data_8IMH # _entry.id 8IMH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8IMH pdb_00008imh 10.2210/pdb8imh/pdb WWPDB D_1300035928 ? ? BMRB 51855 ? 10.13018/BMR51855 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-11-29 2 'Structure model' 1 1 2024-05-15 3 'Structure model' 1 2 2024-12-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 3 'Structure model' pdbx_entry_details # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_citation.journal_volume' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' 5 3 'Structure model' '_citation.year' 6 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8IMH _pdbx_database_status.recvd_initial_deposition_date 2023-03-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 51855 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email sidd@iisc.ac.in _pdbx_contact_author.name_first Siddhartha _pdbx_contact_author.name_last Sarma _pdbx_contact_author.name_mi P. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7619-8904 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Basu Roy, T.' 1 0000-0002-1656-3209 'Sarma, S.P.' 2 0000-0001-7619-8904 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 93 _citation.language ? _citation.page_first 176 _citation.page_last 196 _citation.title 'Insights into the solution structure and transcriptional regulation of the MazE9 antitoxin in Mycobacterium tuberculosis.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.26589 _citation.pdbx_database_id_PubMed 37737533 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Roy, T.B.' 1 ? primary 'Sarma, S.P.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Antitoxin MazE9' _entity.formula_weight 4624.309 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SGSMKLSVSLSDDDVAILDAYVKRAGLPSRSAGLQHAIRVLRY _entity_poly.pdbx_seq_one_letter_code_can SGSMKLSVSLSDDDVAILDAYVKRAGLPSRSAGLQHAIRVLRY _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 SER n 1 4 MET n 1 5 LYS n 1 6 LEU n 1 7 SER n 1 8 VAL n 1 9 SER n 1 10 LEU n 1 11 SER n 1 12 ASP n 1 13 ASP n 1 14 ASP n 1 15 VAL n 1 16 ALA n 1 17 ILE n 1 18 LEU n 1 19 ASP n 1 20 ALA n 1 21 TYR n 1 22 VAL n 1 23 LYS n 1 24 ARG n 1 25 ALA n 1 26 GLY n 1 27 LEU n 1 28 PRO n 1 29 SER n 1 30 ARG n 1 31 SER n 1 32 ALA n 1 33 GLY n 1 34 LEU n 1 35 GLN n 1 36 HIS n 1 37 ALA n 1 38 ILE n 1 39 ARG n 1 40 VAL n 1 41 LEU n 1 42 ARG n 1 43 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 43 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'mazE9, mazE-mt1, Rv2801A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis H37Rv' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 25618 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 TYR 43 43 43 TYR TYR A . n B 1 1 SER 1 1 1 SER SER B . n B 1 2 GLY 2 2 2 GLY GLY B . n B 1 3 SER 3 3 3 SER SER B . n B 1 4 MET 4 4 4 MET MET B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 SER 7 7 7 SER SER B . n B 1 8 VAL 8 8 8 VAL VAL B . n B 1 9 SER 9 9 9 SER SER B . n B 1 10 LEU 10 10 10 LEU LEU B . n B 1 11 SER 11 11 11 SER SER B . n B 1 12 ASP 12 12 12 ASP ASP B . n B 1 13 ASP 13 13 13 ASP ASP B . n B 1 14 ASP 14 14 14 ASP ASP B . n B 1 15 VAL 15 15 15 VAL VAL B . n B 1 16 ALA 16 16 16 ALA ALA B . n B 1 17 ILE 17 17 17 ILE ILE B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 ASP 19 19 19 ASP ASP B . n B 1 20 ALA 20 20 20 ALA ALA B . n B 1 21 TYR 21 21 21 TYR TYR B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 LYS 23 23 23 LYS LYS B . n B 1 24 ARG 24 24 24 ARG ARG B . n B 1 25 ALA 25 25 25 ALA ALA B . n B 1 26 GLY 26 26 26 GLY GLY B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 PRO 28 28 28 PRO PRO B . n B 1 29 SER 29 29 29 SER SER B . n B 1 30 ARG 30 30 30 ARG ARG B . n B 1 31 SER 31 31 31 SER SER B . n B 1 32 ALA 32 32 32 ALA ALA B . n B 1 33 GLY 33 33 33 GLY GLY B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 GLN 35 35 35 GLN GLN B . n B 1 36 HIS 36 36 36 HIS HIS B . n B 1 37 ALA 37 37 37 ALA ALA B . n B 1 38 ILE 38 38 38 ILE ILE B . n B 1 39 ARG 39 39 39 ARG ARG B . n B 1 40 VAL 40 40 40 VAL VAL B . n B 1 41 LEU 41 41 41 LEU LEU B . n B 1 42 ARG 42 42 42 ARG ARG B . n B 1 43 TYR 43 43 43 TYR TYR B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8IMH _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8IMH _struct.title 'Solution structure of the N terminal domain of MazE9 antitoxin (nMazE9) from Mycobacterium tuberculosis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8IMH _struct_keywords.text ;Ribbon-helix-helix, RHH motif, DNA binding domain, transcription factor, toxin-antitoxin system, Mycobacterium tuberculosis MazEF9 system, mazE-mt1, ANTITOXIN ; _struct_keywords.pdbx_keywords ANTITOXIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MAZE9_MYCTU _struct_ref.pdbx_db_accession P0CL61 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MKLSVSLSDDDVAILDAYVKRAGLPSRSAGLQHAIRVLRY _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8IMH A 4 ? 43 ? P0CL61 1 ? 40 ? 4 43 2 1 8IMH B 4 ? 43 ? P0CL61 1 ? 40 ? 4 43 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8IMH SER A 1 ? UNP P0CL61 ? ? 'expression tag' 1 1 1 8IMH GLY A 2 ? UNP P0CL61 ? ? 'expression tag' 2 2 1 8IMH SER A 3 ? UNP P0CL61 ? ? 'expression tag' 3 3 2 8IMH SER B 1 ? UNP P0CL61 ? ? 'expression tag' 1 4 2 8IMH GLY B 2 ? UNP P0CL61 ? ? 'expression tag' 2 5 2 8IMH SER B 3 ? UNP P0CL61 ? ? 'expression tag' 3 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2910 ? 1 MORE -24 ? 1 'SSA (A^2)' 4910 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'NMR Distance Restraints' ? 2 1 'NMR relaxation study' ? 3 1 'gel filtration' ? 4 1 'light scattering' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 11 ? GLY A 26 ? SER A 11 GLY A 26 1 ? 16 HELX_P HELX_P2 AA2 SER A 29 ? TYR A 43 ? SER A 29 TYR A 43 1 ? 15 HELX_P HELX_P3 AA3 SER B 11 ? ALA B 25 ? SER B 11 ALA B 25 1 ? 15 HELX_P HELX_P4 AA4 SER B 29 ? TYR B 43 ? SER B 29 TYR B 43 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 4 ? LEU A 10 ? MET A 4 LEU A 10 AA1 2 MET B 4 ? LEU B 10 ? MET B 4 LEU B 10 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 10 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 10 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id MET _pdbx_struct_sheet_hbond.range_2_label_asym_id B _pdbx_struct_sheet_hbond.range_2_label_seq_id 4 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id MET _pdbx_struct_sheet_hbond.range_2_auth_asym_id B _pdbx_struct_sheet_hbond.range_2_auth_seq_id 4 # _pdbx_entry_details.entry_id 8IMH _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER B 3 ? ? -120.28 -167.70 2 2 SER B 3 ? ? -109.46 -65.18 3 5 ARG B 42 ? ? -94.95 -63.35 4 6 ARG A 42 ? ? -92.64 -74.73 5 7 SER A 3 ? ? -114.30 -164.10 6 7 SER B 3 ? ? -148.27 -100.70 7 7 SER B 29 ? ? -173.11 -179.89 8 8 SER A 3 ? ? -149.89 -82.46 9 8 ARG B 42 ? ? -94.75 -68.75 10 9 SER B 3 ? ? -60.61 -71.31 11 10 SER A 3 ? ? -159.82 -48.41 12 10 ARG A 42 ? ? -91.15 34.72 13 12 SER B 3 ? ? -111.73 -71.68 14 13 SER A 3 ? ? -149.10 -53.92 15 13 SER B 3 ? ? -137.05 -55.52 16 14 SER A 3 ? ? -101.31 -165.36 17 14 SER B 3 ? ? -89.04 -73.50 18 15 ARG B 42 ? ? -105.35 -62.53 19 16 SER B 3 ? ? -110.95 -165.71 20 17 SER B 3 ? ? -119.63 -165.21 21 17 ARG B 42 ? ? -95.39 -68.55 22 20 ARG A 42 ? ? -98.69 -62.27 # _pdbx_nmr_ensemble.entry_id 8IMH _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8IMH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '450 uM nMazE9, 20 mM potassium phosphate, 20 mM sodium chloride, 0.01 % w/v sodium azide, 10 % D2O, 90% H2O/10% D2O' '90% H2O/10% D2O' unlabeled_nMazE9 solution ? 2 ;430 uM [U-100% 13C; U-100% 15N] nMazE9, 20 mM potassium phosphate, 20 mM sodium chloride, 0.01 % sodium azide, 10 % D2O, 90% H2O/10% D2O ; '90% H2O/10% D2O' DL-nMazE9 solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 nMazE9 450 ? uM 'natural abundance' 1 'potassium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 20 ? mM 'natural abundance' 1 'sodium azide' 0.01 ? '% w/v' 'natural abundance' 1 D2O 10 ? % 'natural abundance' 2 nMazE9 430 ? uM '[U-100% 13C; U-100% 15N]' 2 'potassium phosphate' 20 ? mM 'natural abundance' 2 'sodium chloride' 20 ? mM 'natural abundance' 2 'sodium azide' 0.01 ? % 'natural abundance' 2 D2O 10 ? % 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'phosphate buffer pH 7.0' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 2 isotropic 2 1 1 '2D 1H-1H NOESY' 2 isotropic 3 1 2 '2D 1H-15N HSQC' 1 isotropic 4 1 2 '3D HNCACB' 1 isotropic 5 1 2 '3D CC(CO)NH-TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 8IMH _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'X-PLOR NIH' 3.4 'Schwieters, Kuszewski, Tjandra and Clore' 2 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' 'CcpNmr Analysis' '2.4.2, 2.5.0' CCPN 4 'peak picking' 'CcpNmr Analysis' '2.4.2, 2.5.0' CCPN 5 processing NMRPipe '9.5 Rev 2018.060.15.58 , 10.9 Rev 2020.119.13.27' 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 6 collection VnmrJ 4.2 Varian 7 collection TopSpin 4.1.0 'Bruker Biospin' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLY N N N N 77 GLY CA C N N 78 GLY C C N N 79 GLY O O N N 80 GLY OXT O N N 81 GLY H H N N 82 GLY H2 H N N 83 GLY HA2 H N N 84 GLY HA3 H N N 85 GLY HXT H N N 86 HIS N N N N 87 HIS CA C N S 88 HIS C C N N 89 HIS O O N N 90 HIS CB C N N 91 HIS CG C Y N 92 HIS ND1 N Y N 93 HIS CD2 C Y N 94 HIS CE1 C Y N 95 HIS NE2 N Y N 96 HIS OXT O N N 97 HIS H H N N 98 HIS H2 H N N 99 HIS HA H N N 100 HIS HB2 H N N 101 HIS HB3 H N N 102 HIS HD1 H N N 103 HIS HD2 H N N 104 HIS HE1 H N N 105 HIS HE2 H N N 106 HIS HXT H N N 107 ILE N N N N 108 ILE CA C N S 109 ILE C C N N 110 ILE O O N N 111 ILE CB C N S 112 ILE CG1 C N N 113 ILE CG2 C N N 114 ILE CD1 C N N 115 ILE OXT O N N 116 ILE H H N N 117 ILE H2 H N N 118 ILE HA H N N 119 ILE HB H N N 120 ILE HG12 H N N 121 ILE HG13 H N N 122 ILE HG21 H N N 123 ILE HG22 H N N 124 ILE HG23 H N N 125 ILE HD11 H N N 126 ILE HD12 H N N 127 ILE HD13 H N N 128 ILE HXT H N N 129 LEU N N N N 130 LEU CA C N S 131 LEU C C N N 132 LEU O O N N 133 LEU CB C N N 134 LEU CG C N N 135 LEU CD1 C N N 136 LEU CD2 C N N 137 LEU OXT O N N 138 LEU H H N N 139 LEU H2 H N N 140 LEU HA H N N 141 LEU HB2 H N N 142 LEU HB3 H N N 143 LEU HG H N N 144 LEU HD11 H N N 145 LEU HD12 H N N 146 LEU HD13 H N N 147 LEU HD21 H N N 148 LEU HD22 H N N 149 LEU HD23 H N N 150 LEU HXT H N N 151 LYS N N N N 152 LYS CA C N S 153 LYS C C N N 154 LYS O O N N 155 LYS CB C N N 156 LYS CG C N N 157 LYS CD C N N 158 LYS CE C N N 159 LYS NZ N N N 160 LYS OXT O N N 161 LYS H H N N 162 LYS H2 H N N 163 LYS HA H N N 164 LYS HB2 H N N 165 LYS HB3 H N N 166 LYS HG2 H N N 167 LYS HG3 H N N 168 LYS HD2 H N N 169 LYS HD3 H N N 170 LYS HE2 H N N 171 LYS HE3 H N N 172 LYS HZ1 H N N 173 LYS HZ2 H N N 174 LYS HZ3 H N N 175 LYS HXT H N N 176 MET N N N N 177 MET CA C N S 178 MET C C N N 179 MET O O N N 180 MET CB C N N 181 MET CG C N N 182 MET SD S N N 183 MET CE C N N 184 MET OXT O N N 185 MET H H N N 186 MET H2 H N N 187 MET HA H N N 188 MET HB2 H N N 189 MET HB3 H N N 190 MET HG2 H N N 191 MET HG3 H N N 192 MET HE1 H N N 193 MET HE2 H N N 194 MET HE3 H N N 195 MET HXT H N N 196 PRO N N N N 197 PRO CA C N S 198 PRO C C N N 199 PRO O O N N 200 PRO CB C N N 201 PRO CG C N N 202 PRO CD C N N 203 PRO OXT O N N 204 PRO H H N N 205 PRO HA H N N 206 PRO HB2 H N N 207 PRO HB3 H N N 208 PRO HG2 H N N 209 PRO HG3 H N N 210 PRO HD2 H N N 211 PRO HD3 H N N 212 PRO HXT H N N 213 SER N N N N 214 SER CA C N S 215 SER C C N N 216 SER O O N N 217 SER CB C N N 218 SER OG O N N 219 SER OXT O N N 220 SER H H N N 221 SER H2 H N N 222 SER HA H N N 223 SER HB2 H N N 224 SER HB3 H N N 225 SER HG H N N 226 SER HXT H N N 227 TYR N N N N 228 TYR CA C N S 229 TYR C C N N 230 TYR O O N N 231 TYR CB C N N 232 TYR CG C Y N 233 TYR CD1 C Y N 234 TYR CD2 C Y N 235 TYR CE1 C Y N 236 TYR CE2 C Y N 237 TYR CZ C Y N 238 TYR OH O N N 239 TYR OXT O N N 240 TYR H H N N 241 TYR H2 H N N 242 TYR HA H N N 243 TYR HB2 H N N 244 TYR HB3 H N N 245 TYR HD1 H N N 246 TYR HD2 H N N 247 TYR HE1 H N N 248 TYR HE2 H N N 249 TYR HH H N N 250 TYR HXT H N N 251 VAL N N N N 252 VAL CA C N S 253 VAL C C N N 254 VAL O O N N 255 VAL CB C N N 256 VAL CG1 C N N 257 VAL CG2 C N N 258 VAL OXT O N N 259 VAL H H N N 260 VAL H2 H N N 261 VAL HA H N N 262 VAL HB H N N 263 VAL HG11 H N N 264 VAL HG12 H N N 265 VAL HG13 H N N 266 VAL HG21 H N N 267 VAL HG22 H N N 268 VAL HG23 H N N 269 VAL HXT H N N 270 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLY N CA sing N N 73 GLY N H sing N N 74 GLY N H2 sing N N 75 GLY CA C sing N N 76 GLY CA HA2 sing N N 77 GLY CA HA3 sing N N 78 GLY C O doub N N 79 GLY C OXT sing N N 80 GLY OXT HXT sing N N 81 HIS N CA sing N N 82 HIS N H sing N N 83 HIS N H2 sing N N 84 HIS CA C sing N N 85 HIS CA CB sing N N 86 HIS CA HA sing N N 87 HIS C O doub N N 88 HIS C OXT sing N N 89 HIS CB CG sing N N 90 HIS CB HB2 sing N N 91 HIS CB HB3 sing N N 92 HIS CG ND1 sing Y N 93 HIS CG CD2 doub Y N 94 HIS ND1 CE1 doub Y N 95 HIS ND1 HD1 sing N N 96 HIS CD2 NE2 sing Y N 97 HIS CD2 HD2 sing N N 98 HIS CE1 NE2 sing Y N 99 HIS CE1 HE1 sing N N 100 HIS NE2 HE2 sing N N 101 HIS OXT HXT sing N N 102 ILE N CA sing N N 103 ILE N H sing N N 104 ILE N H2 sing N N 105 ILE CA C sing N N 106 ILE CA CB sing N N 107 ILE CA HA sing N N 108 ILE C O doub N N 109 ILE C OXT sing N N 110 ILE CB CG1 sing N N 111 ILE CB CG2 sing N N 112 ILE CB HB sing N N 113 ILE CG1 CD1 sing N N 114 ILE CG1 HG12 sing N N 115 ILE CG1 HG13 sing N N 116 ILE CG2 HG21 sing N N 117 ILE CG2 HG22 sing N N 118 ILE CG2 HG23 sing N N 119 ILE CD1 HD11 sing N N 120 ILE CD1 HD12 sing N N 121 ILE CD1 HD13 sing N N 122 ILE OXT HXT sing N N 123 LEU N CA sing N N 124 LEU N H sing N N 125 LEU N H2 sing N N 126 LEU CA C sing N N 127 LEU CA CB sing N N 128 LEU CA HA sing N N 129 LEU C O doub N N 130 LEU C OXT sing N N 131 LEU CB CG sing N N 132 LEU CB HB2 sing N N 133 LEU CB HB3 sing N N 134 LEU CG CD1 sing N N 135 LEU CG CD2 sing N N 136 LEU CG HG sing N N 137 LEU CD1 HD11 sing N N 138 LEU CD1 HD12 sing N N 139 LEU CD1 HD13 sing N N 140 LEU CD2 HD21 sing N N 141 LEU CD2 HD22 sing N N 142 LEU CD2 HD23 sing N N 143 LEU OXT HXT sing N N 144 LYS N CA sing N N 145 LYS N H sing N N 146 LYS N H2 sing N N 147 LYS CA C sing N N 148 LYS CA CB sing N N 149 LYS CA HA sing N N 150 LYS C O doub N N 151 LYS C OXT sing N N 152 LYS CB CG sing N N 153 LYS CB HB2 sing N N 154 LYS CB HB3 sing N N 155 LYS CG CD sing N N 156 LYS CG HG2 sing N N 157 LYS CG HG3 sing N N 158 LYS CD CE sing N N 159 LYS CD HD2 sing N N 160 LYS CD HD3 sing N N 161 LYS CE NZ sing N N 162 LYS CE HE2 sing N N 163 LYS CE HE3 sing N N 164 LYS NZ HZ1 sing N N 165 LYS NZ HZ2 sing N N 166 LYS NZ HZ3 sing N N 167 LYS OXT HXT sing N N 168 MET N CA sing N N 169 MET N H sing N N 170 MET N H2 sing N N 171 MET CA C sing N N 172 MET CA CB sing N N 173 MET CA HA sing N N 174 MET C O doub N N 175 MET C OXT sing N N 176 MET CB CG sing N N 177 MET CB HB2 sing N N 178 MET CB HB3 sing N N 179 MET CG SD sing N N 180 MET CG HG2 sing N N 181 MET CG HG3 sing N N 182 MET SD CE sing N N 183 MET CE HE1 sing N N 184 MET CE HE2 sing N N 185 MET CE HE3 sing N N 186 MET OXT HXT sing N N 187 PRO N CA sing N N 188 PRO N CD sing N N 189 PRO N H sing N N 190 PRO CA C sing N N 191 PRO CA CB sing N N 192 PRO CA HA sing N N 193 PRO C O doub N N 194 PRO C OXT sing N N 195 PRO CB CG sing N N 196 PRO CB HB2 sing N N 197 PRO CB HB3 sing N N 198 PRO CG CD sing N N 199 PRO CG HG2 sing N N 200 PRO CG HG3 sing N N 201 PRO CD HD2 sing N N 202 PRO CD HD3 sing N N 203 PRO OXT HXT sing N N 204 SER N CA sing N N 205 SER N H sing N N 206 SER N H2 sing N N 207 SER CA C sing N N 208 SER CA CB sing N N 209 SER CA HA sing N N 210 SER C O doub N N 211 SER C OXT sing N N 212 SER CB OG sing N N 213 SER CB HB2 sing N N 214 SER CB HB3 sing N N 215 SER OG HG sing N N 216 SER OXT HXT sing N N 217 TYR N CA sing N N 218 TYR N H sing N N 219 TYR N H2 sing N N 220 TYR CA C sing N N 221 TYR CA CB sing N N 222 TYR CA HA sing N N 223 TYR C O doub N N 224 TYR C OXT sing N N 225 TYR CB CG sing N N 226 TYR CB HB2 sing N N 227 TYR CB HB3 sing N N 228 TYR CG CD1 doub Y N 229 TYR CG CD2 sing Y N 230 TYR CD1 CE1 sing Y N 231 TYR CD1 HD1 sing N N 232 TYR CD2 CE2 doub Y N 233 TYR CD2 HD2 sing N N 234 TYR CE1 CZ doub Y N 235 TYR CE1 HE1 sing N N 236 TYR CE2 CZ sing Y N 237 TYR CE2 HE2 sing N N 238 TYR CZ OH sing N N 239 TYR OH HH sing N N 240 TYR OXT HXT sing N N 241 VAL N CA sing N N 242 VAL N H sing N N 243 VAL N H2 sing N N 244 VAL CA C sing N N 245 VAL CA CB sing N N 246 VAL CA HA sing N N 247 VAL C O doub N N 248 VAL C OXT sing N N 249 VAL CB CG1 sing N N 250 VAL CB CG2 sing N N 251 VAL CB HB sing N N 252 VAL CG1 HG11 sing N N 253 VAL CG1 HG12 sing N N 254 VAL CG1 HG13 sing N N 255 VAL CG2 HG21 sing N N 256 VAL CG2 HG22 sing N N 257 VAL CG2 HG23 sing N N 258 VAL OXT HXT sing N N 259 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Department of Biotechnology (DBT, India)' India ? 1 'Department of Science & Technology (DST, India)' India ? 2 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 DDS2 ? Varian 600 ? 2 'AVANCE III' ? Bruker 700 ? # _atom_sites.entry_id 8IMH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #