data_8K9P # _entry.id 8K9P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8K9P pdb_00008k9p 10.2210/pdb8k9p/pdb WWPDB D_1300039001 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-02-14 2 'Structure model' 1 1 2024-02-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8K9P _pdbx_database_status.recvd_initial_deposition_date 2023-08-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 8K9N _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email y_fukuda@phs.osaka-u.ac.jp _pdbx_contact_author.name_first Yohta _pdbx_contact_author.name_last Fukuda _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7386-8201 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fukuda, Y.' 1 ? 'Kurihara, K.' 2 ? 'Inoue, T.' 3 ? 'Tamada, T.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 63 _citation.language ? _citation.page_first 339 _citation.page_last 347 _citation.title 'Overlooked Hydrogen Bond in a Blue Copper Protein Uncovered by Neutron and Sub- angstrom ngstrom Resolution X-ray Crystallography.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.3c00517 _citation.pdbx_database_id_PubMed 38232298 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fukuda, Y.' 1 ? primary 'Lintuluoto, M.' 2 ? primary 'Kurihara, K.' 3 ? primary 'Hasegawa, K.' 4 ? primary 'Inoue, T.' 5 ? primary 'Tamada, T.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Pseudoazurin 13672.863 1 ? ? ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 72 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Blue copper protein,Cupredoxin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVK CTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK ; _entity_poly.pdbx_seq_one_letter_code_can ;MASENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVK CTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 'SULFATE ION' SO4 4 water DOD # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 GLU n 1 5 ASN n 1 6 ILE n 1 7 GLU n 1 8 VAL n 1 9 HIS n 1 10 MET n 1 11 LEU n 1 12 ASN n 1 13 LYS n 1 14 GLY n 1 15 ALA n 1 16 GLU n 1 17 GLY n 1 18 ALA n 1 19 MET n 1 20 VAL n 1 21 PHE n 1 22 GLU n 1 23 PRO n 1 24 ALA n 1 25 TYR n 1 26 ILE n 1 27 LYS n 1 28 ALA n 1 29 ASN n 1 30 PRO n 1 31 GLY n 1 32 ASP n 1 33 THR n 1 34 VAL n 1 35 THR n 1 36 PHE n 1 37 ILE n 1 38 PRO n 1 39 VAL n 1 40 ASP n 1 41 LYS n 1 42 GLY n 1 43 HIS n 1 44 ASN n 1 45 VAL n 1 46 GLU n 1 47 SER n 1 48 ILE n 1 49 LYS n 1 50 ASP n 1 51 MET n 1 52 ILE n 1 53 PRO n 1 54 GLU n 1 55 GLY n 1 56 ALA n 1 57 GLU n 1 58 LYS n 1 59 PHE n 1 60 LYS n 1 61 SER n 1 62 LYS n 1 63 ILE n 1 64 ASN n 1 65 GLU n 1 66 ASN n 1 67 TYR n 1 68 VAL n 1 69 LEU n 1 70 THR n 1 71 VAL n 1 72 THR n 1 73 GLN n 1 74 PRO n 1 75 GLY n 1 76 ALA n 1 77 TYR n 1 78 LEU n 1 79 VAL n 1 80 LYS n 1 81 CYS n 1 82 THR n 1 83 PRO n 1 84 HIS n 1 85 TYR n 1 86 ALA n 1 87 MET n 1 88 GLY n 1 89 MET n 1 90 ILE n 1 91 ALA n 1 92 LEU n 1 93 ILE n 1 94 ALA n 1 95 VAL n 1 96 GLY n 1 97 ASP n 1 98 SER n 1 99 PRO n 1 100 ALA n 1 101 ASN n 1 102 LEU n 1 103 ASP n 1 104 GLN n 1 105 ILE n 1 106 VAL n 1 107 SER n 1 108 ALA n 1 109 LYS n 1 110 LYS n 1 111 PRO n 1 112 LYS n 1 113 ILE n 1 114 VAL n 1 115 GLN n 1 116 GLU n 1 117 ARG n 1 118 LEU n 1 119 GLU n 1 120 LYS n 1 121 VAL n 1 122 ILE n 1 123 ALA n 1 124 SER n 1 125 ALA n 1 126 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 126 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Alcaligenes faecalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 511 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -2 ? ? ? A . n A 1 2 ALA 2 -1 -1 ALA ALA A . n A 1 3 SER 3 0 0 SER SER A . n A 1 4 GLU 4 1 1 GLU GLU A . n A 1 5 ASN 5 2 2 ASN ASN A . n A 1 6 ILE 6 3 3 ILE ILE A . n A 1 7 GLU 7 4 4 GLU GLU A . n A 1 8 VAL 8 5 5 VAL VAL A . n A 1 9 HIS 9 6 6 HIS HIS A . n A 1 10 MET 10 7 7 MET MET A . n A 1 11 LEU 11 8 8 LEU LEU A . n A 1 12 ASN 12 9 9 ASN ASN A . n A 1 13 LYS 13 10 10 LYS LYS A . n A 1 14 GLY 14 11 11 GLY GLY A . n A 1 15 ALA 15 12 12 ALA ALA A . n A 1 16 GLU 16 13 13 GLU GLU A . n A 1 17 GLY 17 14 14 GLY GLY A . n A 1 18 ALA 18 15 15 ALA ALA A . n A 1 19 MET 19 16 16 MET MET A . n A 1 20 VAL 20 17 17 VAL VAL A . n A 1 21 PHE 21 18 18 PHE PHE A . n A 1 22 GLU 22 19 19 GLU GLU A . n A 1 23 PRO 23 20 20 PRO PRO A . n A 1 24 ALA 24 21 21 ALA ALA A . n A 1 25 TYR 25 22 22 TYR TYR A . n A 1 26 ILE 26 23 23 ILE ILE A . n A 1 27 LYS 27 24 24 LYS LYS A . n A 1 28 ALA 28 25 25 ALA ALA A . n A 1 29 ASN 29 26 26 ASN ASN A . n A 1 30 PRO 30 27 27 PRO PRO A . n A 1 31 GLY 31 28 28 GLY GLY A . n A 1 32 ASP 32 29 29 ASP ASP A . n A 1 33 THR 33 30 30 THR THR A . n A 1 34 VAL 34 31 31 VAL VAL A . n A 1 35 THR 35 32 32 THR THR A . n A 1 36 PHE 36 33 33 PHE PHE A . n A 1 37 ILE 37 34 34 ILE ILE A . n A 1 38 PRO 38 35 35 PRO PRO A . n A 1 39 VAL 39 36 36 VAL VAL A . n A 1 40 ASP 40 37 37 ASP ASP A . n A 1 41 LYS 41 38 38 LYS LYS A . n A 1 42 GLY 42 39 39 GLY GLY A . n A 1 43 HIS 43 40 40 HIS HIS A . n A 1 44 ASN 44 41 41 ASN ASN A . n A 1 45 VAL 45 42 42 VAL VAL A . n A 1 46 GLU 46 43 43 GLU GLU A . n A 1 47 SER 47 44 44 SER SER A . n A 1 48 ILE 48 45 45 ILE ILE A . n A 1 49 LYS 49 46 46 LYS LYS A . n A 1 50 ASP 50 47 47 ASP ASP A . n A 1 51 MET 51 48 48 MET MET A . n A 1 52 ILE 52 49 49 ILE ILE A . n A 1 53 PRO 53 50 50 PRO PRO A . n A 1 54 GLU 54 51 51 GLU GLU A . n A 1 55 GLY 55 52 52 GLY GLY A . n A 1 56 ALA 56 53 53 ALA ALA A . n A 1 57 GLU 57 54 54 GLU GLU A . n A 1 58 LYS 58 55 55 LYS LYS A . n A 1 59 PHE 59 56 56 PHE PHE A . n A 1 60 LYS 60 57 57 LYS LYS A . n A 1 61 SER 61 58 58 SER SER A . n A 1 62 LYS 62 59 59 LYS LYS A . n A 1 63 ILE 63 60 60 ILE ILE A . n A 1 64 ASN 64 61 61 ASN ASN A . n A 1 65 GLU 65 62 62 GLU GLU A . n A 1 66 ASN 66 63 63 ASN ASN A . n A 1 67 TYR 67 64 64 TYR TYR A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 LEU 69 66 66 LEU LEU A . n A 1 70 THR 70 67 67 THR THR A . n A 1 71 VAL 71 68 68 VAL VAL A . n A 1 72 THR 72 69 69 THR THR A . n A 1 73 GLN 73 70 70 GLN GLN A . n A 1 74 PRO 74 71 71 PRO PRO A . n A 1 75 GLY 75 72 72 GLY GLY A . n A 1 76 ALA 76 73 73 ALA ALA A . n A 1 77 TYR 77 74 74 TYR TYR A . n A 1 78 LEU 78 75 75 LEU LEU A . n A 1 79 VAL 79 76 76 VAL VAL A . n A 1 80 LYS 80 77 77 LYS LYS A . n A 1 81 CYS 81 78 78 CYS CYS A . n A 1 82 THR 82 79 79 THR THR A . n A 1 83 PRO 83 80 80 PRO PRO A . n A 1 84 HIS 84 81 81 HIS HIS A . n A 1 85 TYR 85 82 82 TYR TYR A . n A 1 86 ALA 86 83 83 ALA ALA A . n A 1 87 MET 87 84 84 MET MET A . n A 1 88 GLY 88 85 85 GLY GLY A . n A 1 89 MET 89 86 86 MET MET A . n A 1 90 ILE 90 87 87 ILE ILE A . n A 1 91 ALA 91 88 88 ALA ALA A . n A 1 92 LEU 92 89 89 LEU LEU A . n A 1 93 ILE 93 90 90 ILE ILE A . n A 1 94 ALA 94 91 91 ALA ALA A . n A 1 95 VAL 95 92 92 VAL VAL A . n A 1 96 GLY 96 93 93 GLY GLY A . n A 1 97 ASP 97 94 94 ASP ASP A . n A 1 98 SER 98 95 95 SER SER A . n A 1 99 PRO 99 96 96 PRO PRO A . n A 1 100 ALA 100 97 97 ALA ALA A . n A 1 101 ASN 101 98 98 ASN ASN A . n A 1 102 LEU 102 99 99 LEU LEU A . n A 1 103 ASP 103 100 100 ASP ASP A . n A 1 104 GLN 104 101 101 GLN GLN A . n A 1 105 ILE 105 102 102 ILE ILE A . n A 1 106 VAL 106 103 103 VAL VAL A . n A 1 107 SER 107 104 104 SER SER A . n A 1 108 ALA 108 105 105 ALA ALA A . n A 1 109 LYS 109 106 106 LYS LYS A . n A 1 110 LYS 110 107 107 LYS LYS A . n A 1 111 PRO 111 108 108 PRO PRO A . n A 1 112 LYS 112 109 109 LYS LYS A . n A 1 113 ILE 113 110 110 ILE ILE A . n A 1 114 VAL 114 111 111 VAL VAL A . n A 1 115 GLN 115 112 112 GLN GLN A . n A 1 116 GLU 116 113 113 GLU GLU A . n A 1 117 ARG 117 114 114 ARG ARG A . n A 1 118 LEU 118 115 115 LEU LEU A . n A 1 119 GLU 119 116 116 GLU GLU A . n A 1 120 LYS 120 117 117 LYS LYS A . n A 1 121 VAL 121 118 118 VAL VAL A . n A 1 122 ILE 122 119 119 ILE ILE A . n A 1 123 ALA 123 120 120 ALA ALA A . n A 1 124 SER 124 121 121 SER SER A . n A 1 125 ALA 125 122 122 ALA ALA A . n A 1 126 LYS 126 123 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 201 224 CU CU A . C 3 SO4 1 202 1 SO4 SO4 A . D 4 DOD 1 301 84 DOD DOD A . D 4 DOD 2 302 59 DOD DOD A . D 4 DOD 3 303 40 DOD DOD A . D 4 DOD 4 304 12 DOD DOD A . D 4 DOD 5 305 69 DOD DOD A . D 4 DOD 6 306 66 DOD DOD A . D 4 DOD 7 307 67 DOD DOD A . D 4 DOD 8 308 78 DOD DOD A . D 4 DOD 9 309 2 DOD DOD A . D 4 DOD 10 310 6 DOD DOD A . D 4 DOD 11 311 36 DOD DOD A . D 4 DOD 12 312 81 DOD DOD A . D 4 DOD 13 313 33 DOD DOD A . D 4 DOD 14 314 88 DOD DOD A . D 4 DOD 15 315 4 DOD DOD A . D 4 DOD 16 316 8 DOD DOD A . D 4 DOD 17 317 75 DOD DOD A . D 4 DOD 18 318 3 DOD DOD A . D 4 DOD 19 319 20 DOD DOD A . D 4 DOD 20 320 58 DOD DOD A . D 4 DOD 21 321 45 DOD DOD A . D 4 DOD 22 322 74 DOD DOD A . D 4 DOD 23 323 25 DOD DOD A . D 4 DOD 24 324 89 DOD DOD A . D 4 DOD 25 325 18 DOD DOD A . D 4 DOD 26 326 5 DOD DOD A . D 4 DOD 27 327 1 DOD DOD A . D 4 DOD 28 328 77 DOD DOD A . D 4 DOD 29 329 31 DOD DOD A . D 4 DOD 30 330 19 DOD DOD A . D 4 DOD 31 331 34 DOD DOD A . D 4 DOD 32 332 14 DOD DOD A . D 4 DOD 33 333 62 DOD DOD A . D 4 DOD 34 334 35 DOD DOD A . D 4 DOD 35 335 11 DOD DOD A . D 4 DOD 36 336 80 DOD DOD A . D 4 DOD 37 337 26 DOD DOD A . D 4 DOD 38 338 32 DOD DOD A . D 4 DOD 39 339 22 DOD DOD A . D 4 DOD 40 340 76 DOD DOD A . D 4 DOD 41 341 79 DOD DOD A . D 4 DOD 42 342 10 DOD DOD A . D 4 DOD 43 343 39 DOD DOD A . D 4 DOD 44 344 21 DOD DOD A . D 4 DOD 45 345 70 DOD DOD A . D 4 DOD 46 346 29 DOD DOD A . D 4 DOD 47 347 42 DOD DOD A . D 4 DOD 48 348 72 DOD DOD A . D 4 DOD 49 349 9 DOD DOD A . D 4 DOD 50 350 87 DOD DOD A . D 4 DOD 51 351 71 DOD DOD A . D 4 DOD 52 352 7 DOD DOD A . D 4 DOD 53 353 17 DOD DOD A . D 4 DOD 54 354 61 DOD DOD A . D 4 DOD 55 355 68 DOD DOD A . D 4 DOD 56 356 24 DOD DOD A . D 4 DOD 57 357 28 DOD DOD A . D 4 DOD 58 358 30 DOD DOD A . D 4 DOD 59 359 85 DOD DOD A . D 4 DOD 60 360 23 DOD DOD A . D 4 DOD 61 361 83 DOD DOD A . D 4 DOD 62 362 37 DOD DOD A . D 4 DOD 63 363 27 DOD DOD A . D 4 DOD 64 364 60 DOD DOD A . D 4 DOD 65 365 38 DOD DOD A . D 4 DOD 66 366 13 DOD DOD A . D 4 DOD 67 367 41 DOD DOD A . D 4 DOD 68 368 63 DOD DOD A . D 4 DOD 69 369 65 DOD DOD A . D 4 DOD 70 370 86 DOD DOD A . D 4 DOD 71 371 82 DOD DOD A . D 4 DOD 72 372 16 DOD DOD A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.dependencies _software.description _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.pdbx_ordinal _software.type _software.version ? 'data reduction' ? ? ? ? ? ? 'for neutron' ? ? ? ? DENZO ? ? 1 ? . ? 'data scaling' ? ? ? ? ? ? 'for neutron' ? ? ? ? SCALEPACK ? ? 2 ? . ? phasing ? ? ? ? ? ? 'for x-ray and neutron' ? ? ? ? MOLREP ? ? 3 ? . ? refinement ? ? ? ? ? ? 'for x-ray and neutron' ? ? ? ? PHENIX ? ? 4 ? 1.19.2_4158 ? 'data reduction' ? ? ? ? ? ? 'for x-ray' ? ? ? ? XDS ? ? 5 ? . ? 'data scaling' ? ? ? ? ? ? 'for x-ray' ? ? ? ? Aimless ? ? 6 ? . # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8K9P _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.168 _cell.length_a_esd ? _cell.length_b 50.168 _cell.length_b_esd ? _cell.length_c 98.292 _cell.length_c_esd ? _cell.volume 214240.898 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8K9P _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall 'P 65' _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.entry_id _exptl.crystals_number _exptl.details _exptl.method _exptl.method_details ? ? ? ? ? 8K9P 1 ? 'X-RAY DIFFRACTION' ? ? ? ? ? ? 8K9P ? ? 'NEUTRON DIFFRACTION' ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.61 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.90 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.8 M deuterated ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 293 'room temperature' ? 1 ? ? ? 1 ? ? ? ? ? ? N ? 293 'room temperature' ? 1 ? ? ? 2 ? ? ? ? ? ? N # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date _diffrn_detector.pdbx_frequency _diffrn_detector.id _diffrn_detector.number_of_axes ? 'IMAGE PLATE' 1 'LADI III' ? ? ? ? 2022-07-19 ? ? ? ? PIXEL 2 'DECTRIS PILATUS3 S 6M' ? ? ? ? 2022-10-20 ? ? ? # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? 'Si(111)' ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? neutron # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.0000 1.0 2 2.9 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'PHOTON FACTORY BEAMLINE BL-5A' ? ? 1.0000 ? BL-5A 'Photon Factory' ? ? 2 ? ? 'NUCLEAR REACTOR' ? 'JRR-3M BEAMLINE 1G-A' ? ? 2.9 ? 1G-A JRR-3M # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_CC_star _reflns.pdbx_R_split _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_CC_split_method _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] _reflns.pdbx_aniso_diffraction_limit_1 _reflns.pdbx_aniso_diffraction_limit_2 _reflns.pdbx_aniso_diffraction_limit_3 _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvalue_1 _reflns.pdbx_aniso_B_tensor_eigenvalue_2 _reflns.pdbx_aniso_B_tensor_eigenvalue_3 _reflns.pdbx_orthogonalization_convention _reflns.pdbx_percent_possible_ellipsoidal _reflns.pdbx_percent_possible_spherical _reflns.pdbx_percent_possible_ellipsoidal_anomalous _reflns.pdbx_percent_possible_spherical_anomalous _reflns.pdbx_redundancy_anomalous _reflns.pdbx_CC_half_anomalous _reflns.pdbx_absDiff_over_sigma_anomalous _reflns.pdbx_percent_possible_anomalous _reflns.pdbx_observed_signal_threshold _reflns.pdbx_signal_type _reflns.pdbx_signal_details _reflns.pdbx_signal_software_id 18.25 8K9P ? ? 1.30 49.15 ? ? ? ? ? ? ? ? 34425 ? ? ? ? ? ? ? 100 ? ? ? ? ? ? 10.1 ? 16.9 ? ? ? ? ? ? ? ? ? 0.023 ? ? 1 1 0.998 ? ? 0.071 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 18.25 8K9P ? ? 1.90 100 ? ? ? ? ? ? ? ? 9935 ? ? ? ? ? ? ? 90 ? ? ? ? ? ? 2.8 ? 6.99 ? ? ? ? ? ? ? ? ? 0.074 ? ? 2 2 0.988 ? ? 0.108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.30 1.32 ? 2.4 ? ? ? ? 1707 ? ? ? ? ? ? ? ? ? ? ? 9.1 ? ? ? ? 0.310 ? 1 1 0.808 ? ? 99.4 ? 0.895 ? ? ? ? ? ? ? ? ? 1.90 1.97 ? 2.09 ? ? ? ? 914 ? ? ? ? ? ? ? ? ? ? ? 1.8 ? ? ? ? 0.355 ? 2 2 0.602 ? ? 83.7 ? 0.396 ? ? ? ? ? ? ? ? ? # loop_ _refine.aniso_B[1][1] _refine.aniso_B[1][2] _refine.aniso_B[1][3] _refine.aniso_B[2][2] _refine.aniso_B[2][3] _refine.aniso_B[3][3] _refine.B_iso_max _refine.B_iso_mean _refine.B_iso_min _refine.correlation_coeff_Fo_to_Fc _refine.correlation_coeff_Fo_to_Fc_free _refine.details _refine.diff_density_max _refine.diff_density_max_esd _refine.diff_density_min _refine.diff_density_min_esd _refine.diff_density_rms _refine.diff_density_rms_esd _refine.entry_id _refine.pdbx_refine_id _refine.ls_abs_structure_details _refine.ls_abs_structure_Flack _refine.ls_abs_structure_Flack_esd _refine.ls_abs_structure_Rogers _refine.ls_abs_structure_Rogers_esd _refine.ls_d_res_high _refine.ls_d_res_low _refine.ls_extinction_coef _refine.ls_extinction_coef_esd _refine.ls_extinction_expression _refine.ls_extinction_method _refine.ls_goodness_of_fit_all _refine.ls_goodness_of_fit_all_esd _refine.ls_goodness_of_fit_obs _refine.ls_goodness_of_fit_obs_esd _refine.ls_hydrogen_treatment _refine.ls_matrix_type _refine.ls_number_constraints _refine.ls_number_parameters _refine.ls_number_reflns_all _refine.ls_number_reflns_obs _refine.ls_number_reflns_R_free _refine.ls_number_reflns_R_work _refine.ls_number_restraints _refine.ls_percent_reflns_obs _refine.ls_percent_reflns_R_free _refine.ls_R_factor_all _refine.ls_R_factor_obs _refine.ls_R_factor_R_free _refine.ls_R_factor_R_free_error _refine.ls_R_factor_R_free_error_details _refine.ls_R_factor_R_work _refine.ls_R_Fsqd_factor_obs _refine.ls_R_I_factor_obs _refine.ls_redundancy_reflns_all _refine.ls_redundancy_reflns_obs _refine.ls_restrained_S_all _refine.ls_restrained_S_obs _refine.ls_shift_over_esd_max _refine.ls_shift_over_esd_mean _refine.ls_structure_factor_coef _refine.ls_weighting_details _refine.ls_weighting_scheme _refine.ls_wR_factor_all _refine.ls_wR_factor_obs _refine.ls_wR_factor_R_free _refine.ls_wR_factor_R_work _refine.occupancy_max _refine.occupancy_min _refine.solvent_model_details _refine.solvent_model_param_bsol _refine.solvent_model_param_ksol _refine.pdbx_R_complete _refine.ls_R_factor_gt _refine.ls_goodness_of_fit_gt _refine.ls_goodness_of_fit_ref _refine.ls_shift_over_su_max _refine.ls_shift_over_su_max_lt _refine.ls_shift_over_su_mean _refine.ls_shift_over_su_mean_lt _refine.pdbx_ls_sigma_I _refine.pdbx_ls_sigma_F _refine.pdbx_ls_sigma_Fsqd _refine.pdbx_data_cutoff_high_absF _refine.pdbx_data_cutoff_high_rms_absF _refine.pdbx_data_cutoff_low_absF _refine.pdbx_isotropic_thermal_model _refine.pdbx_ls_cross_valid_method _refine.pdbx_method_to_determine_struct _refine.pdbx_starting_model _refine.pdbx_stereochemistry_target_values _refine.pdbx_R_Free_selection_details _refine.pdbx_stereochem_target_val_spec_case _refine.pdbx_overall_ESU_R _refine.pdbx_overall_ESU_R_Free _refine.pdbx_solvent_vdw_probe_radii _refine.pdbx_solvent_ion_probe_radii _refine.pdbx_solvent_shrinkage_radii _refine.pdbx_real_space_R _refine.pdbx_density_correlation _refine.pdbx_pd_number_of_powder_patterns _refine.pdbx_pd_number_of_points _refine.pdbx_pd_meas_number_of_points _refine.pdbx_pd_proc_ls_prof_R_factor _refine.pdbx_pd_proc_ls_prof_wR_factor _refine.pdbx_pd_Marquardt_correlation_coeff _refine.pdbx_pd_Fsqrd_R_factor _refine.pdbx_pd_ls_matrix_band_width _refine.pdbx_overall_phase_error _refine.pdbx_overall_SU_R_free_Cruickshank_DPI _refine.pdbx_overall_SU_R_free_Blow_DPI _refine.pdbx_overall_SU_R_Blow_DPI _refine.pdbx_TLS_residual_ADP_flag _refine.pdbx_diffrn_id _refine.overall_SU_B _refine.overall_SU_ML _refine.overall_SU_R_Cruickshank_DPI _refine.overall_SU_R_free _refine.overall_FOM_free_R_set _refine.overall_FOM_work_R_set _refine.pdbx_average_fsc_overall _refine.pdbx_average_fsc_work _refine.pdbx_average_fsc_free ? ? ? ? ? ? ? 45.00 ? ? ? ? ? ? ? ? ? ? 8K9P 'X-RAY DIFFRACTION' ? ? ? ? ? 1.50 43.45 ? ? ? ? ? ? ? ? ? ? ? ? ? 22422 2272 20150 ? 100.00 10.13 ? 0.1330 0.1692 ? ? 0.1288 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'FLAT BULK SOLVENT MODEL' ? ? ? ? ? ? ? ? ? ? ? 1.38 ? ? ? ? ? 'FREE R-VALUE' 'MOLECULAR REPLACEMENT' ? 'GeoStd + Monomer Library + CDL v1.2' ? ? ? ? 1.1100 ? 0.9000 ? ? ? ? ? ? ? ? ? ? 17.3164 ? ? ? ? 1 ? 0.1168 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8K9P 'NEUTRON DIFFRACTION' ? ? ? ? ? 1.90 39.7 ? ? ? ? ? ? ? ? ? ? ? ? ? 9921 ? ? ? 90.04 ? ? ? 0.277 ? ? 0.213 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'FLAT BULK SOLVENT MODEL' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'FREE R-VALUE' 'MOLECULAR REPLACEMENT' ? 'GeoStd + Monomer Library + CDL v1.2' ? ? ? ? 1.1100 ? 0.9000 ? ? ? ? ? ? ? ? ? ? 17.3164 ? ? ? ? 2 ? 0.1168 ? ? ? ? ? ? ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 938 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 72 _refine_hist.number_atoms_total 1016 _refine_hist.d_res_high 1.50 _refine_hist.d_res_low 43.45 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0093 ? 2156 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2129 ? 3784 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0678 ? 164 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0091 ? 345 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.7808 ? 537 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.50 1.53 . . 136 1275 100.00 . . . . 0.1277 . . . . . . . . . . . 0.1855 'X-RAY DIFFRACTION' 1.53 1.57 . . 137 1255 100.00 . . . . 0.1191 . . . . . . . . . . . 0.1551 'X-RAY DIFFRACTION' 1.57 1.61 . . 139 1261 100.00 . . . . 0.1171 . . . . . . . . . . . 0.1851 'X-RAY DIFFRACTION' 1.61 1.65 . . 145 1238 100.00 . . . . 0.1252 . . . . . . . . . . . 0.1904 'X-RAY DIFFRACTION' 1.65 1.70 . . 140 1261 100.00 . . . . 0.1547 . . . . . . . . . . . 0.2191 'X-RAY DIFFRACTION' 1.70 1.75 . . 137 1249 100.00 . . . . 0.1435 . . . . . . . . . . . 0.2106 'X-RAY DIFFRACTION' 1.75 1.82 . . 140 1267 100.00 . . . . 0.1217 . . . . . . . . . . . 0.1411 'X-RAY DIFFRACTION' 1.82 1.89 . . 142 1259 99.93 . . . . 0.1215 . . . . . . . . . . . 0.1409 'X-RAY DIFFRACTION' 1.89 1.98 . . 145 1258 100.00 . . . . 0.1173 . . . . . . . . . . . 0.1824 'X-RAY DIFFRACTION' 1.98 2.08 . . 146 1259 100.00 . . . . 0.1301 . . . . . . . . . . . 0.1684 'X-RAY DIFFRACTION' 2.08 2.21 . . 148 1252 100.00 . . . . 0.1294 . . . . . . . . . . . 0.1724 'X-RAY DIFFRACTION' 2.21 2.38 . . 141 1264 100.00 . . . . 0.1301 . . . . . . . . . . . 0.1638 'X-RAY DIFFRACTION' 2.38 2.62 . . 141 1255 100.00 . . . . 0.1369 . . . . . . . . . . . 0.1886 'X-RAY DIFFRACTION' 2.62 3.00 . . 140 1260 100.00 . . . . 0.1526 . . . . . . . . . . . 0.1888 'X-RAY DIFFRACTION' 3.00 3.77 . . 141 1265 100.00 . . . . 0.1279 . . . . . . . . . . . 0.1852 'X-RAY DIFFRACTION' 3.78 43.45 . . 154 1272 100.00 . . . . 0.1166 . . . . . . . . . . . 0.1401 # _struct.entry_id 8K9P _struct.title 'Neutron X-ray joint structure of pseudoazurin from Alcaligenes faecalis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8K9P _struct_keywords.text 'blue copper, electron transfer, ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AZUP_ALCFA _struct_ref.pdbx_db_accession P04377 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTP HYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8K9P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 126 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04377 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 123 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8K9P MET A 1 ? UNP P04377 ? ? 'expression tag' -2 1 1 8K9P ALA A 2 ? UNP P04377 ? ? 'expression tag' -1 2 1 8K9P SER A 3 ? UNP P04377 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7250 ? 1 MORE -6 ? 1 'SSA (A^2)' 7270 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 84 ? GLY A 88 ? HIS A 81 GLY A 85 5 ? 5 HELX_P HELX_P2 AA2 ASN A 101 ? ALA A 108 ? ASN A 98 ALA A 105 1 ? 8 HELX_P HELX_P3 AA3 PRO A 111 ? SER A 124 ? PRO A 108 SER A 121 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 43 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 40 A CU 201 1_555 ? ? ? ? ? ? ? 1.989 ? ? metalc2 metalc ? ? A CYS 81 SG ? ? ? 1_555 B CU . CU ? ? A CYS 78 A CU 201 1_555 ? ? ? ? ? ? ? 2.111 ? ? metalc3 metalc ? ? A HIS 84 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 81 A CU 201 1_555 ? ? ? ? ? ? ? 1.965 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 43 ? A HIS 40 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 SG ? A CYS 81 ? A CYS 78 ? 1_555 135.9 ? 2 ND1 ? A HIS 43 ? A HIS 40 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 ND1 ? A HIS 84 ? A HIS 81 ? 1_555 101.9 ? 3 SG ? A CYS 81 ? A CYS 78 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 ND1 ? A HIS 84 ? A HIS 81 ? 1_555 111.5 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 22 A . ? GLU 19 A PRO 23 A ? PRO 20 A 1 2.16 2 GLU 22 A . ? GLU 19 A PRO 23 A ? PRO 20 A 1 -2.46 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 17 ? GLU A 22 ? GLY A 14 GLU A 19 AA1 2 ASN A 5 ? GLY A 14 ? ASN A 2 GLY A 11 AA1 3 THR A 33 ? PRO A 38 ? THR A 30 PRO A 35 AA1 4 TYR A 67 ? THR A 70 ? TYR A 64 THR A 67 AA2 1 TYR A 25 ? ALA A 28 ? TYR A 22 ALA A 25 AA2 2 ILE A 90 ? VAL A 95 ? ILE A 87 VAL A 92 AA2 3 GLY A 75 ? LYS A 80 ? GLY A 72 LYS A 77 AA2 4 GLU A 46 ? SER A 47 ? GLU A 43 SER A 44 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 22 ? O GLU A 19 N HIS A 9 ? N HIS A 6 AA1 2 3 N VAL A 8 ? N VAL A 5 O ILE A 37 ? O ILE A 34 AA1 3 4 N PHE A 36 ? N PHE A 33 O TYR A 67 ? O TYR A 64 AA2 1 2 N ILE A 26 ? N ILE A 23 O ALA A 94 ? O ALA A 91 AA2 2 3 O VAL A 95 ? O VAL A 92 N GLY A 75 ? N GLY A 72 AA2 3 4 O LYS A 80 ? O LYS A 77 N GLU A 46 ? N GLU A 43 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 16 ? ? 63.33 78.89 2 1 SER A 121 ? ? -66.52 11.59 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 -x,-y,z+1/2 # _pdbx_entry_details.entry_id 8K9P _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -2 ? A MET 1 2 1 Y 1 A LYS 123 ? A LYS 126 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU CU CU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 DOD O O N N 89 DOD D1 D N N 90 DOD D2 D N N 91 GLN N N N N 92 GLN CA C N S 93 GLN C C N N 94 GLN O O N N 95 GLN CB C N N 96 GLN CG C N N 97 GLN CD C N N 98 GLN OE1 O N N 99 GLN NE2 N N N 100 GLN OXT O N N 101 GLN H H N N 102 GLN H2 H N N 103 GLN HA H N N 104 GLN HB2 H N N 105 GLN HB3 H N N 106 GLN HG2 H N N 107 GLN HG3 H N N 108 GLN HE21 H N N 109 GLN HE22 H N N 110 GLN HXT H N N 111 GLU N N N N 112 GLU CA C N S 113 GLU C C N N 114 GLU O O N N 115 GLU CB C N N 116 GLU CG C N N 117 GLU CD C N N 118 GLU OE1 O N N 119 GLU OE2 O N N 120 GLU OXT O N N 121 GLU H H N N 122 GLU H2 H N N 123 GLU HA H N N 124 GLU HB2 H N N 125 GLU HB3 H N N 126 GLU HG2 H N N 127 GLU HG3 H N N 128 GLU HE2 H N N 129 GLU HXT H N N 130 GLY N N N N 131 GLY CA C N N 132 GLY C C N N 133 GLY O O N N 134 GLY OXT O N N 135 GLY H H N N 136 GLY H2 H N N 137 GLY HA2 H N N 138 GLY HA3 H N N 139 GLY HXT H N N 140 HIS N N N N 141 HIS CA C N S 142 HIS C C N N 143 HIS O O N N 144 HIS CB C N N 145 HIS CG C Y N 146 HIS ND1 N Y N 147 HIS CD2 C Y N 148 HIS CE1 C Y N 149 HIS NE2 N Y N 150 HIS OXT O N N 151 HIS H H N N 152 HIS H2 H N N 153 HIS HA H N N 154 HIS HB2 H N N 155 HIS HB3 H N N 156 HIS HD1 H N N 157 HIS HD2 H N N 158 HIS HE1 H N N 159 HIS HE2 H N N 160 HIS HXT H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TYR N N N N 327 TYR CA C N S 328 TYR C C N N 329 TYR O O N N 330 TYR CB C N N 331 TYR CG C Y N 332 TYR CD1 C Y N 333 TYR CD2 C Y N 334 TYR CE1 C Y N 335 TYR CE2 C Y N 336 TYR CZ C Y N 337 TYR OH O N N 338 TYR OXT O N N 339 TYR H H N N 340 TYR H2 H N N 341 TYR HA H N N 342 TYR HB2 H N N 343 TYR HB3 H N N 344 TYR HD1 H N N 345 TYR HD2 H N N 346 TYR HE1 H N N 347 TYR HE2 H N N 348 TYR HH H N N 349 TYR HXT H N N 350 VAL N N N N 351 VAL CA C N S 352 VAL C C N N 353 VAL O O N N 354 VAL CB C N N 355 VAL CG1 C N N 356 VAL CG2 C N N 357 VAL OXT O N N 358 VAL H H N N 359 VAL H2 H N N 360 VAL HA H N N 361 VAL HB H N N 362 VAL HG11 H N N 363 VAL HG12 H N N 364 VAL HG13 H N N 365 VAL HG21 H N N 366 VAL HG22 H N N 367 VAL HG23 H N N 368 VAL HXT H N N 369 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DOD O D1 sing N N 83 DOD O D2 sing N N 84 GLN N CA sing N N 85 GLN N H sing N N 86 GLN N H2 sing N N 87 GLN CA C sing N N 88 GLN CA CB sing N N 89 GLN CA HA sing N N 90 GLN C O doub N N 91 GLN C OXT sing N N 92 GLN CB CG sing N N 93 GLN CB HB2 sing N N 94 GLN CB HB3 sing N N 95 GLN CG CD sing N N 96 GLN CG HG2 sing N N 97 GLN CG HG3 sing N N 98 GLN CD OE1 doub N N 99 GLN CD NE2 sing N N 100 GLN NE2 HE21 sing N N 101 GLN NE2 HE22 sing N N 102 GLN OXT HXT sing N N 103 GLU N CA sing N N 104 GLU N H sing N N 105 GLU N H2 sing N N 106 GLU CA C sing N N 107 GLU CA CB sing N N 108 GLU CA HA sing N N 109 GLU C O doub N N 110 GLU C OXT sing N N 111 GLU CB CG sing N N 112 GLU CB HB2 sing N N 113 GLU CB HB3 sing N N 114 GLU CG CD sing N N 115 GLU CG HG2 sing N N 116 GLU CG HG3 sing N N 117 GLU CD OE1 doub N N 118 GLU CD OE2 sing N N 119 GLU OE2 HE2 sing N N 120 GLU OXT HXT sing N N 121 GLY N CA sing N N 122 GLY N H sing N N 123 GLY N H2 sing N N 124 GLY CA C sing N N 125 GLY CA HA2 sing N N 126 GLY CA HA3 sing N N 127 GLY C O doub N N 128 GLY C OXT sing N N 129 GLY OXT HXT sing N N 130 HIS N CA sing N N 131 HIS N H sing N N 132 HIS N H2 sing N N 133 HIS CA C sing N N 134 HIS CA CB sing N N 135 HIS CA HA sing N N 136 HIS C O doub N N 137 HIS C OXT sing N N 138 HIS CB CG sing N N 139 HIS CB HB2 sing N N 140 HIS CB HB3 sing N N 141 HIS CG ND1 sing Y N 142 HIS CG CD2 doub Y N 143 HIS ND1 CE1 doub Y N 144 HIS ND1 HD1 sing N N 145 HIS CD2 NE2 sing Y N 146 HIS CD2 HD2 sing N N 147 HIS CE1 NE2 sing Y N 148 HIS CE1 HE1 sing N N 149 HIS NE2 HE2 sing N N 150 HIS OXT HXT sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TYR N CA sing N N 310 TYR N H sing N N 311 TYR N H2 sing N N 312 TYR CA C sing N N 313 TYR CA CB sing N N 314 TYR CA HA sing N N 315 TYR C O doub N N 316 TYR C OXT sing N N 317 TYR CB CG sing N N 318 TYR CB HB2 sing N N 319 TYR CB HB3 sing N N 320 TYR CG CD1 doub Y N 321 TYR CG CD2 sing Y N 322 TYR CD1 CE1 sing Y N 323 TYR CD1 HD1 sing N N 324 TYR CD2 CE2 doub Y N 325 TYR CD2 HD2 sing N N 326 TYR CE1 CZ doub Y N 327 TYR CE1 HE1 sing N N 328 TYR CE2 CZ sing Y N 329 TYR CE2 HE2 sing N N 330 TYR CZ OH sing N N 331 TYR OH HH sing N N 332 TYR OXT HXT sing N N 333 VAL N CA sing N N 334 VAL N H sing N N 335 VAL N H2 sing N N 336 VAL CA C sing N N 337 VAL CA CB sing N N 338 VAL CA HA sing N N 339 VAL C O doub N N 340 VAL C OXT sing N N 341 VAL CB CG1 sing N N 342 VAL CB CG2 sing N N 343 VAL CB HB sing N N 344 VAL CG1 HG11 sing N N 345 VAL CG1 HG12 sing N N 346 VAL CG1 HG13 sing N N 347 VAL CG2 HG21 sing N N 348 VAL CG2 HG22 sing N N 349 VAL CG2 HG23 sing N N 350 VAL OXT HXT sing N N 351 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CU _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CU _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1PAZ _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 65' _space_group.name_Hall 'P 65' _space_group.IT_number 170 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 8K9P _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019933 _atom_sites.fract_transf_matrix[1][2] 0.011508 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023017 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010174 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? ? ? ? ? ? ? ? ? 6.64599990845 'Custom 0-Gaussian' ? CU ? ? ? ? ? ? ? ? ? ? 7.71799993515 'Custom 0-Gaussian' ? D ? ? ? ? ? ? ? ? ? ? 6.67100000381 'Custom 0-Gaussian' ? H ? ? ? ? ? ? ? ? ? ? -3.73900008202 'Custom 0-Gaussian' ? N ? ? ? ? ? ? ? ? ? ? 9.35999965668 'Custom 0-Gaussian' ? O ? ? ? ? ? ? ? ? ? ? 5.8029999733 'Custom 0-Gaussian' ? S ? ? ? ? ? ? ? ? ? ? 2.84699988365 'Custom 0-Gaussian' ? # loop_