data_8JVF # _entry.id 8JVF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8JVF pdb_00008jvf 10.2210/pdb8jvf/pdb WWPDB D_1300039011 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8JVF _pdbx_database_status.recvd_initial_deposition_date 2023-06-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'same protein not complexed with GTP, Mg' 8JVC unspecified PDB 'same protein not complexed with GTP, Mg' 8JVG unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email kita.akiko.4u@kyoto-u.ac.jp _pdbx_contact_author.name_first Akiko _pdbx_contact_author.name_last Kita _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5174-6238 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kita, A.' 1 ? 'Ishida, Y.' 2 ? 'Shimosaka, T.' 3 ? 'Michimori, Y.' 4 ? 'Makarova, K.' 5 ? 'Koonin, E.' 6 ? 'Atomi, H.' 7 ? 'Miki, K.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 92 _citation.language ? _citation.page_first 768 _citation.page_last 775 _citation.title 'Crystal structure of GTP-dependent dephospho-coenzyme A kinase from the hyperthermophilic archaeon, Thermococcus kodakarensis.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.26666 _citation.pdbx_database_id_PubMed 38235908 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kita, A.' 1 ? primary 'Ishida, Y.' 2 ? primary 'Shimosaka, T.' 3 ? primary 'Michimori, Y.' 4 ? primary 'Makarova, K.' 5 ? primary 'Koonin, E.' 6 ? primary 'Atomi, H.' 7 ? primary 'Miki, K.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GTP-dependent dephospho-CoA kinase' 19686.150 1 2.7.1.237 ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn "GUANOSINE-5'-TRIPHOSPHATE" 523.180 1 ? ? ? ? 4 water nat water 18.015 19 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dephospho-coenzyme A kinase,DPCK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKMFFRLTRELRDELKRPLGELVRGPIPEPYLKVRGELEKHPVVTVGDVVTENVLKIGVKPIIALYDLKTKRKEYSPEIE DTAVFLTVTNPPGTITKALLDTVRKAFGLAERGRNVHILVSGEEDLAAIPAVLYAPLGTLVLYGQPDEGVVLIKVTPECK RRCAKILASMEVVRDGD ; _entity_poly.pdbx_seq_one_letter_code_can ;MKMFFRLTRELRDELKRPLGELVRGPIPEPYLKVRGELEKHPVVTVGDVVTENVLKIGVKPIIALYDLKTKRKEYSPEIE DTAVFLTVTNPPGTITKALLDTVRKAFGLAERGRNVHILVSGEEDLAAIPAVLYAPLGTLVLYGQPDEGVVLIKVTPECK RRCAKILASMEVVRDGD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 "GUANOSINE-5'-TRIPHOSPHATE" GTP 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 MET n 1 4 PHE n 1 5 PHE n 1 6 ARG n 1 7 LEU n 1 8 THR n 1 9 ARG n 1 10 GLU n 1 11 LEU n 1 12 ARG n 1 13 ASP n 1 14 GLU n 1 15 LEU n 1 16 LYS n 1 17 ARG n 1 18 PRO n 1 19 LEU n 1 20 GLY n 1 21 GLU n 1 22 LEU n 1 23 VAL n 1 24 ARG n 1 25 GLY n 1 26 PRO n 1 27 ILE n 1 28 PRO n 1 29 GLU n 1 30 PRO n 1 31 TYR n 1 32 LEU n 1 33 LYS n 1 34 VAL n 1 35 ARG n 1 36 GLY n 1 37 GLU n 1 38 LEU n 1 39 GLU n 1 40 LYS n 1 41 HIS n 1 42 PRO n 1 43 VAL n 1 44 VAL n 1 45 THR n 1 46 VAL n 1 47 GLY n 1 48 ASP n 1 49 VAL n 1 50 VAL n 1 51 THR n 1 52 GLU n 1 53 ASN n 1 54 VAL n 1 55 LEU n 1 56 LYS n 1 57 ILE n 1 58 GLY n 1 59 VAL n 1 60 LYS n 1 61 PRO n 1 62 ILE n 1 63 ILE n 1 64 ALA n 1 65 LEU n 1 66 TYR n 1 67 ASP n 1 68 LEU n 1 69 LYS n 1 70 THR n 1 71 LYS n 1 72 ARG n 1 73 LYS n 1 74 GLU n 1 75 TYR n 1 76 SER n 1 77 PRO n 1 78 GLU n 1 79 ILE n 1 80 GLU n 1 81 ASP n 1 82 THR n 1 83 ALA n 1 84 VAL n 1 85 PHE n 1 86 LEU n 1 87 THR n 1 88 VAL n 1 89 THR n 1 90 ASN n 1 91 PRO n 1 92 PRO n 1 93 GLY n 1 94 THR n 1 95 ILE n 1 96 THR n 1 97 LYS n 1 98 ALA n 1 99 LEU n 1 100 LEU n 1 101 ASP n 1 102 THR n 1 103 VAL n 1 104 ARG n 1 105 LYS n 1 106 ALA n 1 107 PHE n 1 108 GLY n 1 109 LEU n 1 110 ALA n 1 111 GLU n 1 112 ARG n 1 113 GLY n 1 114 ARG n 1 115 ASN n 1 116 VAL n 1 117 HIS n 1 118 ILE n 1 119 LEU n 1 120 VAL n 1 121 SER n 1 122 GLY n 1 123 GLU n 1 124 GLU n 1 125 ASP n 1 126 LEU n 1 127 ALA n 1 128 ALA n 1 129 ILE n 1 130 PRO n 1 131 ALA n 1 132 VAL n 1 133 LEU n 1 134 TYR n 1 135 ALA n 1 136 PRO n 1 137 LEU n 1 138 GLY n 1 139 THR n 1 140 LEU n 1 141 VAL n 1 142 LEU n 1 143 TYR n 1 144 GLY n 1 145 GLN n 1 146 PRO n 1 147 ASP n 1 148 GLU n 1 149 GLY n 1 150 VAL n 1 151 VAL n 1 152 LEU n 1 153 ILE n 1 154 LYS n 1 155 VAL n 1 156 THR n 1 157 PRO n 1 158 GLU n 1 159 CYS n 1 160 LYS n 1 161 ARG n 1 162 ARG n 1 163 CYS n 1 164 ALA n 1 165 LYS n 1 166 ILE n 1 167 LEU n 1 168 ALA n 1 169 SER n 1 170 MET n 1 171 GLU n 1 172 VAL n 1 173 VAL n 1 174 ARG n 1 175 ASP n 1 176 GLY n 1 177 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 177 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TK1697 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermococcus kodakarensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 311400 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GTP non-polymer n "GUANOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O14 P3' 523.180 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 MET 3 3 ? ? ? A . n A 1 4 PHE 4 4 ? ? ? A . n A 1 5 PHE 5 5 ? ? ? A . n A 1 6 ARG 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 THR 8 8 ? ? ? A . n A 1 9 ARG 9 9 ? ? ? A . n A 1 10 GLU 10 10 ? ? ? A . n A 1 11 LEU 11 11 ? ? ? A . n A 1 12 ARG 12 12 ? ? ? A . n A 1 13 ASP 13 13 ? ? ? A . n A 1 14 GLU 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 LYS 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 PRO 18 18 ? ? ? A . n A 1 19 LEU 19 19 19 LEU ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LYS 40 40 40 LYS ALA A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLU 52 52 52 GLU ALA A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 THR 70 70 ? ? ? A . n A 1 71 LYS 71 71 ? ? ? A . n A 1 72 ARG 72 72 ? ? ? A . n A 1 73 LYS 73 73 ? ? ? A . n A 1 74 GLU 74 74 ? ? ? A . n A 1 75 TYR 75 75 ? ? ? A . n A 1 76 SER 76 76 ? ? ? A . n A 1 77 PRO 77 77 ? ? ? A . n A 1 78 GLU 78 78 ? ? ? A . n A 1 79 ILE 79 79 ? ? ? A . n A 1 80 GLU 80 80 ? ? ? A . n A 1 81 ASP 81 81 ? ? ? A . n A 1 82 THR 82 82 ? ? ? A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 LYS 97 97 97 LYS ALA A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 TYR 143 143 143 TYR TYR A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 GLU 148 148 148 GLU ALA A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ARG 161 161 161 ARG ALA A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 CYS 163 163 163 CYS ALA A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LYS 165 165 165 LYS ALA A . n A 1 166 ILE 166 166 166 ILE ALA A . n A 1 167 LEU 167 167 167 LEU ALA A . n A 1 168 ALA 168 168 ? ? ? A . n A 1 169 SER 169 169 ? ? ? A . n A 1 170 MET 170 170 ? ? ? A . n A 1 171 GLU 171 171 ? ? ? A . n A 1 172 VAL 172 172 ? ? ? A . n A 1 173 VAL 173 173 ? ? ? A . n A 1 174 ARG 174 174 ? ? ? A . n A 1 175 ASP 175 175 ? ? ? A . n A 1 176 GLY 176 176 ? ? ? A . n A 1 177 ASP 177 177 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 201 200 MG MG A . C 3 GTP 1 202 300 GTP GTP A . D 4 HOH 1 301 1 HOH HOH A . D 4 HOH 2 302 5 HOH HOH A . D 4 HOH 3 303 4 HOH HOH A . D 4 HOH 4 304 4 HOH HOH A . D 4 HOH 5 305 46 HOH HOH A . D 4 HOH 6 306 9 HOH HOH A . D 4 HOH 7 307 6 HOH HOH A . D 4 HOH 8 308 2 HOH HOH A . D 4 HOH 9 309 44 HOH HOH A . D 4 HOH 10 310 43 HOH HOH A . D 4 HOH 11 311 16 HOH HOH A . D 4 HOH 12 312 11 HOH HOH A . D 4 HOH 13 313 11 HOH HOH A . D 4 HOH 14 314 18 HOH HOH A . D 4 HOH 15 315 7 HOH HOH A . D 4 HOH 16 316 10 HOH HOH A . D 4 HOH 17 317 4 HOH HOH A . D 4 HOH 18 318 7 HOH HOH A . D 4 HOH 19 319 3 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 19 ? CG ? A LEU 19 CG 2 1 Y 1 A LEU 19 ? CD1 ? A LEU 19 CD1 3 1 Y 1 A LEU 19 ? CD2 ? A LEU 19 CD2 4 1 Y 1 A LYS 40 ? CG ? A LYS 40 CG 5 1 Y 1 A LYS 40 ? CD ? A LYS 40 CD 6 1 Y 1 A LYS 40 ? CE ? A LYS 40 CE 7 1 Y 1 A LYS 40 ? NZ ? A LYS 40 NZ 8 1 Y 1 A GLU 52 ? CG ? A GLU 52 CG 9 1 Y 1 A GLU 52 ? CD ? A GLU 52 CD 10 1 Y 1 A GLU 52 ? OE1 ? A GLU 52 OE1 11 1 Y 1 A GLU 52 ? OE2 ? A GLU 52 OE2 12 1 Y 1 A LYS 97 ? CG ? A LYS 97 CG 13 1 Y 1 A LYS 97 ? CD ? A LYS 97 CD 14 1 Y 1 A LYS 97 ? CE ? A LYS 97 CE 15 1 Y 1 A LYS 97 ? NZ ? A LYS 97 NZ 16 1 Y 1 A GLU 148 ? CG ? A GLU 148 CG 17 1 Y 1 A GLU 148 ? CD ? A GLU 148 CD 18 1 Y 1 A GLU 148 ? OE1 ? A GLU 148 OE1 19 1 Y 1 A GLU 148 ? OE2 ? A GLU 148 OE2 20 1 Y 1 A LYS 154 ? CG ? A LYS 154 CG 21 1 Y 1 A LYS 154 ? CD ? A LYS 154 CD 22 1 Y 1 A LYS 154 ? CE ? A LYS 154 CE 23 1 Y 1 A LYS 154 ? NZ ? A LYS 154 NZ 24 1 Y 1 A ARG 161 ? CG ? A ARG 161 CG 25 1 Y 1 A ARG 161 ? CD ? A ARG 161 CD 26 1 Y 1 A ARG 161 ? NE ? A ARG 161 NE 27 1 Y 1 A ARG 161 ? CZ ? A ARG 161 CZ 28 1 Y 1 A ARG 161 ? NH1 ? A ARG 161 NH1 29 1 Y 1 A ARG 161 ? NH2 ? A ARG 161 NH2 30 1 Y 1 A CYS 163 ? SG ? A CYS 163 SG 31 1 Y 1 A LYS 165 ? CG ? A LYS 165 CG 32 1 Y 1 A LYS 165 ? CD ? A LYS 165 CD 33 1 Y 1 A LYS 165 ? CE ? A LYS 165 CE 34 1 Y 1 A LYS 165 ? NZ ? A LYS 165 NZ 35 1 Y 1 A ILE 166 ? CG1 ? A ILE 166 CG1 36 1 Y 1 A ILE 166 ? CG2 ? A ILE 166 CG2 37 1 Y 1 A ILE 166 ? CD1 ? A ILE 166 CD1 38 1 Y 1 A LEU 167 ? CG ? A LEU 167 CG 39 1 Y 1 A LEU 167 ? CD1 ? A LEU 167 CD1 40 1 Y 1 A LEU 167 ? CD2 ? A LEU 167 CD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0411 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHARP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8JVF _cell.details ? _cell.formula_units_Z ? _cell.length_a 55.101 _cell.length_a_esd ? _cell.length_b 55.101 _cell.length_b_esd ? _cell.length_c 122.584 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8JVF _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8JVF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.36 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.95 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 1500, GTP' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-06-10 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL45XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL45XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8JVF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7963 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 24.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 30.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.075 _reflns.pdbx_Rpim_I_all 0.015 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.073 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.49 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 10.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 811 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 26.5 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.425 _reflns_shell.pdbx_Rpim_I_all 0.082 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.417 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 2.620 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 2.620 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -5.239 _refine.B_iso_max ? _refine.B_iso_mean 59.860 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.945 _refine.correlation_coeff_Fo_to_Fc_free 0.932 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8JVF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.400 _refine.ls_d_res_low 41.010 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7916 _refine.ls_number_reflns_R_free 399 _refine.ls_number_reflns_R_work 7517 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.987 _refine.ls_percent_reflns_R_free 5.040 _refine.ls_R_factor_all 0.220 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2578 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2185 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.278 _refine.ls_wR_factor_R_work 0.231 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 1 _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.299 _refine.pdbx_overall_ESU_R_Free 0.235 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 7.926 _refine.overall_SU_ML 0.182 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work 0.9669 _refine.pdbx_average_fsc_free 0.9536 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.400 _refine_hist.d_res_low 41.010 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 1045 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 993 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 0.012 1046 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.000 0.016 1049 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 0.722 1.651 1438 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.240 1.557 2410 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.918 5.000 134 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 6.528 5.000 6 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 0.585 5.000 1 ? r_dihedral_angle_other_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.721 10.000 156 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.877 10.000 31 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.035 0.200 184 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1160 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 194 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.223 0.200 210 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.237 0.200 895 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.171 0.200 497 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.081 0.200 547 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.149 0.200 28 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.129 0.200 6 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.270 0.200 20 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.168 0.200 5 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 5.416 5.909 542 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.411 5.910 542 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 7.919 10.580 674 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.915 10.589 675 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 6.773 6.355 504 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 6.769 6.355 504 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 10.158 11.403 764 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 10.152 11.397 765 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 12.903 59.847 1096 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 12.903 59.860 1094 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.400 2.462 564 . 23 541 100.0000 . 0.274 . . 0.274 . . . . . 0.244 . 20 . 0.954 0.947 0.280 'X-RAY DIFFRACTION' 2.462 2.529 553 . 30 523 100.0000 . 0.267 . . 0.259 . . . . . 0.228 . 20 . 0.956 0.918 0.418 'X-RAY DIFFRACTION' 2.529 2.603 545 . 23 522 100.0000 . 0.239 . . 0.237 . . . . . 0.217 . 20 . 0.967 0.968 0.274 'X-RAY DIFFRACTION' 2.603 2.682 511 . 24 487 100.0000 . 0.233 . . 0.231 . . . . . 0.214 . 20 . 0.971 0.938 0.271 'X-RAY DIFFRACTION' 2.682 2.770 514 . 27 487 100.0000 . 0.240 . . 0.238 . . . . . 0.219 . 20 . 0.969 0.961 0.264 'X-RAY DIFFRACTION' 2.770 2.867 493 . 28 465 100.0000 . 0.230 . . 0.222 . . . . . 0.210 . 20 . 0.968 0.940 0.379 'X-RAY DIFFRACTION' 2.867 2.974 464 . 20 444 100.0000 . 0.236 . . 0.235 . . . . . 0.221 . 20 . 0.965 0.965 0.248 'X-RAY DIFFRACTION' 2.974 3.095 470 . 31 439 100.0000 . 0.212 . . 0.210 . . . . . 0.203 . 20 . 0.969 0.960 0.239 'X-RAY DIFFRACTION' 3.095 3.232 452 . 23 429 100.0000 . 0.263 . . 0.261 . . . . . 0.257 . 20 . 0.954 0.947 0.305 'X-RAY DIFFRACTION' 3.232 3.388 416 . 10 406 100.0000 . 0.247 . . 0.251 . . . . . 0.251 . 20 . 0.958 0.980 0.161 'X-RAY DIFFRACTION' 3.388 3.570 402 . 22 380 100.0000 . 0.242 . . 0.238 . . . . . 0.245 . 20 . 0.965 0.936 0.309 'X-RAY DIFFRACTION' 3.570 3.785 384 . 22 362 100.0000 . 0.241 . . 0.238 . . . . . 0.249 . 20 . 0.965 0.950 0.300 'X-RAY DIFFRACTION' 3.785 4.044 377 . 19 358 100.0000 . 0.203 . . 0.200 . . . . . 0.213 . 20 . 0.978 0.960 0.260 'X-RAY DIFFRACTION' 4.044 4.365 343 . 15 328 100.0000 . 0.183 . . 0.180 . . . . . 0.199 . 20 . 0.981 0.956 0.258 'X-RAY DIFFRACTION' 4.365 4.776 318 . 18 300 100.0000 . 0.152 . . 0.150 . . . . . 0.173 . 20 . 0.986 0.976 0.212 'X-RAY DIFFRACTION' 4.776 5.330 294 . 20 274 100.0000 . 0.191 . . 0.191 . . . . . 0.231 . 20 . 0.982 0.978 0.194 'X-RAY DIFFRACTION' 5.330 6.138 275 . 18 257 100.0000 . 0.220 . . 0.218 . . . . . 0.253 . 20 . 0.973 0.978 0.255 'X-RAY DIFFRACTION' 6.138 7.476 219 . 11 208 100.0000 . 0.228 . . 0.220 . . . . . 0.247 . 20 . 0.972 0.905 0.444 'X-RAY DIFFRACTION' 7.476 10.401 196 . 11 185 100.0000 . 0.198 . . 0.200 . . . . . 0.263 . 20 . 0.977 0.984 0.165 'X-RAY DIFFRACTION' 10.401 41.010 126 . 4 122 100.0000 . 0.295 . . 0.298 . . . . . 0.335 . 20 . 0.932 0.970 0.181 # _struct.entry_id 8JVF _struct.title 'Crystal structure of dephospho-coenzyme A kinase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8JVF _struct_keywords.text 'enzyme-nucleotide complex, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DPCKG_THEKO _struct_ref.pdbx_db_accession Q5JIY7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKMFFRLTRELRDELKRPLGELVRGPIPEPYLKVRGELEKHPVVTVGDVVTENVLKIGVKPIIALYDLKTKRKEYSPEIE DTAVFLTVTNPPGTITKALLDTVRKAFGLAERGRNVHILVSGEEDLAAIPAVLYAPLGTLVLYGQPDEGVVLIKVTPECK RRCAKILASMEVVRDGD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8JVF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 177 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5JIY7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 177 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 177 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 28 ? VAL A 34 ? PRO A 28 VAL A 34 1 ? 7 HELX_P HELX_P2 AA2 VAL A 34 ? GLU A 39 ? VAL A 34 GLU A 39 1 ? 6 HELX_P HELX_P3 AA3 GLY A 47 ? ILE A 57 ? GLY A 47 ILE A 57 1 ? 11 HELX_P HELX_P4 AA4 THR A 96 ? ARG A 112 ? THR A 96 ARG A 112 1 ? 17 HELX_P HELX_P5 AA5 ALA A 127 ? ALA A 135 ? ALA A 127 ALA A 135 1 ? 9 HELX_P HELX_P6 AA6 THR A 156 ? LEU A 167 ? THR A 156 LEU A 167 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B MG . MG ? ? ? 1_555 C GTP . O3G ? ? A MG 201 A GTP 202 1_555 ? ? ? ? ? ? ? 1.989 ? ? metalc2 metalc ? ? B MG . MG ? ? ? 1_555 C GTP . O2B ? ? A MG 201 A GTP 202 1_555 ? ? ? ? ? ? ? 2.609 ? ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 C GTP . O2A ? ? A MG 201 A GTP 202 1_555 ? ? ? ? ? ? ? 2.006 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 301 1_555 ? ? ? ? ? ? ? 2.513 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 308 1_555 ? ? ? ? ? ? ? 2.292 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O3G ? C GTP . ? A GTP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2B ? C GTP . ? A GTP 202 ? 1_555 82.2 ? 2 O3G ? C GTP . ? A GTP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C GTP . ? A GTP 202 ? 1_555 102.4 ? 3 O2B ? C GTP . ? A GTP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C GTP . ? A GTP 202 ? 1_555 78.8 ? 4 O3G ? C GTP . ? A GTP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 301 ? 1_555 76.4 ? 5 O2B ? C GTP . ? A GTP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 301 ? 1_555 56.9 ? 6 O2A ? C GTP . ? A GTP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 301 ? 1_555 135.5 ? 7 O3G ? C GTP . ? A GTP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 308 ? 1_555 143.2 ? 8 O2B ? C GTP . ? A GTP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 308 ? 1_555 66.3 ? 9 O2A ? C GTP . ? A GTP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 308 ? 1_555 90.2 ? 10 O ? D HOH . ? A HOH 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 308 ? 1_555 70.6 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 27 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 27 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 28 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 28 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.67 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 21 ? ARG A 24 ? GLU A 21 ARG A 24 AA1 2 GLY A 149 ? LYS A 154 ? GLY A 149 LYS A 154 AA1 3 LEU A 140 ? GLN A 145 ? LEU A 140 GLN A 145 AA1 4 VAL A 43 ? VAL A 46 ? VAL A 43 VAL A 46 AA1 5 ILE A 63 ? ASP A 67 ? ILE A 63 ASP A 67 AA1 6 VAL A 116 ? GLY A 122 ? VAL A 116 GLY A 122 AA1 7 VAL A 84 ? ASN A 90 ? VAL A 84 ASN A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 21 ? N GLU A 21 O LEU A 152 ? O LEU A 152 AA1 2 3 O GLY A 149 ? O GLY A 149 N GLN A 145 ? N GLN A 145 AA1 3 4 O LEU A 140 ? O LEU A 140 N VAL A 44 ? N VAL A 44 AA1 4 5 N THR A 45 ? N THR A 45 O LEU A 65 ? O LEU A 65 AA1 5 6 N TYR A 66 ? N TYR A 66 O VAL A 120 ? O VAL A 120 AA1 6 7 O SER A 121 ? O SER A 121 N ASN A 90 ? N ASN A 90 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 147 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 78.90 _pdbx_validate_torsion.psi -18.59 # _pdbx_entry_details.entry_id 8JVF _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A MET 3 ? A MET 3 4 1 Y 1 A PHE 4 ? A PHE 4 5 1 Y 1 A PHE 5 ? A PHE 5 6 1 Y 1 A ARG 6 ? A ARG 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A THR 8 ? A THR 8 9 1 Y 1 A ARG 9 ? A ARG 9 10 1 Y 1 A GLU 10 ? A GLU 10 11 1 Y 1 A LEU 11 ? A LEU 11 12 1 Y 1 A ARG 12 ? A ARG 12 13 1 Y 1 A ASP 13 ? A ASP 13 14 1 Y 1 A GLU 14 ? A GLU 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A LYS 16 ? A LYS 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A PRO 18 ? A PRO 18 19 1 Y 1 A THR 70 ? A THR 70 20 1 Y 1 A LYS 71 ? A LYS 71 21 1 Y 1 A ARG 72 ? A ARG 72 22 1 Y 1 A LYS 73 ? A LYS 73 23 1 Y 1 A GLU 74 ? A GLU 74 24 1 Y 1 A TYR 75 ? A TYR 75 25 1 Y 1 A SER 76 ? A SER 76 26 1 Y 1 A PRO 77 ? A PRO 77 27 1 Y 1 A GLU 78 ? A GLU 78 28 1 Y 1 A ILE 79 ? A ILE 79 29 1 Y 1 A GLU 80 ? A GLU 80 30 1 Y 1 A ASP 81 ? A ASP 81 31 1 Y 1 A THR 82 ? A THR 82 32 1 Y 1 A ALA 168 ? A ALA 168 33 1 Y 1 A SER 169 ? A SER 169 34 1 Y 1 A MET 170 ? A MET 170 35 1 Y 1 A GLU 171 ? A GLU 171 36 1 Y 1 A VAL 172 ? A VAL 172 37 1 Y 1 A VAL 173 ? A VAL 173 38 1 Y 1 A ARG 174 ? A ARG 174 39 1 Y 1 A ASP 175 ? A ASP 175 40 1 Y 1 A GLY 176 ? A GLY 176 41 1 Y 1 A ASP 177 ? A ASP 177 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GTP PG P N N 137 GTP O1G O N N 138 GTP O2G O N N 139 GTP O3G O N N 140 GTP O3B O N N 141 GTP PB P N N 142 GTP O1B O N N 143 GTP O2B O N N 144 GTP O3A O N N 145 GTP PA P N N 146 GTP O1A O N N 147 GTP O2A O N N 148 GTP "O5'" O N N 149 GTP "C5'" C N N 150 GTP "C4'" C N R 151 GTP "O4'" O N N 152 GTP "C3'" C N S 153 GTP "O3'" O N N 154 GTP "C2'" C N R 155 GTP "O2'" O N N 156 GTP "C1'" C N R 157 GTP N9 N Y N 158 GTP C8 C Y N 159 GTP N7 N Y N 160 GTP C5 C Y N 161 GTP C6 C N N 162 GTP O6 O N N 163 GTP N1 N N N 164 GTP C2 C N N 165 GTP N2 N N N 166 GTP N3 N N N 167 GTP C4 C Y N 168 GTP HOG2 H N N 169 GTP HOG3 H N N 170 GTP HOB2 H N N 171 GTP HOA2 H N N 172 GTP "H5'" H N N 173 GTP "H5''" H N N 174 GTP "H4'" H N N 175 GTP "H3'" H N N 176 GTP "HO3'" H N N 177 GTP "H2'" H N N 178 GTP "HO2'" H N N 179 GTP "H1'" H N N 180 GTP H8 H N N 181 GTP HN1 H N N 182 GTP HN21 H N N 183 GTP HN22 H N N 184 HIS N N N N 185 HIS CA C N S 186 HIS C C N N 187 HIS O O N N 188 HIS CB C N N 189 HIS CG C Y N 190 HIS ND1 N Y N 191 HIS CD2 C Y N 192 HIS CE1 C Y N 193 HIS NE2 N Y N 194 HIS OXT O N N 195 HIS H H N N 196 HIS H2 H N N 197 HIS HA H N N 198 HIS HB2 H N N 199 HIS HB3 H N N 200 HIS HD1 H N N 201 HIS HD2 H N N 202 HIS HE1 H N N 203 HIS HE2 H N N 204 HIS HXT H N N 205 HOH O O N N 206 HOH H1 H N N 207 HOH H2 H N N 208 ILE N N N N 209 ILE CA C N S 210 ILE C C N N 211 ILE O O N N 212 ILE CB C N S 213 ILE CG1 C N N 214 ILE CG2 C N N 215 ILE CD1 C N N 216 ILE OXT O N N 217 ILE H H N N 218 ILE H2 H N N 219 ILE HA H N N 220 ILE HB H N N 221 ILE HG12 H N N 222 ILE HG13 H N N 223 ILE HG21 H N N 224 ILE HG22 H N N 225 ILE HG23 H N N 226 ILE HD11 H N N 227 ILE HD12 H N N 228 ILE HD13 H N N 229 ILE HXT H N N 230 LEU N N N N 231 LEU CA C N S 232 LEU C C N N 233 LEU O O N N 234 LEU CB C N N 235 LEU CG C N N 236 LEU CD1 C N N 237 LEU CD2 C N N 238 LEU OXT O N N 239 LEU H H N N 240 LEU H2 H N N 241 LEU HA H N N 242 LEU HB2 H N N 243 LEU HB3 H N N 244 LEU HG H N N 245 LEU HD11 H N N 246 LEU HD12 H N N 247 LEU HD13 H N N 248 LEU HD21 H N N 249 LEU HD22 H N N 250 LEU HD23 H N N 251 LEU HXT H N N 252 LYS N N N N 253 LYS CA C N S 254 LYS C C N N 255 LYS O O N N 256 LYS CB C N N 257 LYS CG C N N 258 LYS CD C N N 259 LYS CE C N N 260 LYS NZ N N N 261 LYS OXT O N N 262 LYS H H N N 263 LYS H2 H N N 264 LYS HA H N N 265 LYS HB2 H N N 266 LYS HB3 H N N 267 LYS HG2 H N N 268 LYS HG3 H N N 269 LYS HD2 H N N 270 LYS HD3 H N N 271 LYS HE2 H N N 272 LYS HE3 H N N 273 LYS HZ1 H N N 274 LYS HZ2 H N N 275 LYS HZ3 H N N 276 LYS HXT H N N 277 MET N N N N 278 MET CA C N S 279 MET C C N N 280 MET O O N N 281 MET CB C N N 282 MET CG C N N 283 MET SD S N N 284 MET CE C N N 285 MET OXT O N N 286 MET H H N N 287 MET H2 H N N 288 MET HA H N N 289 MET HB2 H N N 290 MET HB3 H N N 291 MET HG2 H N N 292 MET HG3 H N N 293 MET HE1 H N N 294 MET HE2 H N N 295 MET HE3 H N N 296 MET HXT H N N 297 MG MG MG N N 298 PHE N N N N 299 PHE CA C N S 300 PHE C C N N 301 PHE O O N N 302 PHE CB C N N 303 PHE CG C Y N 304 PHE CD1 C Y N 305 PHE CD2 C Y N 306 PHE CE1 C Y N 307 PHE CE2 C Y N 308 PHE CZ C Y N 309 PHE OXT O N N 310 PHE H H N N 311 PHE H2 H N N 312 PHE HA H N N 313 PHE HB2 H N N 314 PHE HB3 H N N 315 PHE HD1 H N N 316 PHE HD2 H N N 317 PHE HE1 H N N 318 PHE HE2 H N N 319 PHE HZ H N N 320 PHE HXT H N N 321 PRO N N N N 322 PRO CA C N S 323 PRO C C N N 324 PRO O O N N 325 PRO CB C N N 326 PRO CG C N N 327 PRO CD C N N 328 PRO OXT O N N 329 PRO H H N N 330 PRO HA H N N 331 PRO HB2 H N N 332 PRO HB3 H N N 333 PRO HG2 H N N 334 PRO HG3 H N N 335 PRO HD2 H N N 336 PRO HD3 H N N 337 PRO HXT H N N 338 SER N N N N 339 SER CA C N S 340 SER C C N N 341 SER O O N N 342 SER CB C N N 343 SER OG O N N 344 SER OXT O N N 345 SER H H N N 346 SER H2 H N N 347 SER HA H N N 348 SER HB2 H N N 349 SER HB3 H N N 350 SER HG H N N 351 SER HXT H N N 352 THR N N N N 353 THR CA C N S 354 THR C C N N 355 THR O O N N 356 THR CB C N R 357 THR OG1 O N N 358 THR CG2 C N N 359 THR OXT O N N 360 THR H H N N 361 THR H2 H N N 362 THR HA H N N 363 THR HB H N N 364 THR HG1 H N N 365 THR HG21 H N N 366 THR HG22 H N N 367 THR HG23 H N N 368 THR HXT H N N 369 TYR N N N N 370 TYR CA C N S 371 TYR C C N N 372 TYR O O N N 373 TYR CB C N N 374 TYR CG C Y N 375 TYR CD1 C Y N 376 TYR CD2 C Y N 377 TYR CE1 C Y N 378 TYR CE2 C Y N 379 TYR CZ C Y N 380 TYR OH O N N 381 TYR OXT O N N 382 TYR H H N N 383 TYR H2 H N N 384 TYR HA H N N 385 TYR HB2 H N N 386 TYR HB3 H N N 387 TYR HD1 H N N 388 TYR HD2 H N N 389 TYR HE1 H N N 390 TYR HE2 H N N 391 TYR HH H N N 392 TYR HXT H N N 393 VAL N N N N 394 VAL CA C N S 395 VAL C C N N 396 VAL O O N N 397 VAL CB C N N 398 VAL CG1 C N N 399 VAL CG2 C N N 400 VAL OXT O N N 401 VAL H H N N 402 VAL H2 H N N 403 VAL HA H N N 404 VAL HB H N N 405 VAL HG11 H N N 406 VAL HG12 H N N 407 VAL HG13 H N N 408 VAL HG21 H N N 409 VAL HG22 H N N 410 VAL HG23 H N N 411 VAL HXT H N N 412 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GTP PG O1G doub N N 129 GTP PG O2G sing N N 130 GTP PG O3G sing N N 131 GTP PG O3B sing N N 132 GTP O2G HOG2 sing N N 133 GTP O3G HOG3 sing N N 134 GTP O3B PB sing N N 135 GTP PB O1B doub N N 136 GTP PB O2B sing N N 137 GTP PB O3A sing N N 138 GTP O2B HOB2 sing N N 139 GTP O3A PA sing N N 140 GTP PA O1A doub N N 141 GTP PA O2A sing N N 142 GTP PA "O5'" sing N N 143 GTP O2A HOA2 sing N N 144 GTP "O5'" "C5'" sing N N 145 GTP "C5'" "C4'" sing N N 146 GTP "C5'" "H5'" sing N N 147 GTP "C5'" "H5''" sing N N 148 GTP "C4'" "O4'" sing N N 149 GTP "C4'" "C3'" sing N N 150 GTP "C4'" "H4'" sing N N 151 GTP "O4'" "C1'" sing N N 152 GTP "C3'" "O3'" sing N N 153 GTP "C3'" "C2'" sing N N 154 GTP "C3'" "H3'" sing N N 155 GTP "O3'" "HO3'" sing N N 156 GTP "C2'" "O2'" sing N N 157 GTP "C2'" "C1'" sing N N 158 GTP "C2'" "H2'" sing N N 159 GTP "O2'" "HO2'" sing N N 160 GTP "C1'" N9 sing N N 161 GTP "C1'" "H1'" sing N N 162 GTP N9 C8 sing Y N 163 GTP N9 C4 sing Y N 164 GTP C8 N7 doub Y N 165 GTP C8 H8 sing N N 166 GTP N7 C5 sing Y N 167 GTP C5 C6 sing N N 168 GTP C5 C4 doub Y N 169 GTP C6 O6 doub N N 170 GTP C6 N1 sing N N 171 GTP N1 C2 sing N N 172 GTP N1 HN1 sing N N 173 GTP C2 N2 sing N N 174 GTP C2 N3 doub N N 175 GTP N2 HN21 sing N N 176 GTP N2 HN22 sing N N 177 GTP N3 C4 sing N N 178 HIS N CA sing N N 179 HIS N H sing N N 180 HIS N H2 sing N N 181 HIS CA C sing N N 182 HIS CA CB sing N N 183 HIS CA HA sing N N 184 HIS C O doub N N 185 HIS C OXT sing N N 186 HIS CB CG sing N N 187 HIS CB HB2 sing N N 188 HIS CB HB3 sing N N 189 HIS CG ND1 sing Y N 190 HIS CG CD2 doub Y N 191 HIS ND1 CE1 doub Y N 192 HIS ND1 HD1 sing N N 193 HIS CD2 NE2 sing Y N 194 HIS CD2 HD2 sing N N 195 HIS CE1 NE2 sing Y N 196 HIS CE1 HE1 sing N N 197 HIS NE2 HE2 sing N N 198 HIS OXT HXT sing N N 199 HOH O H1 sing N N 200 HOH O H2 sing N N 201 ILE N CA sing N N 202 ILE N H sing N N 203 ILE N H2 sing N N 204 ILE CA C sing N N 205 ILE CA CB sing N N 206 ILE CA HA sing N N 207 ILE C O doub N N 208 ILE C OXT sing N N 209 ILE CB CG1 sing N N 210 ILE CB CG2 sing N N 211 ILE CB HB sing N N 212 ILE CG1 CD1 sing N N 213 ILE CG1 HG12 sing N N 214 ILE CG1 HG13 sing N N 215 ILE CG2 HG21 sing N N 216 ILE CG2 HG22 sing N N 217 ILE CG2 HG23 sing N N 218 ILE CD1 HD11 sing N N 219 ILE CD1 HD12 sing N N 220 ILE CD1 HD13 sing N N 221 ILE OXT HXT sing N N 222 LEU N CA sing N N 223 LEU N H sing N N 224 LEU N H2 sing N N 225 LEU CA C sing N N 226 LEU CA CB sing N N 227 LEU CA HA sing N N 228 LEU C O doub N N 229 LEU C OXT sing N N 230 LEU CB CG sing N N 231 LEU CB HB2 sing N N 232 LEU CB HB3 sing N N 233 LEU CG CD1 sing N N 234 LEU CG CD2 sing N N 235 LEU CG HG sing N N 236 LEU CD1 HD11 sing N N 237 LEU CD1 HD12 sing N N 238 LEU CD1 HD13 sing N N 239 LEU CD2 HD21 sing N N 240 LEU CD2 HD22 sing N N 241 LEU CD2 HD23 sing N N 242 LEU OXT HXT sing N N 243 LYS N CA sing N N 244 LYS N H sing N N 245 LYS N H2 sing N N 246 LYS CA C sing N N 247 LYS CA CB sing N N 248 LYS CA HA sing N N 249 LYS C O doub N N 250 LYS C OXT sing N N 251 LYS CB CG sing N N 252 LYS CB HB2 sing N N 253 LYS CB HB3 sing N N 254 LYS CG CD sing N N 255 LYS CG HG2 sing N N 256 LYS CG HG3 sing N N 257 LYS CD CE sing N N 258 LYS CD HD2 sing N N 259 LYS CD HD3 sing N N 260 LYS CE NZ sing N N 261 LYS CE HE2 sing N N 262 LYS CE HE3 sing N N 263 LYS NZ HZ1 sing N N 264 LYS NZ HZ2 sing N N 265 LYS NZ HZ3 sing N N 266 LYS OXT HXT sing N N 267 MET N CA sing N N 268 MET N H sing N N 269 MET N H2 sing N N 270 MET CA C sing N N 271 MET CA CB sing N N 272 MET CA HA sing N N 273 MET C O doub N N 274 MET C OXT sing N N 275 MET CB CG sing N N 276 MET CB HB2 sing N N 277 MET CB HB3 sing N N 278 MET CG SD sing N N 279 MET CG HG2 sing N N 280 MET CG HG3 sing N N 281 MET SD CE sing N N 282 MET CE HE1 sing N N 283 MET CE HE2 sing N N 284 MET CE HE3 sing N N 285 MET OXT HXT sing N N 286 PHE N CA sing N N 287 PHE N H sing N N 288 PHE N H2 sing N N 289 PHE CA C sing N N 290 PHE CA CB sing N N 291 PHE CA HA sing N N 292 PHE C O doub N N 293 PHE C OXT sing N N 294 PHE CB CG sing N N 295 PHE CB HB2 sing N N 296 PHE CB HB3 sing N N 297 PHE CG CD1 doub Y N 298 PHE CG CD2 sing Y N 299 PHE CD1 CE1 sing Y N 300 PHE CD1 HD1 sing N N 301 PHE CD2 CE2 doub Y N 302 PHE CD2 HD2 sing N N 303 PHE CE1 CZ doub Y N 304 PHE CE1 HE1 sing N N 305 PHE CE2 CZ sing Y N 306 PHE CE2 HE2 sing N N 307 PHE CZ HZ sing N N 308 PHE OXT HXT sing N N 309 PRO N CA sing N N 310 PRO N CD sing N N 311 PRO N H sing N N 312 PRO CA C sing N N 313 PRO CA CB sing N N 314 PRO CA HA sing N N 315 PRO C O doub N N 316 PRO C OXT sing N N 317 PRO CB CG sing N N 318 PRO CB HB2 sing N N 319 PRO CB HB3 sing N N 320 PRO CG CD sing N N 321 PRO CG HG2 sing N N 322 PRO CG HG3 sing N N 323 PRO CD HD2 sing N N 324 PRO CD HD3 sing N N 325 PRO OXT HXT sing N N 326 SER N CA sing N N 327 SER N H sing N N 328 SER N H2 sing N N 329 SER CA C sing N N 330 SER CA CB sing N N 331 SER CA HA sing N N 332 SER C O doub N N 333 SER C OXT sing N N 334 SER CB OG sing N N 335 SER CB HB2 sing N N 336 SER CB HB3 sing N N 337 SER OG HG sing N N 338 SER OXT HXT sing N N 339 THR N CA sing N N 340 THR N H sing N N 341 THR N H2 sing N N 342 THR CA C sing N N 343 THR CA CB sing N N 344 THR CA HA sing N N 345 THR C O doub N N 346 THR C OXT sing N N 347 THR CB OG1 sing N N 348 THR CB CG2 sing N N 349 THR CB HB sing N N 350 THR OG1 HG1 sing N N 351 THR CG2 HG21 sing N N 352 THR CG2 HG22 sing N N 353 THR CG2 HG23 sing N N 354 THR OXT HXT sing N N 355 TYR N CA sing N N 356 TYR N H sing N N 357 TYR N H2 sing N N 358 TYR CA C sing N N 359 TYR CA CB sing N N 360 TYR CA HA sing N N 361 TYR C O doub N N 362 TYR C OXT sing N N 363 TYR CB CG sing N N 364 TYR CB HB2 sing N N 365 TYR CB HB3 sing N N 366 TYR CG CD1 doub Y N 367 TYR CG CD2 sing Y N 368 TYR CD1 CE1 sing Y N 369 TYR CD1 HD1 sing N N 370 TYR CD2 CE2 doub Y N 371 TYR CD2 HD2 sing N N 372 TYR CE1 CZ doub Y N 373 TYR CE1 HE1 sing N N 374 TYR CE2 CZ sing Y N 375 TYR CE2 HE2 sing N N 376 TYR CZ OH sing N N 377 TYR OH HH sing N N 378 TYR OXT HXT sing N N 379 VAL N CA sing N N 380 VAL N H sing N N 381 VAL N H2 sing N N 382 VAL CA C sing N N 383 VAL CA CB sing N N 384 VAL CA HA sing N N 385 VAL C O doub N N 386 VAL C OXT sing N N 387 VAL CB CG1 sing N N 388 VAL CB CG2 sing N N 389 VAL CB HB sing N N 390 VAL CG1 HG11 sing N N 391 VAL CG1 HG12 sing N N 392 VAL CG1 HG13 sing N N 393 VAL CG2 HG21 sing N N 394 VAL CG2 HG22 sing N N 395 VAL CG2 HG23 sing N N 396 VAL OXT HXT sing N N 397 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 GTP ? ? GTP ? ? 'SUBJECT OF INVESTIGATION' ? 2 MG ? ? MG ? ? 'SUBJECT OF INVESTIGATION' ? # _atom_sites.entry_id 8JVF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.018148 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018148 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008158 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 MG 12 12 5.4265 2.8275 2.1759 79.2611 1.2283 0.3808 2.3099 7.1937 0.9382 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 P 15 15 6.4348 1.9067 4.1793 27.1570 1.7801 0.5260 1.4909 68.1645 1.2732 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0555 # loop_