 209 209 VAL VAL A . n A 1 207 ALA 207 210 210 ALA ALA A . n A 1 208 LYS 208 211 211 LYS LYS A . n A 1 209 ALA 209 212 212 ALA ALA A . n A 1 210 VAL 210 213 213 VAL VAL A . n A 1 211 GLU 211 214 214 GLU GLU A . n A 1 212 PRO 212 215 215 PRO PRO A . n A 1 213 LYS 213 216 216 LYS LYS A . n A 1 214 ARG 214 217 217 ARG ARG A . n A 1 215 GLN 215 218 218 GLN GLN A . n A 1 216 ALA 216 219 219 ALA ALA A . n A 1 217 LEU 217 220 220 LEU LEU A . n A 1 218 LEU 218 221 221 LEU LEU A . n A 1 219 GLU 219 222 222 GLU GLU A . n A 1 220 ALA 220 223 223 ALA ALA A . n A 1 221 GLN 221 224 224 GLN GLN A . n A 1 222 ASP 222 225 225 ASP ASP A . n A 1 223 ASP 223 226 226 ASP ASP A . n A 1 224 LEU 224 227 227 LEU LEU A . n A 1 225 GLY 225 228 228 GLY GLY A . n A 1 226 VAL 226 229 229 VAL VAL A . n A 1 227 THR 227 230 230 THR THR A . n A 1 228 GLN 228 231 231 GLN GLN A . n A 1 229 ARG 229 232 232 ARG ARG A . n A 1 230 ILE 230 233 233 ILE ILE A . n A 1 231 LEU 231 234 234 LEU LEU A . n A 1 232 ASP 232 235 235 ASP ASP A . n A 1 233 GLU 233 236 236 GLU GLU A . n A 1 234 ALA 234 237 237 ALA ALA A . n A 1 235 LYS 235 238 238 LYS LYS A . n A 1 236 GLN 236 239 239 GLN GLN A . n A 1 237 ARG 237 240 240 ARG ARG A . n A 1 238 LEU 238 241 241 LEU LEU A . n A 1 239 ARG 239 242 242 ARG ARG A . n A 1 240 GLU 240 243 243 GLU GLU A . n A 1 241 VAL 241 244 244 VAL VAL A . n A 1 242 GLU 242 245 245 GLU GLU A . n A 1 243 ASP 243 246 246 ASP ASP A . n A 1 244 GLY 244 247 247 GLY GLY A . n A 1 245 ILE 245 248 248 ILE ILE A . n A 1 246 ALA 246 249 249 ALA ALA A . n A 1 247 THR 247 250 250 THR THR A . n A 1 248 MSE 248 251 251 MSE MSE A . n A 1 249 GLN 249 252 252 GLN GLN A . n A 1 250 ALA 250 253 253 ALA ALA A . n A 1 251 LYS 251 254 254 LYS LYS A . n A 1 252 TYR 252 255 255 TYR TYR A . n A 1 253 ARG 253 256 256 ARG ARG A . n A 1 254 GLU 254 257 257 GLU GLU A . n A 1 255 CYS 255 258 258 CYS CYS A . n A 1 256 ILE 256 259 259 ILE ILE A . n A 1 257 THR 257 260 260 THR THR A . n A 1 258 LYS 258 261 261 LYS LYS A . n A 1 259 LYS 259 262 262 LYS LYS A . n A 1 260 GLU 260 263 263 GLU GLU A . n A 1 261 GLU 261 264 264 GLU GLU A . n A 1 262 LEU 262 265 265 LEU LEU A . n A 1 263 GLU 263 266 266 GLU GLU A . n A 1 264 LEU 264 267 267 LEU LEU A . n A 1 265 LYS 265 268 268 LYS LYS A . n A 1 266 CYS 266 269 269 CYS CYS A . n A 1 267 GLU 267 270 270 GLU GLU A . n A 1 268 GLN 268 271 271 GLN GLN A . n A 1 269 CYS 269 272 272 CYS CYS A . n A 1 270 GLU 270 273 273 GLU GLU A . n A 1 271 GLN 271 274 274 GLN GLN A . n A 1 272 ARG 272 275 275 ARG ARG A . n A 1 273 LEU 273 276 276 LEU LEU A . n A 1 274 GLY 274 277 277 GLY GLY A . n A 1 275 ARG 275 278 278 ARG ARG A . n A 1 276 ALA 276 279 279 ALA ALA A . n A 1 277 GLY 277 280 280 GLY GLY A . n # _pdbx_contact_author.id 5 _pdbx_contact_author.email gkurisu@protein.osaka-u.ac.jp _pdbx_contact_author.name_first Genji _pdbx_contact_author.name_last Kurisu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5354-0807 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 6 A MSE 9 ? MET 'modified residue' 2 A MSE 13 A MSE 16 ? MET 'modified residue' 3 A MSE 25 A MSE 28 ? MET 'modified residue' 4 A MSE 28 A MSE 31 ? MET 'modified residue' 5 A MSE 98 A MSE 101 ? MET 'modified residue' 6 A MSE 115 A MSE 118 ? MET 'modified residue' 7 A MSE 200 A MSE 203 ? MET 'modified residue' 8 A MSE 248 A MSE 251 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-08-09 2 'Structure model' 1 1 2023-09-20 3 'Structure model' 1 2 2023-09-27 4 'Structure model' 1 3 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' citation 5 3 'Structure model' citation_author 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_initial_refinement_model.type' 2 3 'Structure model' '_citation.journal_volume' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' 5 3 'Structure model' '_citation_author.identifier_ORCID' 6 4 'Structure model' '_chem_comp_atom.atom_id' 7 4 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/6 3 y,-x+y,z+5/6 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 x-y,-y,-z 7 -x,-x+y,-z+2/3 8 -x,-y,z+1/2 9 y,x,-z+1/3 10 -y,-x,-z+5/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+1/6 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 43.3415987532 _pdbx_refine_tls.origin_y 34.9466311044 _pdbx_refine_tls.origin_z 84.5638404472 _pdbx_refine_tls.T[1][1] 1.29501662217 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.172091310828 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0396673271483 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.955822881575 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0218315931764 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 1.06649208363 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.06830148529 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.928251446196 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -1.25776412633 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.25679665457 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 2.1008395432 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.41999758956 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.325644872542 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.313612666843 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0191353214538 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.249484894968 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.317902855817 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.00633504951394 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.3898033474 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.535423903393 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0161114784581 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 4 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 277 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 280 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXCD ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2-4158 5 # _pdbx_entry_details.entry_id 8I3J _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 123 ? ? -66.84 -171.93 2 1 THR A 133 ? ? 19.34 70.87 3 1 LYS A 161 ? ? 55.55 -103.92 4 1 ASP A 162 ? ? 8.59 -64.90 5 1 ASN A 163 ? ? -67.87 65.96 6 1 PHE A 181 ? ? -81.74 37.07 7 1 ILE A 186 ? ? -47.85 -18.86 8 1 ALA A 279 ? ? -75.99 20.83 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MSE N N N N 227 MSE CA C N S 228 MSE C C N N 229 MSE O O N N 230 MSE OXT O N N 231 MSE CB C N N 232 MSE CG C N N 233 MSE SE SE N N 234 MSE CE C N N 235 MSE H H N N 236 MSE H2 H N N 237 MSE HA H N N 238 MSE HXT H N N 239 MSE HB2 H N N 240 MSE HB3 H N N 241 MSE HG2 H N N 242 MSE HG3 H N N 243 MSE HE1 H N N 244 MSE HE2 H N N 245 MSE HE3 H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MSE N CA sing N N 216 MSE N H sing N N 217 MSE N H2 sing N N 218 MSE CA C sing N N 219 MSE CA CB sing N N 220 MSE CA HA sing N N 221 MSE C O doub N N 222 MSE C OXT sing N N 223 MSE OXT HXT sing N N 224 MSE CB CG sing N N 225 MSE CB HB2 sing N N 226 MSE CB HB3 sing N N 227 MSE CG SE sing N N 228 MSE CG HG2 sing N N 229 MSE CG HG3 sing N N 230 MSE SE CE sing N N 231 MSE CE HE1 sing N N 232 MSE CE HE2 sing N N 233 MSE CE HE3 sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 18H02390 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MSE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MSE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 61 2 2' _space_group.name_Hall 'P 61 2 (x,y,z+5/12)' _space_group.IT_number 178 _space_group.crystal_system hexagonal _space_group.id 1 #