data_8JAT # _entry.id 8JAT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8JAT pdb_00008jat 10.2210/pdb8jat/pdb WWPDB D_1300037531 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-21 2 'Structure model' 1 1 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8JAT _pdbx_database_status.recvd_initial_deposition_date 2023-05-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email zhihe.kuang@jnu.edu.cn _pdbx_contact_author.name_first Zhihe _pdbx_contact_author.name_last Kuang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1032-5688 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhao, P.' 1 0000-0002-6698-6509 'Kuang, Z.' 2 0000-0003-1032-5688 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 670 _citation.language ? _citation.page_first 73 _citation.page_last 78 _citation.title 'Crystal structure of the 3-ketodihydrosphingosine reductase TSC10 from Cryptococcus neoformans.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2023.05.109 _citation.pdbx_database_id_PubMed 37285720 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, P.' 1 ? primary 'Zhuang, Z.' 2 ? primary 'Guan, X.' 3 ? primary 'Yang, J.' 4 ? primary 'Wang, W.' 5 ? primary 'Kuang, Z.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3-ketodihydrosphingosine reductase TSC10' 29768.910 1 1.1.1.102 Y190F ? ? 2 non-polymer syn 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 745.421 1 ? ? ? ? 3 water nat water 18.015 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '3-dehydrosphinganine reductase,KDS reductase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSNYDPRGKHCYITGGSSGLGKALAERLVKQGAHVTIVGRDSKKAEGVVEELKAIAAPGQIIQCIAADLTSPIASTNAIH AACKPHADQAPDYVYLCAGFSRPKLFVETTKQELKDGLDGVYWVSAYTAHEACQMMSKQRRTGKIIFVASFLSYVSFAGY SSFSPAKYALRGLSDALRSEMLLHNIDIHIFLPCGISGPGFDAENRTKPAVTKKIEEGDTPITPDVCAAALESGLKKGYY QITDNLVTEPIRLRSNGGVPTNNFLLSGSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSNYDPRGKHCYITGGSSGLGKALAERLVKQGAHVTIVGRDSKKAEGVVEELKAIAAPGQIIQCIAADLTSPIASTNAIH AACKPHADQAPDYVYLCAGFSRPKLFVETTKQELKDGLDGVYWVSAYTAHEACQMMSKQRRTGKIIFVASFLSYVSFAGY SSFSPAKYALRGLSDALRSEMLLHNIDIHIFLPCGISGPGFDAENRTKPAVTKKIEEGDTPITPDVCAAALESGLKKGYY QITDNLVTEPIRLRSNGGVPTNNFLLSGSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' NDP 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASN n 1 4 TYR n 1 5 ASP n 1 6 PRO n 1 7 ARG n 1 8 GLY n 1 9 LYS n 1 10 HIS n 1 11 CYS n 1 12 TYR n 1 13 ILE n 1 14 THR n 1 15 GLY n 1 16 GLY n 1 17 SER n 1 18 SER n 1 19 GLY n 1 20 LEU n 1 21 GLY n 1 22 LYS n 1 23 ALA n 1 24 LEU n 1 25 ALA n 1 26 GLU n 1 27 ARG n 1 28 LEU n 1 29 VAL n 1 30 LYS n 1 31 GLN n 1 32 GLY n 1 33 ALA n 1 34 HIS n 1 35 VAL n 1 36 THR n 1 37 ILE n 1 38 VAL n 1 39 GLY n 1 40 ARG n 1 41 ASP n 1 42 SER n 1 43 LYS n 1 44 LYS n 1 45 ALA n 1 46 GLU n 1 47 GLY n 1 48 VAL n 1 49 VAL n 1 50 GLU n 1 51 GLU n 1 52 LEU n 1 53 LYS n 1 54 ALA n 1 55 ILE n 1 56 ALA n 1 57 ALA n 1 58 PRO n 1 59 GLY n 1 60 GLN n 1 61 ILE n 1 62 ILE n 1 63 GLN n 1 64 CYS n 1 65 ILE n 1 66 ALA n 1 67 ALA n 1 68 ASP n 1 69 LEU n 1 70 THR n 1 71 SER n 1 72 PRO n 1 73 ILE n 1 74 ALA n 1 75 SER n 1 76 THR n 1 77 ASN n 1 78 ALA n 1 79 ILE n 1 80 HIS n 1 81 ALA n 1 82 ALA n 1 83 CYS n 1 84 LYS n 1 85 PRO n 1 86 HIS n 1 87 ALA n 1 88 ASP n 1 89 GLN n 1 90 ALA n 1 91 PRO n 1 92 ASP n 1 93 TYR n 1 94 VAL n 1 95 TYR n 1 96 LEU n 1 97 CYS n 1 98 ALA n 1 99 GLY n 1 100 PHE n 1 101 SER n 1 102 ARG n 1 103 PRO n 1 104 LYS n 1 105 LEU n 1 106 PHE n 1 107 VAL n 1 108 GLU n 1 109 THR n 1 110 THR n 1 111 LYS n 1 112 GLN n 1 113 GLU n 1 114 LEU n 1 115 LYS n 1 116 ASP n 1 117 GLY n 1 118 LEU n 1 119 ASP n 1 120 GLY n 1 121 VAL n 1 122 TYR n 1 123 TRP n 1 124 VAL n 1 125 SER n 1 126 ALA n 1 127 TYR n 1 128 THR n 1 129 ALA n 1 130 HIS n 1 131 GLU n 1 132 ALA n 1 133 CYS n 1 134 GLN n 1 135 MET n 1 136 MET n 1 137 SER n 1 138 LYS n 1 139 GLN n 1 140 ARG n 1 141 ARG n 1 142 THR n 1 143 GLY n 1 144 LYS n 1 145 ILE n 1 146 ILE n 1 147 PHE n 1 148 VAL n 1 149 ALA n 1 150 SER n 1 151 PHE n 1 152 LEU n 1 153 SER n 1 154 TYR n 1 155 VAL n 1 156 SER n 1 157 PHE n 1 158 ALA n 1 159 GLY n 1 160 TYR n 1 161 SER n 1 162 SER n 1 163 PHE n 1 164 SER n 1 165 PRO n 1 166 ALA n 1 167 LYS n 1 168 TYR n 1 169 ALA n 1 170 LEU n 1 171 ARG n 1 172 GLY n 1 173 LEU n 1 174 SER n 1 175 ASP n 1 176 ALA n 1 177 LEU n 1 178 ARG n 1 179 SER n 1 180 GLU n 1 181 MET n 1 182 LEU n 1 183 LEU n 1 184 HIS n 1 185 ASN n 1 186 ILE n 1 187 ASP n 1 188 ILE n 1 189 HIS n 1 190 ILE n 1 191 PHE n 1 192 LEU n 1 193 PRO n 1 194 CYS n 1 195 GLY n 1 196 ILE n 1 197 SER n 1 198 GLY n 1 199 PRO n 1 200 GLY n 1 201 PHE n 1 202 ASP n 1 203 ALA n 1 204 GLU n 1 205 ASN n 1 206 ARG n 1 207 THR n 1 208 LYS n 1 209 PRO n 1 210 ALA n 1 211 VAL n 1 212 THR n 1 213 LYS n 1 214 LYS n 1 215 ILE n 1 216 GLU n 1 217 GLU n 1 218 GLY n 1 219 ASP n 1 220 THR n 1 221 PRO n 1 222 ILE n 1 223 THR n 1 224 PRO n 1 225 ASP n 1 226 VAL n 1 227 CYS n 1 228 ALA n 1 229 ALA n 1 230 ALA n 1 231 LEU n 1 232 GLU n 1 233 SER n 1 234 GLY n 1 235 LEU n 1 236 LYS n 1 237 LYS n 1 238 GLY n 1 239 TYR n 1 240 TYR n 1 241 GLN n 1 242 ILE n 1 243 THR n 1 244 ASP n 1 245 ASN n 1 246 LEU n 1 247 VAL n 1 248 THR n 1 249 GLU n 1 250 PRO n 1 251 ILE n 1 252 ARG n 1 253 LEU n 1 254 ARG n 1 255 SER n 1 256 ASN n 1 257 GLY n 1 258 GLY n 1 259 VAL n 1 260 PRO n 1 261 THR n 1 262 ASN n 1 263 ASN n 1 264 PHE n 1 265 LEU n 1 266 LEU n 1 267 SER n 1 268 GLY n 1 269 SER n 1 270 HIS n 1 271 HIS n 1 272 HIS n 1 273 HIS n 1 274 HIS n 1 275 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 275 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TSC10, CNG00270' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cryptococcus neoformans var. neoformans JEC21' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 214684 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NDP non-polymer . 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' ? 'C21 H30 N7 O17 P3' 745.421 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 28 ? ? ? A . n A 1 2 SER 2 29 ? ? ? A . n A 1 3 ASN 3 30 ? ? ? A . n A 1 4 TYR 4 31 31 TYR TYR A . n A 1 5 ASP 5 32 32 ASP ASP A . n A 1 6 PRO 6 33 33 PRO PRO A . n A 1 7 ARG 7 34 34 ARG ARG A . n A 1 8 GLY 8 35 35 GLY GLY A . n A 1 9 LYS 9 36 36 LYS LYS A . n A 1 10 HIS 10 37 37 HIS HIS A . n A 1 11 CYS 11 38 38 CYS CYS A . n A 1 12 TYR 12 39 39 TYR TYR A . n A 1 13 ILE 13 40 40 ILE ILE A . n A 1 14 THR 14 41 41 THR THR A . n A 1 15 GLY 15 42 42 GLY GLY A . n A 1 16 GLY 16 43 43 GLY GLY A . n A 1 17 SER 17 44 44 SER SER A . n A 1 18 SER 18 45 45 SER SER A . n A 1 19 GLY 19 46 46 GLY GLY A . n A 1 20 LEU 20 47 47 LEU LEU A . n A 1 21 GLY 21 48 48 GLY GLY A . n A 1 22 LYS 22 49 49 LYS LYS A . n A 1 23 ALA 23 50 50 ALA ALA A . n A 1 24 LEU 24 51 51 LEU LEU A . n A 1 25 ALA 25 52 52 ALA ALA A . n A 1 26 GLU 26 53 53 GLU GLU A . n A 1 27 ARG 27 54 54 ARG ARG A . n A 1 28 LEU 28 55 55 LEU LEU A . n A 1 29 VAL 29 56 56 VAL VAL A . n A 1 30 LYS 30 57 57 LYS LYS A . n A 1 31 GLN 31 58 58 GLN GLN A . n A 1 32 GLY 32 59 59 GLY GLY A . n A 1 33 ALA 33 60 60 ALA ALA A . n A 1 34 HIS 34 61 61 HIS HIS A . n A 1 35 VAL 35 62 62 VAL VAL A . n A 1 36 THR 36 63 63 THR THR A . n A 1 37 ILE 37 64 64 ILE ILE A . n A 1 38 VAL 38 65 65 VAL VAL A . n A 1 39 GLY 39 66 66 GLY GLY A . n A 1 40 ARG 40 67 67 ARG ARG A . n A 1 41 ASP 41 68 68 ASP ASP A . n A 1 42 SER 42 69 69 SER SER A . n A 1 43 LYS 43 70 70 LYS LYS A . n A 1 44 LYS 44 71 71 LYS LYS A . n A 1 45 ALA 45 72 72 ALA ALA A . n A 1 46 GLU 46 73 73 GLU GLU A . n A 1 47 GLY 47 74 74 GLY GLY A . n A 1 48 VAL 48 75 75 VAL VAL A . n A 1 49 VAL 49 76 76 VAL VAL A . n A 1 50 GLU 50 77 77 GLU GLU A . n A 1 51 GLU 51 78 78 GLU GLU A . n A 1 52 LEU 52 79 79 LEU LEU A . n A 1 53 LYS 53 80 80 LYS LYS A . n A 1 54 ALA 54 81 81 ALA ALA A . n A 1 55 ILE 55 82 82 ILE ILE A . n A 1 56 ALA 56 83 83 ALA ALA A . n A 1 57 ALA 57 84 84 ALA ALA A . n A 1 58 PRO 58 85 85 PRO PRO A . n A 1 59 GLY 59 86 86 GLY GLY A . n A 1 60 GLN 60 87 87 GLN GLN A . n A 1 61 ILE 61 88 88 ILE ILE A . n A 1 62 ILE 62 89 89 ILE ILE A . n A 1 63 GLN 63 90 90 GLN GLN A . n A 1 64 CYS 64 91 91 CYS CYS A . n A 1 65 ILE 65 92 92 ILE ILE A . n A 1 66 ALA 66 93 93 ALA ALA A . n A 1 67 ALA 67 94 94 ALA ALA A . n A 1 68 ASP 68 95 95 ASP ASP A . n A 1 69 LEU 69 96 96 LEU LEU A . n A 1 70 THR 70 97 97 THR THR A . n A 1 71 SER 71 98 98 SER SER A . n A 1 72 PRO 72 99 99 PRO PRO A . n A 1 73 ILE 73 100 100 ILE ILE A . n A 1 74 ALA 74 101 101 ALA ALA A . n A 1 75 SER 75 102 102 SER SER A . n A 1 76 THR 76 103 103 THR THR A . n A 1 77 ASN 77 104 104 ASN ASN A . n A 1 78 ALA 78 105 105 ALA ALA A . n A 1 79 ILE 79 106 106 ILE ILE A . n A 1 80 HIS 80 107 107 HIS HIS A . n A 1 81 ALA 81 108 108 ALA ALA A . n A 1 82 ALA 82 109 109 ALA ALA A . n A 1 83 CYS 83 110 110 CYS CYS A . n A 1 84 LYS 84 111 111 LYS LYS A . n A 1 85 PRO 85 112 112 PRO PRO A . n A 1 86 HIS 86 113 113 HIS HIS A . n A 1 87 ALA 87 114 114 ALA ALA A . n A 1 88 ASP 88 115 115 ASP ASP A . n A 1 89 GLN 89 116 116 GLN GLN A . n A 1 90 ALA 90 117 117 ALA ALA A . n A 1 91 PRO 91 118 118 PRO PRO A . n A 1 92 ASP 92 119 119 ASP ASP A . n A 1 93 TYR 93 120 120 TYR TYR A . n A 1 94 VAL 94 121 121 VAL VAL A . n A 1 95 TYR 95 122 122 TYR TYR A . n A 1 96 LEU 96 123 123 LEU LEU A . n A 1 97 CYS 97 124 124 CYS CYS A . n A 1 98 ALA 98 125 125 ALA ALA A . n A 1 99 GLY 99 126 126 GLY GLY A . n A 1 100 PHE 100 127 127 PHE PHE A . n A 1 101 SER 101 128 128 SER SER A . n A 1 102 ARG 102 129 129 ARG ARG A . n A 1 103 PRO 103 130 130 PRO PRO A . n A 1 104 LYS 104 131 131 LYS LYS A . n A 1 105 LEU 105 132 132 LEU LEU A . n A 1 106 PHE 106 133 133 PHE PHE A . n A 1 107 VAL 107 134 134 VAL VAL A . n A 1 108 GLU 108 135 135 GLU GLU A . n A 1 109 THR 109 136 136 THR THR A . n A 1 110 THR 110 137 137 THR THR A . n A 1 111 LYS 111 138 138 LYS LYS A . n A 1 112 GLN 112 139 139 GLN GLN A . n A 1 113 GLU 113 140 140 GLU GLU A . n A 1 114 LEU 114 141 141 LEU LEU A . n A 1 115 LYS 115 142 142 LYS LYS A . n A 1 116 ASP 116 143 143 ASP ASP A . n A 1 117 GLY 117 144 144 GLY GLY A . n A 1 118 LEU 118 145 145 LEU LEU A . n A 1 119 ASP 119 146 146 ASP ASP A . n A 1 120 GLY 120 147 147 GLY GLY A . n A 1 121 VAL 121 148 148 VAL VAL A . n A 1 122 TYR 122 149 149 TYR TYR A . n A 1 123 TRP 123 150 150 TRP TRP A . n A 1 124 VAL 124 151 151 VAL VAL A . n A 1 125 SER 125 152 152 SER SER A . n A 1 126 ALA 126 153 153 ALA ALA A . n A 1 127 TYR 127 154 154 TYR TYR A . n A 1 128 THR 128 155 155 THR THR A . n A 1 129 ALA 129 156 156 ALA ALA A . n A 1 130 HIS 130 157 157 HIS HIS A . n A 1 131 GLU 131 158 158 GLU GLU A . n A 1 132 ALA 132 159 159 ALA ALA A . n A 1 133 CYS 133 160 160 CYS CYS A . n A 1 134 GLN 134 161 161 GLN GLN A . n A 1 135 MET 135 162 162 MET MET A . n A 1 136 MET 136 163 163 MET MET A . n A 1 137 SER 137 164 164 SER SER A . n A 1 138 LYS 138 165 165 LYS LYS A . n A 1 139 GLN 139 166 166 GLN GLN A . n A 1 140 ARG 140 167 167 ARG ARG A . n A 1 141 ARG 141 168 168 ARG ARG A . n A 1 142 THR 142 169 169 THR THR A . n A 1 143 GLY 143 170 170 GLY GLY A . n A 1 144 LYS 144 171 171 LYS LYS A . n A 1 145 ILE 145 172 172 ILE ILE A . n A 1 146 ILE 146 173 173 ILE ILE A . n A 1 147 PHE 147 174 174 PHE PHE A . n A 1 148 VAL 148 175 175 VAL VAL A . n A 1 149 ALA 149 176 176 ALA ALA A . n A 1 150 SER 150 177 177 SER SER A . n A 1 151 PHE 151 178 ? ? ? A . n A 1 152 LEU 152 179 ? ? ? A . n A 1 153 SER 153 180 ? ? ? A . n A 1 154 TYR 154 181 ? ? ? A . n A 1 155 VAL 155 182 ? ? ? A . n A 1 156 SER 156 183 ? ? ? A . n A 1 157 PHE 157 184 ? ? ? A . n A 1 158 ALA 158 185 ? ? ? A . n A 1 159 GLY 159 186 ? ? ? A . n A 1 160 TYR 160 187 187 TYR TYR A . n A 1 161 SER 161 188 188 SER SER A . n A 1 162 SER 162 189 189 SER SER A . n A 1 163 PHE 163 190 190 PHE PHE A . n A 1 164 SER 164 191 191 SER SER A . n A 1 165 PRO 165 192 192 PRO PRO A . n A 1 166 ALA 166 193 193 ALA ALA A . n A 1 167 LYS 167 194 194 LYS LYS A . n A 1 168 TYR 168 195 195 TYR TYR A . n A 1 169 ALA 169 196 196 ALA ALA A . n A 1 170 LEU 170 197 197 LEU LEU A . n A 1 171 ARG 171 198 198 ARG ARG A . n A 1 172 GLY 172 199 199 GLY GLY A . n A 1 173 LEU 173 200 200 LEU LEU A . n A 1 174 SER 174 201 201 SER SER A . n A 1 175 ASP 175 202 202 ASP ASP A . n A 1 176 ALA 176 203 203 ALA ALA A . n A 1 177 LEU 177 204 204 LEU LEU A . n A 1 178 ARG 178 205 205 ARG ARG A . n A 1 179 SER 179 206 206 SER SER A . n A 1 180 GLU 180 207 207 GLU GLU A . n A 1 181 MET 181 208 208 MET MET A . n A 1 182 LEU 182 209 209 LEU LEU A . n A 1 183 LEU 183 210 210 LEU LEU A . n A 1 184 HIS 184 211 211 HIS HIS A . n A 1 185 ASN 185 212 212 ASN ASN A . n A 1 186 ILE 186 213 213 ILE ILE A . n A 1 187 ASP 187 214 214 ASP ASP A . n A 1 188 ILE 188 215 215 ILE ILE A . n A 1 189 HIS 189 216 216 HIS HIS A . n A 1 190 ILE 190 217 217 ILE ILE A . n A 1 191 PHE 191 218 218 PHE PHE A . n A 1 192 LEU 192 219 219 LEU LEU A . n A 1 193 PRO 193 220 220 PRO PRO A . n A 1 194 CYS 194 221 ? ? ? A . n A 1 195 GLY 195 222 ? ? ? A . n A 1 196 ILE 196 223 ? ? ? A . n A 1 197 SER 197 224 ? ? ? A . n A 1 198 GLY 198 225 ? ? ? A . n A 1 199 PRO 199 226 ? ? ? A . n A 1 200 GLY 200 227 ? ? ? A . n A 1 201 PHE 201 228 ? ? ? A . n A 1 202 ASP 202 229 ? ? ? A . n A 1 203 ALA 203 230 ? ? ? A . n A 1 204 GLU 204 231 ? ? ? A . n A 1 205 ASN 205 232 ? ? ? A . n A 1 206 ARG 206 233 ? ? ? A . n A 1 207 THR 207 234 ? ? ? A . n A 1 208 LYS 208 235 ? ? ? A . n A 1 209 PRO 209 236 ? ? ? A . n A 1 210 ALA 210 237 ? ? ? A . n A 1 211 VAL 211 238 ? ? ? A . n A 1 212 THR 212 239 ? ? ? A . n A 1 213 LYS 213 240 ? ? ? A . n A 1 214 LYS 214 241 ? ? ? A . n A 1 215 ILE 215 242 ? ? ? A . n A 1 216 GLU 216 243 ? ? ? A . n A 1 217 GLU 217 244 ? ? ? A . n A 1 218 GLY 218 245 ? ? ? A . n A 1 219 ASP 219 246 ? ? ? A . n A 1 220 THR 220 247 ? ? ? A . n A 1 221 PRO 221 248 ? ? ? A . n A 1 222 ILE 222 249 249 ILE ILE A . n A 1 223 THR 223 250 250 THR THR A . n A 1 224 PRO 224 251 251 PRO PRO A . n A 1 225 ASP 225 252 252 ASP ASP A . n A 1 226 VAL 226 253 253 VAL VAL A . n A 1 227 CYS 227 254 254 CYS CYS A . n A 1 228 ALA 228 255 255 ALA ALA A . n A 1 229 ALA 229 256 256 ALA ALA A . n A 1 230 ALA 230 257 257 ALA ALA A . n A 1 231 LEU 231 258 258 LEU LEU A . n A 1 232 GLU 232 259 259 GLU GLU A . n A 1 233 SER 233 260 260 SER SER A . n A 1 234 GLY 234 261 261 GLY GLY A . n A 1 235 LEU 235 262 262 LEU LEU A . n A 1 236 LYS 236 263 263 LYS LYS A . n A 1 237 LYS 237 264 264 LYS LYS A . n A 1 238 GLY 238 265 265 GLY GLY A . n A 1 239 TYR 239 266 266 TYR TYR A . n A 1 240 TYR 240 267 267 TYR TYR A . n A 1 241 GLN 241 268 268 GLN GLN A . n A 1 242 ILE 242 269 269 ILE ILE A . n A 1 243 THR 243 270 270 THR THR A . n A 1 244 ASP 244 271 271 ASP ASP A . n A 1 245 ASN 245 272 ? ? ? A . n A 1 246 LEU 246 273 ? ? ? A . n A 1 247 VAL 247 274 ? ? ? A . n A 1 248 THR 248 275 ? ? ? A . n A 1 249 GLU 249 276 ? ? ? A . n A 1 250 PRO 250 277 ? ? ? A . n A 1 251 ILE 251 278 ? ? ? A . n A 1 252 ARG 252 279 ? ? ? A . n A 1 253 LEU 253 280 ? ? ? A . n A 1 254 ARG 254 281 ? ? ? A . n A 1 255 SER 255 282 ? ? ? A . n A 1 256 ASN 256 283 ? ? ? A . n A 1 257 GLY 257 284 ? ? ? A . n A 1 258 GLY 258 285 ? ? ? A . n A 1 259 VAL 259 286 ? ? ? A . n A 1 260 PRO 260 287 ? ? ? A . n A 1 261 THR 261 288 ? ? ? A . n A 1 262 ASN 262 289 ? ? ? A . n A 1 263 ASN 263 290 ? ? ? A . n A 1 264 PHE 264 291 ? ? ? A . n A 1 265 LEU 265 292 ? ? ? A . n A 1 266 LEU 266 293 ? ? ? A . n A 1 267 SER 267 294 ? ? ? A . n A 1 268 GLY 268 295 ? ? ? A . n A 1 269 SER 269 296 ? ? ? A . n A 1 270 HIS 270 297 ? ? ? A . n A 1 271 HIS 271 298 ? ? ? A . n A 1 272 HIS 272 299 ? ? ? A . n A 1 273 HIS 273 300 ? ? ? A . n A 1 274 HIS 274 301 ? ? ? A . n A 1 275 HIS 275 302 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NDP 1 401 301 NDP NDP A . C 3 HOH 1 501 2 HOH HOH A . C 3 HOH 2 502 3 HOH HOH A . C 3 HOH 3 503 1 HOH HOH A . C 3 HOH 4 504 4 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A NDP 401 ? C5D ? B NDP 1 C5D 2 1 N 1 A NDP 401 ? C4D ? B NDP 1 C4D 3 1 N 1 A NDP 401 ? O4D ? B NDP 1 O4D 4 1 N 1 A NDP 401 ? C3D ? B NDP 1 C3D 5 1 N 1 A NDP 401 ? O3D ? B NDP 1 O3D 6 1 N 1 A NDP 401 ? C2D ? B NDP 1 C2D 7 1 N 1 A NDP 401 ? O2D ? B NDP 1 O2D 8 1 N 1 A NDP 401 ? C1D ? B NDP 1 C1D 9 1 N 1 A NDP 401 ? N1N ? B NDP 1 N1N 10 1 N 1 A NDP 401 ? C2N ? B NDP 1 C2N 11 1 N 1 A NDP 401 ? C3N ? B NDP 1 C3N 12 1 N 1 A NDP 401 ? C7N ? B NDP 1 C7N 13 1 N 1 A NDP 401 ? O7N ? B NDP 1 O7N 14 1 N 1 A NDP 401 ? N7N ? B NDP 1 N7N 15 1 N 1 A NDP 401 ? C4N ? B NDP 1 C4N 16 1 N 1 A NDP 401 ? C5N ? B NDP 1 C5N 17 1 N 1 A NDP 401 ? C6N ? B NDP 1 C6N # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MrBUMP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 8JAT _cell.details ? _cell.formula_units_Z ? _cell.length_a 111.311 _cell.length_a_esd ? _cell.length_b 111.311 _cell.length_b_esd ? _cell.length_c 80.399 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8JAT _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8JAT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.41 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Potassium sodium tartrate tetrahydrate, 20% w/v Polyethylene glycol 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-12-13 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL02U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL02U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8JAT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.20 _reflns.d_resolution_low 45.80 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5219 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.94 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.514 _reflns.pdbx_Rpim_I_all 0.115 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.987 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.501 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.20 _reflns_shell.d_res_low 3.42 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 17959 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 913 _reflns_shell.percent_possible_obs 100.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 19.7 _reflns_shell.pdbx_chi_squared 0.85 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.7 _reflns_shell.pdbx_Rrim_I_all 2.945 _reflns_shell.pdbx_Rpim_I_all 0.655 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.711 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.870 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 1.05 _refine.aniso_B[1][2] 0.53 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 1.05 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -3.42 _refine.B_iso_max ? _refine.B_iso_mean 64.071 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.933 _refine.correlation_coeff_Fo_to_Fc_free 0.882 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8JAT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.20 _refine.ls_d_res_low 45.80 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4945 _refine.ls_number_reflns_R_free 250 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.88 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.21328 _refine.ls_R_factor_R_free 0.28227 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.21004 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.520 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 24.811 _refine.overall_SU_ML 0.411 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 3.20 _refine_hist.d_res_low 45.80 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 1584 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1549 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 1612 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.015 1529 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.586 1.644 2185 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.225 1.582 3533 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.518 5.000 201 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.432 22.029 69 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.845 15.000 269 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.962 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.062 0.200 219 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1782 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 341 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.779 6.451 812 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.778 6.447 811 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 7.548 9.671 1011 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.545 9.675 1012 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.292 7.243 799 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.220 7.222 792 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.409 10.594 1175 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 11.773 79.681 1841 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 11.771 79.686 1842 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.201 _refine_ls_shell.d_res_low 3.284 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 18 _refine_ls_shell.number_reflns_R_work 352 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.302 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.341 # _struct.entry_id 8JAT _struct.title 'Crystal structure of the 3-ketodihydrosphingosine reductase TSC10 from Cryptococcus neoformans' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8JAT _struct_keywords.text '3-ketodihydrosphingosine reductase, Cryptococcus neoformans, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TSC10_CRYNJ _struct_ref.pdbx_db_accession P0CR36 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SNYDPRGKHCYITGGSSGLGKALAERLVKQGAHVTIVGRDSKKAEGVVEELKAIAAPGQIIQCIAADLTSPIASTNAIHA ACKPHADQAPDYVYLCAGFSRPKLFVETTKQELKDGLDGVYWVSAYTAHEACQMMSKQRRTGKIIFVASFLSYVSFAGYS SYSPAKYALRGLSDALRSEMLLHNIDIHIFLPCGISGPGFDAENRTKPAVTKKIEEGDTPITPDVCAAALESGLKKGYYQ ITDNLVTEPIRLRSNGGVPTNNFLL ; _struct_ref.pdbx_align_begin 29 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8JAT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 266 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0CR36 _struct_ref_seq.db_align_beg 29 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 293 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 29 _struct_ref_seq.pdbx_auth_seq_align_end 293 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8JAT MET A 1 ? UNP P0CR36 ? ? 'initiating methionine' 28 1 1 8JAT PHE A 163 ? UNP P0CR36 TYR 190 'engineered mutation' 190 2 1 8JAT SER A 267 ? UNP P0CR36 ? ? 'expression tag' 294 3 1 8JAT GLY A 268 ? UNP P0CR36 ? ? 'expression tag' 295 4 1 8JAT SER A 269 ? UNP P0CR36 ? ? 'expression tag' 296 5 1 8JAT HIS A 270 ? UNP P0CR36 ? ? 'expression tag' 297 6 1 8JAT HIS A 271 ? UNP P0CR36 ? ? 'expression tag' 298 7 1 8JAT HIS A 272 ? UNP P0CR36 ? ? 'expression tag' 299 8 1 8JAT HIS A 273 ? UNP P0CR36 ? ? 'expression tag' 300 9 1 8JAT HIS A 274 ? UNP P0CR36 ? ? 'expression tag' 301 10 1 8JAT HIS A 275 ? UNP P0CR36 ? ? 'expression tag' 302 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4850 ? 1 MORE -20 ? 1 'SSA (A^2)' 16750 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 9_554 -x,-x+y,-z-1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -26.7996666667 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 18 ? GLY A 32 ? SER A 45 GLY A 59 1 ? 15 HELX_P HELX_P2 AA2 ASP A 41 ? ALA A 56 ? ASP A 68 ALA A 83 1 ? 16 HELX_P HELX_P3 AA3 SER A 71 ? ALA A 82 ? SER A 98 ALA A 109 1 ? 12 HELX_P HELX_P4 AA4 THR A 110 ? TYR A 122 ? THR A 137 TYR A 149 1 ? 13 HELX_P HELX_P5 AA5 TYR A 122 ? ARG A 140 ? TYR A 149 ARG A 167 1 ? 19 HELX_P HELX_P6 AA6 PHE A 163 ? MET A 181 ? PHE A 190 MET A 208 1 ? 19 HELX_P HELX_P7 AA7 THR A 223 ? LYS A 237 ? THR A 250 LYS A 264 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 64 ? ALA A 66 ? CYS A 91 ALA A 93 AA1 2 HIS A 34 ? GLY A 39 ? HIS A 61 GLY A 66 AA1 3 HIS A 10 ? THR A 14 ? HIS A 37 THR A 41 AA1 4 TYR A 93 ? LEU A 96 ? TYR A 120 LEU A 123 AA1 5 LYS A 144 ? VAL A 148 ? LYS A 171 VAL A 175 AA1 6 ASP A 187 ? PHE A 191 ? ASP A 214 PHE A 218 AA1 7 GLN A 241 ? ILE A 242 ? GLN A 268 ILE A 269 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 65 ? O ILE A 92 N GLY A 39 ? N GLY A 66 AA1 2 3 O HIS A 34 ? O HIS A 61 N CYS A 11 ? N CYS A 38 AA1 3 4 N THR A 14 ? N THR A 41 O TYR A 95 ? O TYR A 122 AA1 4 5 N VAL A 94 ? N VAL A 121 O ILE A 146 ? O ILE A 173 AA1 5 6 N ILE A 145 ? N ILE A 172 O HIS A 189 ? O HIS A 216 AA1 6 7 N ILE A 190 ? N ILE A 217 O ILE A 242 ? O ILE A 269 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 PRO _pdbx_validate_symm_contact.auth_seq_id_1 85 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 PRO _pdbx_validate_symm_contact.auth_seq_id_2 85 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 11_555 _pdbx_validate_symm_contact.dist 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 57 ? ? -34.56 -34.62 2 1 PRO A 85 ? ? -39.31 149.01 3 1 HIS A 113 ? ? -90.04 34.64 4 1 ASP A 115 ? ? 62.29 -9.85 5 1 GLN A 116 ? ? -39.67 116.62 6 1 ALA A 117 ? ? -44.32 157.86 7 1 ASP A 119 ? ? -95.21 -68.58 8 1 ARG A 129 ? ? -119.32 65.62 9 1 TYR A 149 ? ? -79.93 -74.71 10 1 GLN A 161 ? ? -32.57 -34.54 11 1 THR A 169 ? ? -106.28 -140.31 12 1 ALA A 176 ? ? -125.29 -127.88 13 1 SER A 188 ? ? -85.32 -104.20 14 1 SER A 206 ? ? -65.70 -93.80 15 1 GLU A 207 ? ? -29.48 -58.18 16 1 THR A 250 ? ? -39.36 132.22 17 1 VAL A 253 ? ? -52.24 -77.52 18 1 SER A 260 ? ? -50.30 -78.36 19 1 THR A 270 ? ? -116.10 -157.07 # _pdbx_entry_details.entry_id 8JAT _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 28 ? A MET 1 2 1 Y 1 A SER 29 ? A SER 2 3 1 Y 1 A ASN 30 ? A ASN 3 4 1 Y 1 A PHE 178 ? A PHE 151 5 1 Y 1 A LEU 179 ? A LEU 152 6 1 Y 1 A SER 180 ? A SER 153 7 1 Y 1 A TYR 181 ? A TYR 154 8 1 Y 1 A VAL 182 ? A VAL 155 9 1 Y 1 A SER 183 ? A SER 156 10 1 Y 1 A PHE 184 ? A PHE 157 11 1 Y 1 A ALA 185 ? A ALA 158 12 1 Y 1 A GLY 186 ? A GLY 159 13 1 Y 1 A CYS 221 ? A CYS 194 14 1 Y 1 A GLY 222 ? A GLY 195 15 1 Y 1 A ILE 223 ? A ILE 196 16 1 Y 1 A SER 224 ? A SER 197 17 1 Y 1 A GLY 225 ? A GLY 198 18 1 Y 1 A PRO 226 ? A PRO 199 19 1 Y 1 A GLY 227 ? A GLY 200 20 1 Y 1 A PHE 228 ? A PHE 201 21 1 Y 1 A ASP 229 ? A ASP 202 22 1 Y 1 A ALA 230 ? A ALA 203 23 1 Y 1 A GLU 231 ? A GLU 204 24 1 Y 1 A ASN 232 ? A ASN 205 25 1 Y 1 A ARG 233 ? A ARG 206 26 1 Y 1 A THR 234 ? A THR 207 27 1 Y 1 A LYS 235 ? A LYS 208 28 1 Y 1 A PRO 236 ? A PRO 209 29 1 Y 1 A ALA 237 ? A ALA 210 30 1 Y 1 A VAL 238 ? A VAL 211 31 1 Y 1 A THR 239 ? A THR 212 32 1 Y 1 A LYS 240 ? A LYS 213 33 1 Y 1 A LYS 241 ? A LYS 214 34 1 Y 1 A ILE 242 ? A ILE 215 35 1 Y 1 A GLU 243 ? A GLU 216 36 1 Y 1 A GLU 244 ? A GLU 217 37 1 Y 1 A GLY 245 ? A GLY 218 38 1 Y 1 A ASP 246 ? A ASP 219 39 1 Y 1 A THR 247 ? A THR 220 40 1 Y 1 A PRO 248 ? A PRO 221 41 1 Y 1 A ASN 272 ? A ASN 245 42 1 Y 1 A LEU 273 ? A LEU 246 43 1 Y 1 A VAL 274 ? A VAL 247 44 1 Y 1 A THR 275 ? A THR 248 45 1 Y 1 A GLU 276 ? A GLU 249 46 1 Y 1 A PRO 277 ? A PRO 250 47 1 Y 1 A ILE 278 ? A ILE 251 48 1 Y 1 A ARG 279 ? A ARG 252 49 1 Y 1 A LEU 280 ? A LEU 253 50 1 Y 1 A ARG 281 ? A ARG 254 51 1 Y 1 A SER 282 ? A SER 255 52 1 Y 1 A ASN 283 ? A ASN 256 53 1 Y 1 A GLY 284 ? A GLY 257 54 1 Y 1 A GLY 285 ? A GLY 258 55 1 Y 1 A VAL 286 ? A VAL 259 56 1 Y 1 A PRO 287 ? A PRO 260 57 1 Y 1 A THR 288 ? A THR 261 58 1 Y 1 A ASN 289 ? A ASN 262 59 1 Y 1 A ASN 290 ? A ASN 263 60 1 Y 1 A PHE 291 ? A PHE 264 61 1 Y 1 A LEU 292 ? A LEU 265 62 1 Y 1 A LEU 293 ? A LEU 266 63 1 Y 1 A SER 294 ? A SER 267 64 1 Y 1 A GLY 295 ? A GLY 268 65 1 Y 1 A SER 296 ? A SER 269 66 1 Y 1 A HIS 297 ? A HIS 270 67 1 Y 1 A HIS 298 ? A HIS 271 68 1 Y 1 A HIS 299 ? A HIS 272 69 1 Y 1 A HIS 300 ? A HIS 273 70 1 Y 1 A HIS 301 ? A HIS 274 71 1 Y 1 A HIS 302 ? A HIS 275 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NDP PA P N S 250 NDP O1A O N N 251 NDP O2A O N N 252 NDP O5B O N N 253 NDP C5B C N N 254 NDP C4B C N R 255 NDP O4B O N N 256 NDP C3B C N R 257 NDP O3B O N N 258 NDP C2B C N R 259 NDP O2B O N N 260 NDP C1B C N R 261 NDP N9A N Y N 262 NDP C8A C Y N 263 NDP N7A N Y N 264 NDP C5A C Y N 265 NDP C6A C Y N 266 NDP N6A N N N 267 NDP N1A N Y N 268 NDP C2A C Y N 269 NDP N3A N Y N 270 NDP C4A C Y N 271 NDP O3 O N N 272 NDP PN P N S 273 NDP O1N O N N 274 NDP O2N O N N 275 NDP O5D O N N 276 NDP C5D C N N 277 NDP C4D C N R 278 NDP O4D O N N 279 NDP C3D C N S 280 NDP O3D O N N 281 NDP C2D C N R 282 NDP O2D O N N 283 NDP C1D C N R 284 NDP N1N N N N 285 NDP C2N C N N 286 NDP C3N C N N 287 NDP C7N C N N 288 NDP O7N O N N 289 NDP N7N N N N 290 NDP C4N C N N 291 NDP C5N C N N 292 NDP C6N C N N 293 NDP P2B P N N 294 NDP O1X O N N 295 NDP O2X O N N 296 NDP O3X O N N 297 NDP HOA2 H N N 298 NDP H51A H N N 299 NDP H52A H N N 300 NDP H4B H N N 301 NDP H3B H N N 302 NDP HO3A H N N 303 NDP H2B H N N 304 NDP H1B H N N 305 NDP H8A H N N 306 NDP H61A H N N 307 NDP H62A H N N 308 NDP H2A H N N 309 NDP H21N H N N 310 NDP H51N H N N 311 NDP H52N H N N 312 NDP H4D H N N 313 NDP H3D H N N 314 NDP HO3N H N N 315 NDP H2D H N N 316 NDP HO2N H N N 317 NDP H1D H N N 318 NDP H2N H N N 319 NDP H71N H N N 320 NDP H72N H N N 321 NDP H41N H N N 322 NDP H42N H N N 323 NDP H5N H N N 324 NDP H6N H N N 325 NDP HOP2 H N N 326 NDP HOP3 H N N 327 PHE N N N N 328 PHE CA C N S 329 PHE C C N N 330 PHE O O N N 331 PHE CB C N N 332 PHE CG C Y N 333 PHE CD1 C Y N 334 PHE CD2 C Y N 335 PHE CE1 C Y N 336 PHE CE2 C Y N 337 PHE CZ C Y N 338 PHE OXT O N N 339 PHE H H N N 340 PHE H2 H N N 341 PHE HA H N N 342 PHE HB2 H N N 343 PHE HB3 H N N 344 PHE HD1 H N N 345 PHE HD2 H N N 346 PHE HE1 H N N 347 PHE HE2 H N N 348 PHE HZ H N N 349 PHE HXT H N N 350 PRO N N N N 351 PRO CA C N S 352 PRO C C N N 353 PRO O O N N 354 PRO CB C N N 355 PRO CG C N N 356 PRO CD C N N 357 PRO OXT O N N 358 PRO H H N N 359 PRO HA H N N 360 PRO HB2 H N N 361 PRO HB3 H N N 362 PRO HG2 H N N 363 PRO HG3 H N N 364 PRO HD2 H N N 365 PRO HD3 H N N 366 PRO HXT H N N 367 SER N N N N 368 SER CA C N S 369 SER C C N N 370 SER O O N N 371 SER CB C N N 372 SER OG O N N 373 SER OXT O N N 374 SER H H N N 375 SER H2 H N N 376 SER HA H N N 377 SER HB2 H N N 378 SER HB3 H N N 379 SER HG H N N 380 SER HXT H N N 381 THR N N N N 382 THR CA C N S 383 THR C C N N 384 THR O O N N 385 THR CB C N R 386 THR OG1 O N N 387 THR CG2 C N N 388 THR OXT O N N 389 THR H H N N 390 THR H2 H N N 391 THR HA H N N 392 THR HB H N N 393 THR HG1 H N N 394 THR HG21 H N N 395 THR HG22 H N N 396 THR HG23 H N N 397 THR HXT H N N 398 TRP N N N N 399 TRP CA C N S 400 TRP C C N N 401 TRP O O N N 402 TRP CB C N N 403 TRP CG C Y N 404 TRP CD1 C Y N 405 TRP CD2 C Y N 406 TRP NE1 N Y N 407 TRP CE2 C Y N 408 TRP CE3 C Y N 409 TRP CZ2 C Y N 410 TRP CZ3 C Y N 411 TRP CH2 C Y N 412 TRP OXT O N N 413 TRP H H N N 414 TRP H2 H N N 415 TRP HA H N N 416 TRP HB2 H N N 417 TRP HB3 H N N 418 TRP HD1 H N N 419 TRP HE1 H N N 420 TRP HE3 H N N 421 TRP HZ2 H N N 422 TRP HZ3 H N N 423 TRP HH2 H N N 424 TRP HXT H N N 425 TYR N N N N 426 TYR CA C N S 427 TYR C C N N 428 TYR O O N N 429 TYR CB C N N 430 TYR CG C Y N 431 TYR CD1 C Y N 432 TYR CD2 C Y N 433 TYR CE1 C Y N 434 TYR CE2 C Y N 435 TYR CZ C Y N 436 TYR OH O N N 437 TYR OXT O N N 438 TYR H H N N 439 TYR H2 H N N 440 TYR HA H N N 441 TYR HB2 H N N 442 TYR HB3 H N N 443 TYR HD1 H N N 444 TYR HD2 H N N 445 TYR HE1 H N N 446 TYR HE2 H N N 447 TYR HH H N N 448 TYR HXT H N N 449 VAL N N N N 450 VAL CA C N S 451 VAL C C N N 452 VAL O O N N 453 VAL CB C N N 454 VAL CG1 C N N 455 VAL CG2 C N N 456 VAL OXT O N N 457 VAL H H N N 458 VAL H2 H N N 459 VAL HA H N N 460 VAL HB H N N 461 VAL HG11 H N N 462 VAL HG12 H N N 463 VAL HG13 H N N 464 VAL HG21 H N N 465 VAL HG22 H N N 466 VAL HG23 H N N 467 VAL HXT H N N 468 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 NDP PA O1A doub N N 237 NDP PA O2A sing N N 238 NDP PA O5B sing N N 239 NDP PA O3 sing N N 240 NDP O2A HOA2 sing N N 241 NDP O5B C5B sing N N 242 NDP C5B C4B sing N N 243 NDP C5B H51A sing N N 244 NDP C5B H52A sing N N 245 NDP C4B O4B sing N N 246 NDP C4B C3B sing N N 247 NDP C4B H4B sing N N 248 NDP O4B C1B sing N N 249 NDP C3B O3B sing N N 250 NDP C3B C2B sing N N 251 NDP C3B H3B sing N N 252 NDP O3B HO3A sing N N 253 NDP C2B O2B sing N N 254 NDP C2B C1B sing N N 255 NDP C2B H2B sing N N 256 NDP O2B P2B sing N N 257 NDP C1B N9A sing N N 258 NDP C1B H1B sing N N 259 NDP N9A C8A sing Y N 260 NDP N9A C4A sing Y N 261 NDP C8A N7A doub Y N 262 NDP C8A H8A sing N N 263 NDP N7A C5A sing Y N 264 NDP C5A C6A sing Y N 265 NDP C5A C4A doub Y N 266 NDP C6A N6A sing N N 267 NDP C6A N1A doub Y N 268 NDP N6A H61A sing N N 269 NDP N6A H62A sing N N 270 NDP N1A C2A sing Y N 271 NDP C2A N3A doub Y N 272 NDP C2A H2A sing N N 273 NDP N3A C4A sing Y N 274 NDP O3 PN sing N N 275 NDP PN O1N doub N N 276 NDP PN O2N sing N N 277 NDP PN O5D sing N N 278 NDP O2N H21N sing N N 279 NDP O5D C5D sing N N 280 NDP C5D C4D sing N N 281 NDP C5D H51N sing N N 282 NDP C5D H52N sing N N 283 NDP C4D O4D sing N N 284 NDP C4D C3D sing N N 285 NDP C4D H4D sing N N 286 NDP O4D C1D sing N N 287 NDP C3D O3D sing N N 288 NDP C3D C2D sing N N 289 NDP C3D H3D sing N N 290 NDP O3D HO3N sing N N 291 NDP C2D O2D sing N N 292 NDP C2D C1D sing N N 293 NDP C2D H2D sing N N 294 NDP O2D HO2N sing N N 295 NDP C1D N1N sing N N 296 NDP C1D H1D sing N N 297 NDP N1N C2N sing N N 298 NDP N1N C6N sing N N 299 NDP C2N C3N doub N N 300 NDP C2N H2N sing N N 301 NDP C3N C7N sing N N 302 NDP C3N C4N sing N N 303 NDP C7N O7N doub N N 304 NDP C7N N7N sing N N 305 NDP N7N H71N sing N N 306 NDP N7N H72N sing N N 307 NDP C4N C5N sing N N 308 NDP C4N H41N sing N N 309 NDP C4N H42N sing N N 310 NDP C5N C6N doub N N 311 NDP C5N H5N sing N N 312 NDP C6N H6N sing N N 313 NDP P2B O1X doub N N 314 NDP P2B O2X sing N N 315 NDP P2B O3X sing N N 316 NDP O2X HOP2 sing N N 317 NDP O3X HOP3 sing N N 318 PHE N CA sing N N 319 PHE N H sing N N 320 PHE N H2 sing N N 321 PHE CA C sing N N 322 PHE CA CB sing N N 323 PHE CA HA sing N N 324 PHE C O doub N N 325 PHE C OXT sing N N 326 PHE CB CG sing N N 327 PHE CB HB2 sing N N 328 PHE CB HB3 sing N N 329 PHE CG CD1 doub Y N 330 PHE CG CD2 sing Y N 331 PHE CD1 CE1 sing Y N 332 PHE CD1 HD1 sing N N 333 PHE CD2 CE2 doub Y N 334 PHE CD2 HD2 sing N N 335 PHE CE1 CZ doub Y N 336 PHE CE1 HE1 sing N N 337 PHE CE2 CZ sing Y N 338 PHE CE2 HE2 sing N N 339 PHE CZ HZ sing N N 340 PHE OXT HXT sing N N 341 PRO N CA sing N N 342 PRO N CD sing N N 343 PRO N H sing N N 344 PRO CA C sing N N 345 PRO CA CB sing N N 346 PRO CA HA sing N N 347 PRO C O doub N N 348 PRO C OXT sing N N 349 PRO CB CG sing N N 350 PRO CB HB2 sing N N 351 PRO CB HB3 sing N N 352 PRO CG CD sing N N 353 PRO CG HG2 sing N N 354 PRO CG HG3 sing N N 355 PRO CD HD2 sing N N 356 PRO CD HD3 sing N N 357 PRO OXT HXT sing N N 358 SER N CA sing N N 359 SER N H sing N N 360 SER N H2 sing N N 361 SER CA C sing N N 362 SER CA CB sing N N 363 SER CA HA sing N N 364 SER C O doub N N 365 SER C OXT sing N N 366 SER CB OG sing N N 367 SER CB HB2 sing N N 368 SER CB HB3 sing N N 369 SER OG HG sing N N 370 SER OXT HXT sing N N 371 THR N CA sing N N 372 THR N H sing N N 373 THR N H2 sing N N 374 THR CA C sing N N 375 THR CA CB sing N N 376 THR CA HA sing N N 377 THR C O doub N N 378 THR C OXT sing N N 379 THR CB OG1 sing N N 380 THR CB CG2 sing N N 381 THR CB HB sing N N 382 THR OG1 HG1 sing N N 383 THR CG2 HG21 sing N N 384 THR CG2 HG22 sing N N 385 THR CG2 HG23 sing N N 386 THR OXT HXT sing N N 387 TRP N CA sing N N 388 TRP N H sing N N 389 TRP N H2 sing N N 390 TRP CA C sing N N 391 TRP CA CB sing N N 392 TRP CA HA sing N N 393 TRP C O doub N N 394 TRP C OXT sing N N 395 TRP CB CG sing N N 396 TRP CB HB2 sing N N 397 TRP CB HB3 sing N N 398 TRP CG CD1 doub Y N 399 TRP CG CD2 sing Y N 400 TRP CD1 NE1 sing Y N 401 TRP CD1 HD1 sing N N 402 TRP CD2 CE2 doub Y N 403 TRP CD2 CE3 sing Y N 404 TRP NE1 CE2 sing Y N 405 TRP NE1 HE1 sing N N 406 TRP CE2 CZ2 sing Y N 407 TRP CE3 CZ3 doub Y N 408 TRP CE3 HE3 sing N N 409 TRP CZ2 CH2 doub Y N 410 TRP CZ2 HZ2 sing N N 411 TRP CZ3 CH2 sing Y N 412 TRP CZ3 HZ3 sing N N 413 TRP CH2 HH2 sing N N 414 TRP OXT HXT sing N N 415 TYR N CA sing N N 416 TYR N H sing N N 417 TYR N H2 sing N N 418 TYR CA C sing N N 419 TYR CA CB sing N N 420 TYR CA HA sing N N 421 TYR C O doub N N 422 TYR C OXT sing N N 423 TYR CB CG sing N N 424 TYR CB HB2 sing N N 425 TYR CB HB3 sing N N 426 TYR CG CD1 doub Y N 427 TYR CG CD2 sing Y N 428 TYR CD1 CE1 sing Y N 429 TYR CD1 HD1 sing N N 430 TYR CD2 CE2 doub Y N 431 TYR CD2 HD2 sing N N 432 TYR CE1 CZ doub Y N 433 TYR CE1 HE1 sing N N 434 TYR CE2 CZ sing Y N 435 TYR CE2 HE2 sing N N 436 TYR CZ OH sing N N 437 TYR OH HH sing N N 438 TYR OXT HXT sing N N 439 VAL N CA sing N N 440 VAL N H sing N N 441 VAL N H2 sing N N 442 VAL CA C sing N N 443 VAL CA CB sing N N 444 VAL CA HA sing N N 445 VAL C O doub N N 446 VAL C OXT sing N N 447 VAL CB CG1 sing N N 448 VAL CB CG2 sing N N 449 VAL CB HB sing N N 450 VAL CG1 HG11 sing N N 451 VAL CG1 HG12 sing N N 452 VAL CG1 HG13 sing N N 453 VAL CG2 HG21 sing N N 454 VAL CG2 HG22 sing N N 455 VAL CG2 HG23 sing N N 456 VAL OXT HXT sing N N 457 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 81571539 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NDP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NDP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8JAT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008984 _atom_sites.fract_transf_matrix[1][2] 0.005187 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010374 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012438 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_