data_8JSJ # _entry.id 8JSJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8JSJ pdb_00008jsj 10.2210/pdb8jsj/pdb WWPDB D_1300038779 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-07-03 2 'Structure model' 1 1 2024-07-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' entity # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_entity.details' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8JSJ _pdbx_database_status.recvd_initial_deposition_date 2023-06-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 8JSF _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email chyeah6599@nchu.edu.tw _pdbx_contact_author.name_first Yeh _pdbx_contact_author.name_last Chen _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7740-0446 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, Y.-C.' 1 ? 'Yang, C.-S.' 2 ? 'Hou, M.-H.' 3 ? 'Chen, Y.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first 5634 _citation.page_last 5634 _citation.title 'Structural and functional characterization of cyclic pyrimidine-regulated anti-phage system.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-024-49861-2 _citation.pdbx_database_id_PubMed 38965224 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hou, M.H.' 1 ? primary 'Chen, C.J.' 2 0000-0003-3834-9243 primary 'Yang, C.S.' 3 ? primary 'Wang, Y.C.' 4 0000-0003-2726-9731 primary 'Chen, Y.' 5 0000-0002-7740-0446 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man PycTIR 34018.613 1 ? ? ? 'NCBI: WP_081473994.1' 2 water nat water 18.015 50 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGALLDRFSGDEKKGRLIEAVCGQDLVANDKDLAEQIVAAGVLQEIADGDVIIKQGDWDDDLFLILAGKMQITINGRPQT VREAGTHVGELTGTSPARPRTATVSAIGEALVLRLKRTVLDEITRDSPAYLKRMLDVVAGRLDERNKGIGQTNDIPRIFV ISSSEKIGVANEIVRNLDSKEIAVQLWDKGTFGISDYPISSLMDAIESSDFTIAVVGADDTLTMRGETHQVARDNVHLEF GISLGVLGRRRSMLLVCADDGVRLPSDAAGLTTLRYRTGSDDEMKRTVRNACIEAKEHIEKEGVFTDRRAR ; _entity_poly.pdbx_seq_one_letter_code_can ;MGALLDRFSGDEKKGRLIEAVCGQDLVANDKDLAEQIVAAGVLQEIADGDVIIKQGDWDDDLFLILAGKMQITINGRPQT VREAGTHVGELTGTSPARPRTATVSAIGEALVLRLKRTVLDEITRDSPAYLKRMLDVVAGRLDERNKGIGQTNDIPRIFV ISSSEKIGVANEIVRNLDSKEIAVQLWDKGTFGISDYPISSLMDAIESSDFTIAVVGADDTLTMRGETHQVARDNVHLEF GISLGVLGRRRSMLLVCADDGVRLPSDAAGLTTLRYRTGSDDEMKRTVRNACIEAKEHIEKEGVFTDRRAR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ALA n 1 4 LEU n 1 5 LEU n 1 6 ASP n 1 7 ARG n 1 8 PHE n 1 9 SER n 1 10 GLY n 1 11 ASP n 1 12 GLU n 1 13 LYS n 1 14 LYS n 1 15 GLY n 1 16 ARG n 1 17 LEU n 1 18 ILE n 1 19 GLU n 1 20 ALA n 1 21 VAL n 1 22 CYS n 1 23 GLY n 1 24 GLN n 1 25 ASP n 1 26 LEU n 1 27 VAL n 1 28 ALA n 1 29 ASN n 1 30 ASP n 1 31 LYS n 1 32 ASP n 1 33 LEU n 1 34 ALA n 1 35 GLU n 1 36 GLN n 1 37 ILE n 1 38 VAL n 1 39 ALA n 1 40 ALA n 1 41 GLY n 1 42 VAL n 1 43 LEU n 1 44 GLN n 1 45 GLU n 1 46 ILE n 1 47 ALA n 1 48 ASP n 1 49 GLY n 1 50 ASP n 1 51 VAL n 1 52 ILE n 1 53 ILE n 1 54 LYS n 1 55 GLN n 1 56 GLY n 1 57 ASP n 1 58 TRP n 1 59 ASP n 1 60 ASP n 1 61 ASP n 1 62 LEU n 1 63 PHE n 1 64 LEU n 1 65 ILE n 1 66 LEU n 1 67 ALA n 1 68 GLY n 1 69 LYS n 1 70 MET n 1 71 GLN n 1 72 ILE n 1 73 THR n 1 74 ILE n 1 75 ASN n 1 76 GLY n 1 77 ARG n 1 78 PRO n 1 79 GLN n 1 80 THR n 1 81 VAL n 1 82 ARG n 1 83 GLU n 1 84 ALA n 1 85 GLY n 1 86 THR n 1 87 HIS n 1 88 VAL n 1 89 GLY n 1 90 GLU n 1 91 LEU n 1 92 THR n 1 93 GLY n 1 94 THR n 1 95 SER n 1 96 PRO n 1 97 ALA n 1 98 ARG n 1 99 PRO n 1 100 ARG n 1 101 THR n 1 102 ALA n 1 103 THR n 1 104 VAL n 1 105 SER n 1 106 ALA n 1 107 ILE n 1 108 GLY n 1 109 GLU n 1 110 ALA n 1 111 LEU n 1 112 VAL n 1 113 LEU n 1 114 ARG n 1 115 LEU n 1 116 LYS n 1 117 ARG n 1 118 THR n 1 119 VAL n 1 120 LEU n 1 121 ASP n 1 122 GLU n 1 123 ILE n 1 124 THR n 1 125 ARG n 1 126 ASP n 1 127 SER n 1 128 PRO n 1 129 ALA n 1 130 TYR n 1 131 LEU n 1 132 LYS n 1 133 ARG n 1 134 MET n 1 135 LEU n 1 136 ASP n 1 137 VAL n 1 138 VAL n 1 139 ALA n 1 140 GLY n 1 141 ARG n 1 142 LEU n 1 143 ASP n 1 144 GLU n 1 145 ARG n 1 146 ASN n 1 147 LYS n 1 148 GLY n 1 149 ILE n 1 150 GLY n 1 151 GLN n 1 152 THR n 1 153 ASN n 1 154 ASP n 1 155 ILE n 1 156 PRO n 1 157 ARG n 1 158 ILE n 1 159 PHE n 1 160 VAL n 1 161 ILE n 1 162 SER n 1 163 SER n 1 164 SER n 1 165 GLU n 1 166 LYS n 1 167 ILE n 1 168 GLY n 1 169 VAL n 1 170 ALA n 1 171 ASN n 1 172 GLU n 1 173 ILE n 1 174 VAL n 1 175 ARG n 1 176 ASN n 1 177 LEU n 1 178 ASP n 1 179 SER n 1 180 LYS n 1 181 GLU n 1 182 ILE n 1 183 ALA n 1 184 VAL n 1 185 GLN n 1 186 LEU n 1 187 TRP n 1 188 ASP n 1 189 LYS n 1 190 GLY n 1 191 THR n 1 192 PHE n 1 193 GLY n 1 194 ILE n 1 195 SER n 1 196 ASP n 1 197 TYR n 1 198 PRO n 1 199 ILE n 1 200 SER n 1 201 SER n 1 202 LEU n 1 203 MET n 1 204 ASP n 1 205 ALA n 1 206 ILE n 1 207 GLU n 1 208 SER n 1 209 SER n 1 210 ASP n 1 211 PHE n 1 212 THR n 1 213 ILE n 1 214 ALA n 1 215 VAL n 1 216 VAL n 1 217 GLY n 1 218 ALA n 1 219 ASP n 1 220 ASP n 1 221 THR n 1 222 LEU n 1 223 THR n 1 224 MET n 1 225 ARG n 1 226 GLY n 1 227 GLU n 1 228 THR n 1 229 HIS n 1 230 GLN n 1 231 VAL n 1 232 ALA n 1 233 ARG n 1 234 ASP n 1 235 ASN n 1 236 VAL n 1 237 HIS n 1 238 LEU n 1 239 GLU n 1 240 PHE n 1 241 GLY n 1 242 ILE n 1 243 SER n 1 244 LEU n 1 245 GLY n 1 246 VAL n 1 247 LEU n 1 248 GLY n 1 249 ARG n 1 250 ARG n 1 251 ARG n 1 252 SER n 1 253 MET n 1 254 LEU n 1 255 LEU n 1 256 VAL n 1 257 CYS n 1 258 ALA n 1 259 ASP n 1 260 ASP n 1 261 GLY n 1 262 VAL n 1 263 ARG n 1 264 LEU n 1 265 PRO n 1 266 SER n 1 267 ASP n 1 268 ALA n 1 269 ALA n 1 270 GLY n 1 271 LEU n 1 272 THR n 1 273 THR n 1 274 LEU n 1 275 ARG n 1 276 TYR n 1 277 ARG n 1 278 THR n 1 279 GLY n 1 280 SER n 1 281 ASP n 1 282 ASP n 1 283 GLU n 1 284 MET n 1 285 LYS n 1 286 ARG n 1 287 THR n 1 288 VAL n 1 289 ARG n 1 290 ASN n 1 291 ALA n 1 292 CYS n 1 293 ILE n 1 294 GLU n 1 295 ALA n 1 296 LYS n 1 297 GLU n 1 298 HIS n 1 299 ILE n 1 300 GLU n 1 301 LYS n 1 302 GLU n 1 303 GLY n 1 304 VAL n 1 305 PHE n 1 306 THR n 1 307 ASP n 1 308 ARG n 1 309 ARG n 1 310 ALA n 1 311 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 311 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Novosphingobium pentaromativorans US6-1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1088721 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 THR 92 92 ? ? ? A . n A 1 93 GLY 93 93 ? ? ? A . n A 1 94 THR 94 94 ? ? ? A . n A 1 95 SER 95 95 ? ? ? A . n A 1 96 PRO 96 96 ? ? ? A . n A 1 97 ALA 97 97 ? ? ? A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ARG 141 141 ? ? ? A . n A 1 142 LEU 142 142 ? ? ? A . n A 1 143 ASP 143 143 ? ? ? A . n A 1 144 GLU 144 144 ? ? ? A . n A 1 145 ARG 145 145 ? ? ? A . n A 1 146 ASN 146 146 ? ? ? A . n A 1 147 LYS 147 147 ? ? ? A . n A 1 148 GLY 148 148 ? ? ? A . n A 1 149 ILE 149 149 ? ? ? A . n A 1 150 GLY 150 150 ? ? ? A . n A 1 151 GLN 151 151 ? ? ? A . n A 1 152 THR 152 152 ? ? ? A . n A 1 153 ASN 153 153 ? ? ? A . n A 1 154 ASP 154 154 ? ? ? A . n A 1 155 ILE 155 155 ? ? ? A . n A 1 156 PRO 156 156 ? ? ? A . n A 1 157 ARG 157 157 ? ? ? A . n A 1 158 ILE 158 158 ? ? ? A . n A 1 159 PHE 159 159 ? ? ? A . n A 1 160 VAL 160 160 ? ? ? A . n A 1 161 ILE 161 161 ? ? ? A . n A 1 162 SER 162 162 ? ? ? A . n A 1 163 SER 163 163 ? ? ? A . n A 1 164 SER 164 164 ? ? ? A . n A 1 165 GLU 165 165 ? ? ? A . n A 1 166 LYS 166 166 ? ? ? A . n A 1 167 ILE 167 167 ? ? ? A . n A 1 168 GLY 168 168 ? ? ? A . n A 1 169 VAL 169 169 ? ? ? A . n A 1 170 ALA 170 170 ? ? ? A . n A 1 171 ASN 171 171 ? ? ? A . n A 1 172 GLU 172 172 ? ? ? A . n A 1 173 ILE 173 173 ? ? ? A . n A 1 174 VAL 174 174 ? ? ? A . n A 1 175 ARG 175 175 ? ? ? A . n A 1 176 ASN 176 176 ? ? ? A . n A 1 177 LEU 177 177 ? ? ? A . n A 1 178 ASP 178 178 ? ? ? A . n A 1 179 SER 179 179 ? ? ? A . n A 1 180 LYS 180 180 ? ? ? A . n A 1 181 GLU 181 181 ? ? ? A . n A 1 182 ILE 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 VAL 184 184 ? ? ? A . n A 1 185 GLN 185 185 ? ? ? A . n A 1 186 LEU 186 186 ? ? ? A . n A 1 187 TRP 187 187 ? ? ? A . n A 1 188 ASP 188 188 ? ? ? A . n A 1 189 LYS 189 189 ? ? ? A . n A 1 190 GLY 190 190 ? ? ? A . n A 1 191 THR 191 191 ? ? ? A . n A 1 192 PHE 192 192 ? ? ? A . n A 1 193 GLY 193 193 ? ? ? A . n A 1 194 ILE 194 194 ? ? ? A . n A 1 195 SER 195 195 ? ? ? A . n A 1 196 ASP 196 196 ? ? ? A . n A 1 197 TYR 197 197 ? ? ? A . n A 1 198 PRO 198 198 ? ? ? A . n A 1 199 ILE 199 199 ? ? ? A . n A 1 200 SER 200 200 ? ? ? A . n A 1 201 SER 201 201 ? ? ? A . n A 1 202 LEU 202 202 ? ? ? A . n A 1 203 MET 203 203 ? ? ? A . n A 1 204 ASP 204 204 ? ? ? A . n A 1 205 ALA 205 205 ? ? ? A . n A 1 206 ILE 206 206 ? ? ? A . n A 1 207 GLU 207 207 ? ? ? A . n A 1 208 SER 208 208 ? ? ? A . n A 1 209 SER 209 209 ? ? ? A . n A 1 210 ASP 210 210 ? ? ? A . n A 1 211 PHE 211 211 ? ? ? A . n A 1 212 THR 212 212 ? ? ? A . n A 1 213 ILE 213 213 ? ? ? A . n A 1 214 ALA 214 214 ? ? ? A . n A 1 215 VAL 215 215 ? ? ? A . n A 1 216 VAL 216 216 ? ? ? A . n A 1 217 GLY 217 217 ? ? ? A . n A 1 218 ALA 218 218 ? ? ? A . n A 1 219 ASP 219 219 ? ? ? A . n A 1 220 ASP 220 220 ? ? ? A . n A 1 221 THR 221 221 ? ? ? A . n A 1 222 LEU 222 222 ? ? ? A . n A 1 223 THR 223 223 ? ? ? A . n A 1 224 MET 224 224 ? ? ? A . n A 1 225 ARG 225 225 ? ? ? A . n A 1 226 GLY 226 226 ? ? ? A . n A 1 227 GLU 227 227 ? ? ? A . n A 1 228 THR 228 228 ? ? ? A . n A 1 229 HIS 229 229 ? ? ? A . n A 1 230 GLN 230 230 ? ? ? A . n A 1 231 VAL 231 231 ? ? ? A . n A 1 232 ALA 232 232 ? ? ? A . n A 1 233 ARG 233 233 ? ? ? A . n A 1 234 ASP 234 234 ? ? ? A . n A 1 235 ASN 235 235 ? ? ? A . n A 1 236 VAL 236 236 ? ? ? A . n A 1 237 HIS 237 237 ? ? ? A . n A 1 238 LEU 238 238 ? ? ? A . n A 1 239 GLU 239 239 ? ? ? A . n A 1 240 PHE 240 240 ? ? ? A . n A 1 241 GLY 241 241 ? ? ? A . n A 1 242 ILE 242 242 ? ? ? A . n A 1 243 SER 243 243 ? ? ? A . n A 1 244 LEU 244 244 ? ? ? A . n A 1 245 GLY 245 245 ? ? ? A . n A 1 246 VAL 246 246 ? ? ? A . n A 1 247 LEU 247 247 ? ? ? A . n A 1 248 GLY 248 248 ? ? ? A . n A 1 249 ARG 249 249 ? ? ? A . n A 1 250 ARG 250 250 ? ? ? A . n A 1 251 ARG 251 251 ? ? ? A . n A 1 252 SER 252 252 ? ? ? A . n A 1 253 MET 253 253 ? ? ? A . n A 1 254 LEU 254 254 ? ? ? A . n A 1 255 LEU 255 255 ? ? ? A . n A 1 256 VAL 256 256 ? ? ? A . n A 1 257 CYS 257 257 ? ? ? A . n A 1 258 ALA 258 258 ? ? ? A . n A 1 259 ASP 259 259 ? ? ? A . n A 1 260 ASP 260 260 ? ? ? A . n A 1 261 GLY 261 261 ? ? ? A . n A 1 262 VAL 262 262 ? ? ? A . n A 1 263 ARG 263 263 ? ? ? A . n A 1 264 LEU 264 264 ? ? ? A . n A 1 265 PRO 265 265 ? ? ? A . n A 1 266 SER 266 266 ? ? ? A . n A 1 267 ASP 267 267 ? ? ? A . n A 1 268 ALA 268 268 ? ? ? A . n A 1 269 ALA 269 269 ? ? ? A . n A 1 270 GLY 270 270 ? ? ? A . n A 1 271 LEU 271 271 ? ? ? A . n A 1 272 THR 272 272 ? ? ? A . n A 1 273 THR 273 273 ? ? ? A . n A 1 274 LEU 274 274 ? ? ? A . n A 1 275 ARG 275 275 ? ? ? A . n A 1 276 TYR 276 276 ? ? ? A . n A 1 277 ARG 277 277 ? ? ? A . n A 1 278 THR 278 278 ? ? ? A . n A 1 279 GLY 279 279 ? ? ? A . n A 1 280 SER 280 280 ? ? ? A . n A 1 281 ASP 281 281 ? ? ? A . n A 1 282 ASP 282 282 ? ? ? A . n A 1 283 GLU 283 283 ? ? ? A . n A 1 284 MET 284 284 ? ? ? A . n A 1 285 LYS 285 285 ? ? ? A . n A 1 286 ARG 286 286 ? ? ? A . n A 1 287 THR 287 287 ? ? ? A . n A 1 288 VAL 288 288 ? ? ? A . n A 1 289 ARG 289 289 ? ? ? A . n A 1 290 ASN 290 290 ? ? ? A . n A 1 291 ALA 291 291 ? ? ? A . n A 1 292 CYS 292 292 ? ? ? A . n A 1 293 ILE 293 293 ? ? ? A . n A 1 294 GLU 294 294 ? ? ? A . n A 1 295 ALA 295 295 ? ? ? A . n A 1 296 LYS 296 296 ? ? ? A . n A 1 297 GLU 297 297 ? ? ? A . n A 1 298 HIS 298 298 ? ? ? A . n A 1 299 ILE 299 299 ? ? ? A . n A 1 300 GLU 300 300 ? ? ? A . n A 1 301 LYS 301 301 ? ? ? A . n A 1 302 GLU 302 302 ? ? ? A . n A 1 303 GLY 303 303 ? ? ? A . n A 1 304 VAL 304 304 ? ? ? A . n A 1 305 PHE 305 305 ? ? ? A . n A 1 306 THR 306 306 ? ? ? A . n A 1 307 ASP 307 307 ? ? ? A . n A 1 308 ARG 308 308 ? ? ? A . n A 1 309 ARG 309 309 ? ? ? A . n A 1 310 ALA 310 310 ? ? ? A . n A 1 311 ARG 311 311 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 224 HOH HOH A . B 2 HOH 2 402 205 HOH HOH A . B 2 HOH 3 403 244 HOH HOH A . B 2 HOH 4 404 227 HOH HOH A . B 2 HOH 5 405 207 HOH HOH A . B 2 HOH 6 406 201 HOH HOH A . B 2 HOH 7 407 206 HOH HOH A . B 2 HOH 8 408 218 HOH HOH A . B 2 HOH 9 409 202 HOH HOH A . B 2 HOH 10 410 231 HOH HOH A . B 2 HOH 11 411 215 HOH HOH A . B 2 HOH 12 412 200 HOH HOH A . B 2 HOH 13 413 230 HOH HOH A . B 2 HOH 14 414 234 HOH HOH A . B 2 HOH 15 415 211 HOH HOH A . B 2 HOH 16 416 213 HOH HOH A . B 2 HOH 17 417 239 HOH HOH A . B 2 HOH 18 418 203 HOH HOH A . B 2 HOH 19 419 210 HOH HOH A . B 2 HOH 20 420 208 HOH HOH A . B 2 HOH 21 421 216 HOH HOH A . B 2 HOH 22 422 226 HOH HOH A . B 2 HOH 23 423 217 HOH HOH A . B 2 HOH 24 424 221 HOH HOH A . B 2 HOH 25 425 236 HOH HOH A . B 2 HOH 26 426 222 HOH HOH A . B 2 HOH 27 427 220 HOH HOH A . B 2 HOH 28 428 212 HOH HOH A . B 2 HOH 29 429 237 HOH HOH A . B 2 HOH 30 430 240 HOH HOH A . B 2 HOH 31 431 229 HOH HOH A . B 2 HOH 32 432 219 HOH HOH A . B 2 HOH 33 433 214 HOH HOH A . B 2 HOH 34 434 204 HOH HOH A . B 2 HOH 35 435 243 HOH HOH A . B 2 HOH 36 436 235 HOH HOH A . B 2 HOH 37 437 209 HOH HOH A . B 2 HOH 38 438 245 HOH HOH A . B 2 HOH 39 439 225 HOH HOH A . B 2 HOH 40 440 233 HOH HOH A . B 2 HOH 41 441 238 HOH HOH A . B 2 HOH 42 442 241 HOH HOH A . B 2 HOH 43 443 223 HOH HOH A . B 2 HOH 44 444 228 HOH HOH A . B 2 HOH 45 445 242 HOH HOH A . B 2 HOH 46 446 247 HOH HOH A . B 2 HOH 47 447 246 HOH HOH A . B 2 HOH 48 448 232 HOH HOH A . B 2 HOH 49 449 248 HOH HOH A . B 2 HOH 50 450 249 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8JSJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.115 _cell.length_a_esd ? _cell.length_b 87.115 _cell.length_b_esd ? _cell.length_c 93.349 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8JSJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8JSJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M ammonium acetate, 0.01 M calcium chloride dihydrate,0.05 M sodium cacodylate trihydrate pH 6.5,10% w/v polyethylene glycol 4,000 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-09-21 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97626 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSRRC BEAMLINE TPS 07A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97626 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'TPS 07A' _diffrn_source.pdbx_synchrotron_site NSRRC # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8JSJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.858 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5229 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 34.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 85.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.86 _reflns_shell.d_res_low 2.96 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 502 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.895 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.041 _refine.aniso_B[1][2] -0.021 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -0.041 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.134 _refine.B_iso_max ? _refine.B_iso_mean 53.472 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.893 _refine.correlation_coeff_Fo_to_Fc_free 0.864 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8JSJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.858 _refine.ls_d_res_low 24.345 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4901 _refine.ls_number_reflns_R_free 247 _refine.ls_number_reflns_R_work 4654 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.817 _refine.ls_percent_reflns_R_free 5.040 _refine.ls_R_factor_all 0.259 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2820 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2578 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model AlphaFold _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 1.273 _refine.pdbx_overall_ESU_R_Free 0.401 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 16.894 _refine.overall_SU_ML 0.293 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1017 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 1067 _refine_hist.d_res_high 2.858 _refine_hist.d_res_low 24.345 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 1024 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.017 1040 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.451 1.633 1380 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.135 1.594 2383 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.969 5.000 132 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.882 21.818 55 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 22.793 15.000 191 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.384 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.047 0.200 138 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1151 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 217 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.245 0.200 238 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.224 0.200 1028 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.156 0.200 471 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.085 0.200 542 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.204 0.200 31 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.065 0.200 2 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.282 0.200 14 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.246 0.200 44 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.208 0.200 3 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 4.218 5.291 534 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.208 5.283 532 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.882 7.907 664 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.890 7.908 664 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.801 6.149 489 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.798 6.152 490 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 7.749 8.899 714 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.743 8.903 715 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 12.706 63.892 1103 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 12.761 63.957 1102 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.858 2.932 . . 5 175 49.3151 . . . . 0.373 . . . . . . . . . . . 0.160 'X-RAY DIFFRACTION' 2.932 3.011 . . 15 241 70.1370 . . . . 0.414 . . . . . . . . . . . 0.313 'X-RAY DIFFRACTION' 3.011 3.097 . . 13 317 96.2099 . . . . 0.411 . . . . . . . . . . . 0.472 'X-RAY DIFFRACTION' 3.097 3.192 . . 15 338 100.0000 . . . . 0.352 . . . . . . . . . . . 0.469 'X-RAY DIFFRACTION' 3.192 3.295 . . 24 301 100.0000 . . . . 0.338 . . . . . . . . . . . 0.358 'X-RAY DIFFRACTION' 3.295 3.409 . . 14 306 100.0000 . . . . 0.324 . . . . . . . . . . . 0.294 'X-RAY DIFFRACTION' 3.409 3.536 . . 15 299 100.0000 . . . . 0.294 . . . . . . . . . . . 0.322 'X-RAY DIFFRACTION' 3.536 3.679 . . 20 279 100.0000 . . . . 0.299 . . . . . . . . . . . 0.264 'X-RAY DIFFRACTION' 3.679 3.839 . . 18 273 100.0000 . . . . 0.264 . . . . . . . . . . . 0.351 'X-RAY DIFFRACTION' 3.839 4.024 . . 17 271 100.0000 . . . . 0.241 . . . . . . . . . . . 0.275 'X-RAY DIFFRACTION' 4.024 4.237 . . 19 244 100.0000 . . . . 0.232 . . . . . . . . . . . 0.248 'X-RAY DIFFRACTION' 4.237 4.488 . . 10 243 100.0000 . . . . 0.201 . . . . . . . . . . . 0.243 'X-RAY DIFFRACTION' 4.488 4.791 . . 14 232 100.0000 . . . . 0.172 . . . . . . . . . . . 0.196 'X-RAY DIFFRACTION' 4.791 5.164 . . 11 214 100.0000 . . . . 0.194 . . . . . . . . . . . 0.247 'X-RAY DIFFRACTION' 5.164 5.640 . . 7 207 100.0000 . . . . 0.211 . . . . . . . . . . . 0.279 'X-RAY DIFFRACTION' 5.640 6.278 . . 10 185 100.0000 . . . . 0.230 . . . . . . . . . . . 0.304 'X-RAY DIFFRACTION' 6.278 7.197 . . 7 171 100.0000 . . . . 0.214 . . . . . . . . . . . 0.145 'X-RAY DIFFRACTION' 7.197 8.690 . . 3 152 99.3590 . . . . 0.191 . . . . . . . . . . . 0.287 'X-RAY DIFFRACTION' 8.690 11.804 . . 7 122 100.0000 . . . . 0.177 . . . . . . . . . . . 0.204 'X-RAY DIFFRACTION' 11.804 24.345 . . 3 82 92.3913 . . . . 0.310 . . . . . . . . . . . 0.166 # _struct.entry_id 8JSJ _struct.title 'Crystal structure of an N-terminal cyclic nucleotide-binding domain of a PycTIR from Novosphingobium pentaromativorans' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8JSJ _struct_keywords.text 'cUMP receptor, Pycsar effector protein, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8JSJ _struct_ref.pdbx_db_accession 8JSJ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8JSJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 311 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8JSJ _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 311 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 311 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 2 ? ARG A 7 ? GLY A 2 ARG A 7 1 ? 6 HELX_P HELX_P2 AA2 GLY A 10 ? GLU A 12 ? GLY A 10 GLU A 12 5 ? 3 HELX_P HELX_P3 AA3 LYS A 13 ? GLY A 23 ? LYS A 13 GLY A 23 1 ? 11 HELX_P HELX_P4 AA4 ASP A 30 ? GLY A 41 ? ASP A 30 GLY A 41 1 ? 12 HELX_P HELX_P5 AA5 ARG A 117 ? ARG A 125 ? ARG A 117 ARG A 125 1 ? 9 HELX_P HELX_P6 AA6 SER A 127 ? VAL A 137 ? SER A 127 VAL A 137 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 42 ? ILE A 46 ? VAL A 42 ILE A 46 AA1 2 SER A 105 ? LYS A 116 ? SER A 105 LYS A 116 AA1 3 ASP A 61 ? ILE A 74 ? ASP A 61 ILE A 74 AA1 4 ARG A 77 ? GLU A 83 ? ARG A 77 GLU A 83 AA2 1 VAL A 42 ? ILE A 46 ? VAL A 42 ILE A 46 AA2 2 SER A 105 ? LYS A 116 ? SER A 105 LYS A 116 AA2 3 ASP A 61 ? ILE A 74 ? ASP A 61 ILE A 74 AA2 4 HIS A 87 ? VAL A 88 ? HIS A 87 VAL A 88 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 46 ? N ILE A 46 O ALA A 110 ? O ALA A 110 AA1 2 3 O ILE A 107 ? O ILE A 107 N LYS A 69 ? N LYS A 69 AA1 3 4 N ILE A 74 ? N ILE A 74 O ARG A 77 ? O ARG A 77 AA2 1 2 N ILE A 46 ? N ILE A 46 O ALA A 110 ? O ALA A 110 AA2 2 3 O ILE A 107 ? O ILE A 107 N LYS A 69 ? N LYS A 69 AA2 3 4 N PHE A 63 ? N PHE A 63 O VAL A 88 ? O VAL A 88 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 8 ? ? -138.41 -34.13 2 1 ALA A 28 ? ? 40.22 80.10 3 1 ASN A 29 ? ? 32.35 37.79 4 1 ASP A 48 ? ? -38.19 124.77 5 1 ASN A 75 ? ? 50.75 14.10 6 1 GLN A 79 ? ? -114.37 -94.75 7 1 ALA A 84 ? ? -39.77 127.94 8 1 PRO A 99 ? ? -69.43 -165.82 9 1 THR A 118 ? ? -51.35 -72.01 10 1 THR A 124 ? ? -23.71 -68.52 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 446 ? 5.99 . 2 1 O ? A HOH 447 ? 6.80 . 3 1 O ? A HOH 448 ? 6.93 . 4 1 O ? A HOH 449 ? 7.21 . 5 1 O ? A HOH 450 ? 11.26 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 92 ? A THR 92 2 1 Y 1 A GLY 93 ? A GLY 93 3 1 Y 1 A THR 94 ? A THR 94 4 1 Y 1 A SER 95 ? A SER 95 5 1 Y 1 A PRO 96 ? A PRO 96 6 1 Y 1 A ALA 97 ? A ALA 97 7 1 Y 1 A ARG 141 ? A ARG 141 8 1 Y 1 A LEU 142 ? A LEU 142 9 1 Y 1 A ASP 143 ? A ASP 143 10 1 Y 1 A GLU 144 ? A GLU 144 11 1 Y 1 A ARG 145 ? A ARG 145 12 1 Y 1 A ASN 146 ? A ASN 146 13 1 Y 1 A LYS 147 ? A LYS 147 14 1 Y 1 A GLY 148 ? A GLY 148 15 1 Y 1 A ILE 149 ? A ILE 149 16 1 Y 1 A GLY 150 ? A GLY 150 17 1 Y 1 A GLN 151 ? A GLN 151 18 1 Y 1 A THR 152 ? A THR 152 19 1 Y 1 A ASN 153 ? A ASN 153 20 1 Y 1 A ASP 154 ? A ASP 154 21 1 Y 1 A ILE 155 ? A ILE 155 22 1 Y 1 A PRO 156 ? A PRO 156 23 1 Y 1 A ARG 157 ? A ARG 157 24 1 Y 1 A ILE 158 ? A ILE 158 25 1 Y 1 A PHE 159 ? A PHE 159 26 1 Y 1 A VAL 160 ? A VAL 160 27 1 Y 1 A ILE 161 ? A ILE 161 28 1 Y 1 A SER 162 ? A SER 162 29 1 Y 1 A SER 163 ? A SER 163 30 1 Y 1 A SER 164 ? A SER 164 31 1 Y 1 A GLU 165 ? A GLU 165 32 1 Y 1 A LYS 166 ? A LYS 166 33 1 Y 1 A ILE 167 ? A ILE 167 34 1 Y 1 A GLY 168 ? A GLY 168 35 1 Y 1 A VAL 169 ? A VAL 169 36 1 Y 1 A ALA 170 ? A ALA 170 37 1 Y 1 A ASN 171 ? A ASN 171 38 1 Y 1 A GLU 172 ? A GLU 172 39 1 Y 1 A ILE 173 ? A ILE 173 40 1 Y 1 A VAL 174 ? A VAL 174 41 1 Y 1 A ARG 175 ? A ARG 175 42 1 Y 1 A ASN 176 ? A ASN 176 43 1 Y 1 A LEU 177 ? A LEU 177 44 1 Y 1 A ASP 178 ? A ASP 178 45 1 Y 1 A SER 179 ? A SER 179 46 1 Y 1 A LYS 180 ? A LYS 180 47 1 Y 1 A GLU 181 ? A GLU 181 48 1 Y 1 A ILE 182 ? A ILE 182 49 1 Y 1 A ALA 183 ? A ALA 183 50 1 Y 1 A VAL 184 ? A VAL 184 51 1 Y 1 A GLN 185 ? A GLN 185 52 1 Y 1 A LEU 186 ? A LEU 186 53 1 Y 1 A TRP 187 ? A TRP 187 54 1 Y 1 A ASP 188 ? A ASP 188 55 1 Y 1 A LYS 189 ? A LYS 189 56 1 Y 1 A GLY 190 ? A GLY 190 57 1 Y 1 A THR 191 ? A THR 191 58 1 Y 1 A PHE 192 ? A PHE 192 59 1 Y 1 A GLY 193 ? A GLY 193 60 1 Y 1 A ILE 194 ? A ILE 194 61 1 Y 1 A SER 195 ? A SER 195 62 1 Y 1 A ASP 196 ? A ASP 196 63 1 Y 1 A TYR 197 ? A TYR 197 64 1 Y 1 A PRO 198 ? A PRO 198 65 1 Y 1 A ILE 199 ? A ILE 199 66 1 Y 1 A SER 200 ? A SER 200 67 1 Y 1 A SER 201 ? A SER 201 68 1 Y 1 A LEU 202 ? A LEU 202 69 1 Y 1 A MET 203 ? A MET 203 70 1 Y 1 A ASP 204 ? A ASP 204 71 1 Y 1 A ALA 205 ? A ALA 205 72 1 Y 1 A ILE 206 ? A ILE 206 73 1 Y 1 A GLU 207 ? A GLU 207 74 1 Y 1 A SER 208 ? A SER 208 75 1 Y 1 A SER 209 ? A SER 209 76 1 Y 1 A ASP 210 ? A ASP 210 77 1 Y 1 A PHE 211 ? A PHE 211 78 1 Y 1 A THR 212 ? A THR 212 79 1 Y 1 A ILE 213 ? A ILE 213 80 1 Y 1 A ALA 214 ? A ALA 214 81 1 Y 1 A VAL 215 ? A VAL 215 82 1 Y 1 A VAL 216 ? A VAL 216 83 1 Y 1 A GLY 217 ? A GLY 217 84 1 Y 1 A ALA 218 ? A ALA 218 85 1 Y 1 A ASP 219 ? A ASP 219 86 1 Y 1 A ASP 220 ? A ASP 220 87 1 Y 1 A THR 221 ? A THR 221 88 1 Y 1 A LEU 222 ? A LEU 222 89 1 Y 1 A THR 223 ? A THR 223 90 1 Y 1 A MET 224 ? A MET 224 91 1 Y 1 A ARG 225 ? A ARG 225 92 1 Y 1 A GLY 226 ? A GLY 226 93 1 Y 1 A GLU 227 ? A GLU 227 94 1 Y 1 A THR 228 ? A THR 228 95 1 Y 1 A HIS 229 ? A HIS 229 96 1 Y 1 A GLN 230 ? A GLN 230 97 1 Y 1 A VAL 231 ? A VAL 231 98 1 Y 1 A ALA 232 ? A ALA 232 99 1 Y 1 A ARG 233 ? A ARG 233 100 1 Y 1 A ASP 234 ? A ASP 234 101 1 Y 1 A ASN 235 ? A ASN 235 102 1 Y 1 A VAL 236 ? A VAL 236 103 1 Y 1 A HIS 237 ? A HIS 237 104 1 Y 1 A LEU 238 ? A LEU 238 105 1 Y 1 A GLU 239 ? A GLU 239 106 1 Y 1 A PHE 240 ? A PHE 240 107 1 Y 1 A GLY 241 ? A GLY 241 108 1 Y 1 A ILE 242 ? A ILE 242 109 1 Y 1 A SER 243 ? A SER 243 110 1 Y 1 A LEU 244 ? A LEU 244 111 1 Y 1 A GLY 245 ? A GLY 245 112 1 Y 1 A VAL 246 ? A VAL 246 113 1 Y 1 A LEU 247 ? A LEU 247 114 1 Y 1 A GLY 248 ? A GLY 248 115 1 Y 1 A ARG 249 ? A ARG 249 116 1 Y 1 A ARG 250 ? A ARG 250 117 1 Y 1 A ARG 251 ? A ARG 251 118 1 Y 1 A SER 252 ? A SER 252 119 1 Y 1 A MET 253 ? A MET 253 120 1 Y 1 A LEU 254 ? A LEU 254 121 1 Y 1 A LEU 255 ? A LEU 255 122 1 Y 1 A VAL 256 ? A VAL 256 123 1 Y 1 A CYS 257 ? A CYS 257 124 1 Y 1 A ALA 258 ? A ALA 258 125 1 Y 1 A ASP 259 ? A ASP 259 126 1 Y 1 A ASP 260 ? A ASP 260 127 1 Y 1 A GLY 261 ? A GLY 261 128 1 Y 1 A VAL 262 ? A VAL 262 129 1 Y 1 A ARG 263 ? A ARG 263 130 1 Y 1 A LEU 264 ? A LEU 264 131 1 Y 1 A PRO 265 ? A PRO 265 132 1 Y 1 A SER 266 ? A SER 266 133 1 Y 1 A ASP 267 ? A ASP 267 134 1 Y 1 A ALA 268 ? A ALA 268 135 1 Y 1 A ALA 269 ? A ALA 269 136 1 Y 1 A GLY 270 ? A GLY 270 137 1 Y 1 A LEU 271 ? A LEU 271 138 1 Y 1 A THR 272 ? A THR 272 139 1 Y 1 A THR 273 ? A THR 273 140 1 Y 1 A LEU 274 ? A LEU 274 141 1 Y 1 A ARG 275 ? A ARG 275 142 1 Y 1 A TYR 276 ? A TYR 276 143 1 Y 1 A ARG 277 ? A ARG 277 144 1 Y 1 A THR 278 ? A THR 278 145 1 Y 1 A GLY 279 ? A GLY 279 146 1 Y 1 A SER 280 ? A SER 280 147 1 Y 1 A ASP 281 ? A ASP 281 148 1 Y 1 A ASP 282 ? A ASP 282 149 1 Y 1 A GLU 283 ? A GLU 283 150 1 Y 1 A MET 284 ? A MET 284 151 1 Y 1 A LYS 285 ? A LYS 285 152 1 Y 1 A ARG 286 ? A ARG 286 153 1 Y 1 A THR 287 ? A THR 287 154 1 Y 1 A VAL 288 ? A VAL 288 155 1 Y 1 A ARG 289 ? A ARG 289 156 1 Y 1 A ASN 290 ? A ASN 290 157 1 Y 1 A ALA 291 ? A ALA 291 158 1 Y 1 A CYS 292 ? A CYS 292 159 1 Y 1 A ILE 293 ? A ILE 293 160 1 Y 1 A GLU 294 ? A GLU 294 161 1 Y 1 A ALA 295 ? A ALA 295 162 1 Y 1 A LYS 296 ? A LYS 296 163 1 Y 1 A GLU 297 ? A GLU 297 164 1 Y 1 A HIS 298 ? A HIS 298 165 1 Y 1 A ILE 299 ? A ILE 299 166 1 Y 1 A GLU 300 ? A GLU 300 167 1 Y 1 A LYS 301 ? A LYS 301 168 1 Y 1 A GLU 302 ? A GLU 302 169 1 Y 1 A GLY 303 ? A GLY 303 170 1 Y 1 A VAL 304 ? A VAL 304 171 1 Y 1 A PHE 305 ? A PHE 305 172 1 Y 1 A THR 306 ? A THR 306 173 1 Y 1 A ASP 307 ? A ASP 307 174 1 Y 1 A ARG 308 ? A ARG 308 175 1 Y 1 A ARG 309 ? A ARG 309 176 1 Y 1 A ALA 310 ? A ALA 310 177 1 Y 1 A ARG 311 ? A ARG 311 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Ministry of Science and Technology (MoST, Taiwan)' _pdbx_audit_support.country Taiwan _pdbx_audit_support.grant_number 111-2311-B-039-001-MY3 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8JSJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011479 _atom_sites.fract_transf_matrix[1][2] 0.006627 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013255 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010712 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 N+1 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 O-1 8 9 4.195 12.857 1.641 4.172 1.528 47.018 -20.325 -0.014 21.960 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 0.867 # loop_