data_8OT1 # _entry.id 8OT1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.386 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8OT1 pdb_00008ot1 10.2210/pdb8ot1/pdb WWPDB D_1292129974 ? ? EMDB EMD-17166 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8OT1 _pdbx_database_status.recvd_initial_deposition_date 2023-04-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'unseeded Abeta(1-40) amyloid fibril (morphology i)' _pdbx_database_related.db_id EMD-17166 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_contact_author.id 3 _pdbx_contact_author.email marcus.faendrich@uni-ulm.de _pdbx_contact_author.name_first Marcus _pdbx_contact_author.name_last Faendrich _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2123-6816 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pfeiffer, P.B.' 1 0009-0004-3946-3579 'Schmidt, M.' 2 0000-0002-9442-460X 'Faendrich, M.' 3 0000-0003-2123-6816 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 436 _citation.language ? _citation.page_first 168422 _citation.page_last 168422 _citation.title 'Cryo-EM Analysis of the Effect of Seeding with Brain-derived A beta Amyloid Fibrils.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2023.168422 _citation.pdbx_database_id_PubMed 38158175 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pfeiffer, P.B.' 1 ? primary 'Ugrina, M.' 2 ? primary 'Schwierz, N.' 3 ? primary 'Sigurdson, C.J.' 4 ? primary 'Schmidt, M.' 5 ? primary 'Fandrich, M.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Amyloid-beta A4 protein' _entity.formula_weight 4335.852 _entity.pdbx_number_of_molecules 12 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV _entity_poly.pdbx_seq_one_letter_code_can DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV _entity_poly.pdbx_strand_id A,B,C,D,E,F,G,H,I,J,K,L _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ALA n 1 3 GLU n 1 4 PHE n 1 5 ARG n 1 6 HIS n 1 7 ASP n 1 8 SER n 1 9 GLY n 1 10 TYR n 1 11 GLU n 1 12 VAL n 1 13 HIS n 1 14 HIS n 1 15 GLN n 1 16 LYS n 1 17 LEU n 1 18 VAL n 1 19 PHE n 1 20 PHE n 1 21 ALA n 1 22 GLU n 1 23 ASP n 1 24 VAL n 1 25 GLY n 1 26 SER n 1 27 ASN n 1 28 LYS n 1 29 GLY n 1 30 ALA n 1 31 ILE n 1 32 ILE n 1 33 GLY n 1 34 LEU n 1 35 MET n 1 36 VAL n 1 37 GLY n 1 38 GLY n 1 39 VAL n 1 40 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 40 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain RV308 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 PHE 4 4 ? ? ? A . n A 1 5 ARG 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 ASP 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 TYR 10 10 ? ? ? A . n A 1 11 GLU 11 11 ? ? ? A . n A 1 12 VAL 12 12 ? ? ? A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n B 1 1 ASP 1 1 ? ? ? B . n B 1 2 ALA 2 2 ? ? ? B . n B 1 3 GLU 3 3 ? ? ? B . n B 1 4 PHE 4 4 ? ? ? B . n B 1 5 ARG 5 5 ? ? ? B . n B 1 6 HIS 6 6 ? ? ? B . n B 1 7 ASP 7 7 ? ? ? B . n B 1 8 SER 8 8 ? ? ? B . n B 1 9 GLY 9 9 ? ? ? B . n B 1 10 TYR 10 10 ? ? ? B . n B 1 11 GLU 11 11 ? ? ? B . n B 1 12 VAL 12 12 ? ? ? B . n B 1 13 HIS 13 13 13 HIS HIS B . n B 1 14 HIS 14 14 14 HIS HIS B . n B 1 15 GLN 15 15 15 GLN GLN B . n B 1 16 LYS 16 16 16 LYS LYS B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 VAL 18 18 18 VAL VAL B . n B 1 19 PHE 19 19 19 PHE PHE B . n B 1 20 PHE 20 20 20 PHE PHE B . n B 1 21 ALA 21 21 21 ALA ALA B . n B 1 22 GLU 22 22 22 GLU GLU B . n B 1 23 ASP 23 23 23 ASP ASP B . n B 1 24 VAL 24 24 24 VAL VAL B . n B 1 25 GLY 25 25 25 GLY GLY B . n B 1 26 SER 26 26 26 SER SER B . n B 1 27 ASN 27 27 27 ASN ASN B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 GLY 29 29 29 GLY GLY B . n B 1 30 ALA 30 30 30 ALA ALA B . n B 1 31 ILE 31 31 31 ILE ILE B . n B 1 32 ILE 32 32 32 ILE ILE B . n B 1 33 GLY 33 33 33 GLY GLY B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 MET 35 35 35 MET MET B . n B 1 36 VAL 36 36 36 VAL VAL B . n B 1 37 GLY 37 37 37 GLY GLY B . n B 1 38 GLY 38 38 38 GLY GLY B . n B 1 39 VAL 39 39 39 VAL VAL B . n B 1 40 VAL 40 40 40 VAL VAL B . n C 1 1 ASP 1 1 ? ? ? C . n C 1 2 ALA 2 2 ? ? ? C . n C 1 3 GLU 3 3 ? ? ? C . n C 1 4 PHE 4 4 ? ? ? C . n C 1 5 ARG 5 5 ? ? ? C . n C 1 6 HIS 6 6 ? ? ? C . n C 1 7 ASP 7 7 ? ? ? C . n C 1 8 SER 8 8 ? ? ? C . n C 1 9 GLY 9 9 ? ? ? C . n C 1 10 TYR 10 10 ? ? ? C . n C 1 11 GLU 11 11 ? ? ? C . n C 1 12 VAL 12 12 ? ? ? C . n C 1 13 HIS 13 13 13 HIS HIS C . n C 1 14 HIS 14 14 14 HIS HIS C . n C 1 15 GLN 15 15 15 GLN GLN C . n C 1 16 LYS 16 16 16 LYS LYS C . n C 1 17 LEU 17 17 17 LEU LEU C . n C 1 18 VAL 18 18 18 VAL VAL C . n C 1 19 PHE 19 19 19 PHE PHE C . n C 1 20 PHE 20 20 20 PHE PHE C . n C 1 21 ALA 21 21 21 ALA ALA C . n C 1 22 GLU 22 22 22 GLU GLU C . n C 1 23 ASP 23 23 23 ASP ASP C . n C 1 24 VAL 24 24 24 VAL VAL C . n C 1 25 GLY 25 25 25 GLY GLY C . n C 1 26 SER 26 26 26 SER SER C . n C 1 27 ASN 27 27 27 ASN ASN C . n C 1 28 LYS 28 28 28 LYS LYS C . n C 1 29 GLY 29 29 29 GLY GLY C . n C 1 30 ALA 30 30 30 ALA ALA C . n C 1 31 ILE 31 31 31 ILE ILE C . n C 1 32 ILE 32 32 32 ILE ILE C . n C 1 33 GLY 33 33 33 GLY GLY C . n C 1 34 LEU 34 34 34 LEU LEU C . n C 1 35 MET 35 35 35 MET MET C . n C 1 36 VAL 36 36 36 VAL VAL C . n C 1 37 GLY 37 37 37 GLY GLY C . n C 1 38 GLY 38 38 38 GLY GLY C . n C 1 39 VAL 39 39 39 VAL VAL C . n C 1 40 VAL 40 40 40 VAL VAL C . n D 1 1 ASP 1 1 ? ? ? D . n D 1 2 ALA 2 2 ? ? ? D . n D 1 3 GLU 3 3 ? ? ? D . n D 1 4 PHE 4 4 ? ? ? D . n D 1 5 ARG 5 5 ? ? ? D . n D 1 6 HIS 6 6 ? ? ? D . n D 1 7 ASP 7 7 ? ? ? D . n D 1 8 SER 8 8 ? ? ? D . n D 1 9 GLY 9 9 ? ? ? D . n D 1 10 TYR 10 10 ? ? ? D . n D 1 11 GLU 11 11 ? ? ? D . n D 1 12 VAL 12 12 ? ? ? D . n D 1 13 HIS 13 13 13 HIS HIS D . n D 1 14 HIS 14 14 14 HIS HIS D . n D 1 15 GLN 15 15 15 GLN GLN D . n D 1 16 LYS 16 16 16 LYS LYS D . n D 1 17 LEU 17 17 17 LEU LEU D . n D 1 18 VAL 18 18 18 VAL VAL D . n D 1 19 PHE 19 19 19 PHE PHE D . n D 1 20 PHE 20 20 20 PHE PHE D . n D 1 21 ALA 21 21 21 ALA ALA D . n D 1 22 GLU 22 22 22 GLU GLU D . n D 1 23 ASP 23 23 23 ASP ASP D . n D 1 24 VAL 24 24 24 VAL VAL D . n D 1 25 GLY 25 25 25 GLY GLY D . n D 1 26 SER 26 26 26 SER SER D . n D 1 27 ASN 27 27 27 ASN ASN D . n D 1 28 LYS 28 28 28 LYS LYS D . n D 1 29 GLY 29 29 29 GLY GLY D . n D 1 30 ALA 30 30 30 ALA ALA D . n D 1 31 ILE 31 31 31 ILE ILE D . n D 1 32 ILE 32 32 32 ILE ILE D . n D 1 33 GLY 33 33 33 GLY GLY D . n D 1 34 LEU 34 34 34 LEU LEU D . n D 1 35 MET 35 35 35 MET MET D . n D 1 36 VAL 36 36 36 VAL VAL D . n D 1 37 GLY 37 37 37 GLY GLY D . n D 1 38 GLY 38 38 38 GLY GLY D . n D 1 39 VAL 39 39 39 VAL VAL D . n D 1 40 VAL 40 40 40 VAL VAL D . n E 1 1 ASP 1 1 ? ? ? E . n E 1 2 ALA 2 2 ? ? ? E . n E 1 3 GLU 3 3 ? ? ? E . n E 1 4 PHE 4 4 ? ? ? E . n E 1 5 ARG 5 5 ? ? ? E . n E 1 6 HIS 6 6 ? ? ? E . n E 1 7 ASP 7 7 ? ? ? E . n E 1 8 SER 8 8 ? ? ? E . n E 1 9 GLY 9 9 ? ? ? E . n E 1 10 TYR 10 10 ? ? ? E . n E 1 11 GLU 11 11 ? ? ? E . n E 1 12 VAL 12 12 ? ? ? E . n E 1 13 HIS 13 13 13 HIS HIS E . n E 1 14 HIS 14 14 14 HIS HIS E . n E 1 15 GLN 15 15 15 GLN GLN E . n E 1 16 LYS 16 16 16 LYS LYS E . n E 1 17 LEU 17 17 17 LEU LEU E . n E 1 18 VAL 18 18 18 VAL VAL E . n E 1 19 PHE 19 19 19 PHE PHE E . n E 1 20 PHE 20 20 20 PHE PHE E . n E 1 21 ALA 21 21 21 ALA ALA E . n E 1 22 GLU 22 22 22 GLU GLU E . n E 1 23 ASP 23 23 23 ASP ASP E . n E 1 24 VAL 24 24 24 VAL VAL E . n E 1 25 GLY 25 25 25 GLY GLY E . n E 1 26 SER 26 26 26 SER SER E . n E 1 27 ASN 27 27 27 ASN ASN E . n E 1 28 LYS 28 28 28 LYS LYS E . n E 1 29 GLY 29 29 29 GLY GLY E . n E 1 30 ALA 30 30 30 ALA ALA E . n E 1 31 ILE 31 31 31 ILE ILE E . n E 1 32 ILE 32 32 32 ILE ILE E . n E 1 33 GLY 33 33 33 GLY GLY E . n E 1 34 LEU 34 34 34 LEU LEU E . n E 1 35 MET 35 35 35 MET MET E . n E 1 36 VAL 36 36 36 VAL VAL E . n E 1 37 GLY 37 37 37 GLY GLY E . n E 1 38 GLY 38 38 38 GLY GLY E . n E 1 39 VAL 39 39 39 VAL VAL E . n E 1 40 VAL 40 40 40 VAL VAL E . n F 1 1 ASP 1 1 ? ? ? F . n F 1 2 ALA 2 2 ? ? ? F . n F 1 3 GLU 3 3 ? ? ? F . n F 1 4 PHE 4 4 ? ? ? F . n F 1 5 ARG 5 5 ? ? ? F . n F 1 6 HIS 6 6 ? ? ? F . n F 1 7 ASP 7 7 ? ? ? F . n F 1 8 SER 8 8 ? ? ? F . n F 1 9 GLY 9 9 ? ? ? F . n F 1 10 TYR 10 10 ? ? ? F . n F 1 11 GLU 11 11 ? ? ? F . n F 1 12 VAL 12 12 ? ? ? F . n F 1 13 HIS 13 13 13 HIS HIS F . n F 1 14 HIS 14 14 14 HIS HIS F . n F 1 15 GLN 15 15 15 GLN GLN F . n F 1 16 LYS 16 16 16 LYS LYS F . n F 1 17 LEU 17 17 17 LEU LEU F . n F 1 18 VAL 18 18 18 VAL VAL F . n F 1 19 PHE 19 19 19 PHE PHE F . n F 1 20 PHE 20 20 20 PHE PHE F . n F 1 21 ALA 21 21 21 ALA ALA F . n F 1 22 GLU 22 22 22 GLU GLU F . n F 1 23 ASP 23 23 23 ASP ASP F . n F 1 24 VAL 24 24 24 VAL VAL F . n F 1 25 GLY 25 25 25 GLY GLY F . n F 1 26 SER 26 26 26 SER SER F . n F 1 27 ASN 27 27 27 ASN ASN F . n F 1 28 LYS 28 28 28 LYS LYS F . n F 1 29 GLY 29 29 29 GLY GLY F . n F 1 30 ALA 30 30 30 ALA ALA F . n F 1 31 ILE 31 31 31 ILE ILE F . n F 1 32 ILE 32 32 32 ILE ILE F . n F 1 33 GLY 33 33 33 GLY GLY F . n F 1 34 LEU 34 34 34 LEU LEU F . n F 1 35 MET 35 35 35 MET MET F . n F 1 36 VAL 36 36 36 VAL VAL F . n F 1 37 GLY 37 37 37 GLY GLY F . n F 1 38 GLY 38 38 38 GLY GLY F . n F 1 39 VAL 39 39 39 VAL VAL F . n F 1 40 VAL 40 40 40 VAL VAL F . n G 1 1 ASP 1 1 ? ? ? G . n G 1 2 ALA 2 2 ? ? ? G . n G 1 3 GLU 3 3 ? ? ? G . n G 1 4 PHE 4 4 ? ? ? G . n G 1 5 ARG 5 5 ? ? ? G . n G 1 6 HIS 6 6 ? ? ? G . n G 1 7 ASP 7 7 ? ? ? G . n G 1 8 SER 8 8 ? ? ? G . n G 1 9 GLY 9 9 ? ? ? G . n G 1 10 TYR 10 10 ? ? ? G . n G 1 11 GLU 11 11 ? ? ? G . n G 1 12 VAL 12 12 ? ? ? G . n G 1 13 HIS 13 13 13 HIS HIS G . n G 1 14 HIS 14 14 14 HIS HIS G . n G 1 15 GLN 15 15 15 GLN GLN G . n G 1 16 LYS 16 16 16 LYS LYS G . n G 1 17 LEU 17 17 17 LEU LEU G . n G 1 18 VAL 18 18 18 VAL VAL G . n G 1 19 PHE 19 19 19 PHE PHE G . n G 1 20 PHE 20 20 20 PHE PHE G . n G 1 21 ALA 21 21 21 ALA ALA G . n G 1 22 GLU 22 22 22 GLU GLU G . n G 1 23 ASP 23 23 23 ASP ASP G . n G 1 24 VAL 24 24 24 VAL VAL G . n G 1 25 GLY 25 25 25 GLY GLY G . n G 1 26 SER 26 26 26 SER SER G . n G 1 27 ASN 27 27 27 ASN ASN G . n G 1 28 LYS 28 28 28 LYS LYS G . n G 1 29 GLY 29 29 29 GLY GLY G . n G 1 30 ALA 30 30 30 ALA ALA G . n G 1 31 ILE 31 31 31 ILE ILE G . n G 1 32 ILE 32 32 32 ILE ILE G . n G 1 33 GLY 33 33 33 GLY GLY G . n G 1 34 LEU 34 34 34 LEU LEU G . n G 1 35 MET 35 35 35 MET MET G . n G 1 36 VAL 36 36 36 VAL VAL G . n G 1 37 GLY 37 37 37 GLY GLY G . n G 1 38 GLY 38 38 38 GLY GLY G . n G 1 39 VAL 39 39 39 VAL VAL G . n G 1 40 VAL 40 40 40 VAL VAL G . n H 1 1 ASP 1 1 ? ? ? H . n H 1 2 ALA 2 2 ? ? ? H . n H 1 3 GLU 3 3 ? ? ? H . n H 1 4 PHE 4 4 ? ? ? H . n H 1 5 ARG 5 5 ? ? ? H . n H 1 6 HIS 6 6 ? ? ? H . n H 1 7 ASP 7 7 ? ? ? H . n H 1 8 SER 8 8 ? ? ? H . n H 1 9 GLY 9 9 ? ? ? H . n H 1 10 TYR 10 10 ? ? ? H . n H 1 11 GLU 11 11 ? ? ? H . n H 1 12 VAL 12 12 ? ? ? H . n H 1 13 HIS 13 13 13 HIS HIS H . n H 1 14 HIS 14 14 14 HIS HIS H . n H 1 15 GLN 15 15 15 GLN GLN H . n H 1 16 LYS 16 16 16 LYS LYS H . n H 1 17 LEU 17 17 17 LEU LEU H . n H 1 18 VAL 18 18 18 VAL VAL H . n H 1 19 PHE 19 19 19 PHE PHE H . n H 1 20 PHE 20 20 20 PHE PHE H . n H 1 21 ALA 21 21 21 ALA ALA H . n H 1 22 GLU 22 22 22 GLU GLU H . n H 1 23 ASP 23 23 23 ASP ASP H . n H 1 24 VAL 24 24 24 VAL VAL H . n H 1 25 GLY 25 25 25 GLY GLY H . n H 1 26 SER 26 26 26 SER SER H . n H 1 27 ASN 27 27 27 ASN ASN H . n H 1 28 LYS 28 28 28 LYS LYS H . n H 1 29 GLY 29 29 29 GLY GLY H . n H 1 30 ALA 30 30 30 ALA ALA H . n H 1 31 ILE 31 31 31 ILE ILE H . n H 1 32 ILE 32 32 32 ILE ILE H . n H 1 33 GLY 33 33 33 GLY GLY H . n H 1 34 LEU 34 34 34 LEU LEU H . n H 1 35 MET 35 35 35 MET MET H . n H 1 36 VAL 36 36 36 VAL VAL H . n H 1 37 GLY 37 37 37 GLY GLY H . n H 1 38 GLY 38 38 38 GLY GLY H . n H 1 39 VAL 39 39 39 VAL VAL H . n H 1 40 VAL 40 40 40 VAL VAL H . n I 1 1 ASP 1 1 ? ? ? I . n I 1 2 ALA 2 2 ? ? ? I . n I 1 3 GLU 3 3 ? ? ? I . n I 1 4 PHE 4 4 ? ? ? I . n I 1 5 ARG 5 5 ? ? ? I . n I 1 6 HIS 6 6 ? ? ? I . n I 1 7 ASP 7 7 ? ? ? I . n I 1 8 SER 8 8 ? ? ? I . n I 1 9 GLY 9 9 ? ? ? I . n I 1 10 TYR 10 10 ? ? ? I . n I 1 11 GLU 11 11 ? ? ? I . n I 1 12 VAL 12 12 ? ? ? I . n I 1 13 HIS 13 13 13 HIS HIS I . n I 1 14 HIS 14 14 14 HIS HIS I . n I 1 15 GLN 15 15 15 GLN GLN I . n I 1 16 LYS 16 16 16 LYS LYS I . n I 1 17 LEU 17 17 17 LEU LEU I . n I 1 18 VAL 18 18 18 VAL VAL I . n I 1 19 PHE 19 19 19 PHE PHE I . n I 1 20 PHE 20 20 20 PHE PHE I . n I 1 21 ALA 21 21 21 ALA ALA I . n I 1 22 GLU 22 22 22 GLU GLU I . n I 1 23 ASP 23 23 23 ASP ASP I . n I 1 24 VAL 24 24 24 VAL VAL I . n I 1 25 GLY 25 25 25 GLY GLY I . n I 1 26 SER 26 26 26 SER SER I . n I 1 27 ASN 27 27 27 ASN ASN I . n I 1 28 LYS 28 28 28 LYS LYS I . n I 1 29 GLY 29 29 29 GLY GLY I . n I 1 30 ALA 30 30 30 ALA ALA I . n I 1 31 ILE 31 31 31 ILE ILE I . n I 1 32 ILE 32 32 32 ILE ILE I . n I 1 33 GLY 33 33 33 GLY GLY I . n I 1 34 LEU 34 34 34 LEU LEU I . n I 1 35 MET 35 35 35 MET MET I . n I 1 36 VAL 36 36 36 VAL VAL I . n I 1 37 GLY 37 37 37 GLY GLY I . n I 1 38 GLY 38 38 38 GLY GLY I . n I 1 39 VAL 39 39 39 VAL VAL I . n I 1 40 VAL 40 40 40 VAL VAL I . n J 1 1 ASP 1 1 ? ? ? J . n J 1 2 ALA 2 2 ? ? ? J . n J 1 3 GLU 3 3 ? ? ? J . n J 1 4 PHE 4 4 ? ? ? J . n J 1 5 ARG 5 5 ? ? ? J . n J 1 6 HIS 6 6 ? ? ? J . n J 1 7 ASP 7 7 ? ? ? J . n J 1 8 SER 8 8 ? ? ? J . n J 1 9 GLY 9 9 ? ? ? J . n J 1 10 TYR 10 10 ? ? ? J . n J 1 11 GLU 11 11 ? ? ? J . n J 1 12 VAL 12 12 ? ? ? J . n J 1 13 HIS 13 13 13 HIS HIS J . n J 1 14 HIS 14 14 14 HIS HIS J . n J 1 15 GLN 15 15 15 GLN GLN J . n J 1 16 LYS 16 16 16 LYS LYS J . n J 1 17 LEU 17 17 17 LEU LEU J . n J 1 18 VAL 18 18 18 VAL VAL J . n J 1 19 PHE 19 19 19 PHE PHE J . n J 1 20 PHE 20 20 20 PHE PHE J . n J 1 21 ALA 21 21 21 ALA ALA J . n J 1 22 GLU 22 22 22 GLU GLU J . n J 1 23 ASP 23 23 23 ASP ASP J . n J 1 24 VAL 24 24 24 VAL VAL J . n J 1 25 GLY 25 25 25 GLY GLY J . n J 1 26 SER 26 26 26 SER SER J . n J 1 27 ASN 27 27 27 ASN ASN J . n J 1 28 LYS 28 28 28 LYS LYS J . n J 1 29 GLY 29 29 29 GLY GLY J . n J 1 30 ALA 30 30 30 ALA ALA J . n J 1 31 ILE 31 31 31 ILE ILE J . n J 1 32 ILE 32 32 32 ILE ILE J . n J 1 33 GLY 33 33 33 GLY GLY J . n J 1 34 LEU 34 34 34 LEU LEU J . n J 1 35 MET 35 35 35 MET MET J . n J 1 36 VAL 36 36 36 VAL VAL J . n J 1 37 GLY 37 37 37 GLY GLY J . n J 1 38 GLY 38 38 38 GLY GLY J . n J 1 39 VAL 39 39 39 VAL VAL J . n J 1 40 VAL 40 40 40 VAL VAL J . n K 1 1 ASP 1 1 ? ? ? K . n K 1 2 ALA 2 2 ? ? ? K . n K 1 3 GLU 3 3 ? ? ? K . n K 1 4 PHE 4 4 ? ? ? K . n K 1 5 ARG 5 5 ? ? ? K . n K 1 6 HIS 6 6 ? ? ? K . n K 1 7 ASP 7 7 ? ? ? K . n K 1 8 SER 8 8 ? ? ? K . n K 1 9 GLY 9 9 ? ? ? K . n K 1 10 TYR 10 10 ? ? ? K . n K 1 11 GLU 11 11 ? ? ? K . n K 1 12 VAL 12 12 ? ? ? K . n K 1 13 HIS 13 13 13 HIS HIS K . n K 1 14 HIS 14 14 14 HIS HIS K . n K 1 15 GLN 15 15 15 GLN GLN K . n K 1 16 LYS 16 16 16 LYS LYS K . n K 1 17 LEU 17 17 17 LEU LEU K . n K 1 18 VAL 18 18 18 VAL VAL K . n K 1 19 PHE 19 19 19 PHE PHE K . n K 1 20 PHE 20 20 20 PHE PHE K . n K 1 21 ALA 21 21 21 ALA ALA K . n K 1 22 GLU 22 22 22 GLU GLU K . n K 1 23 ASP 23 23 23 ASP ASP K . n K 1 24 VAL 24 24 24 VAL VAL K . n K 1 25 GLY 25 25 25 GLY GLY K . n K 1 26 SER 26 26 26 SER SER K . n K 1 27 ASN 27 27 27 ASN ASN K . n K 1 28 LYS 28 28 28 LYS LYS K . n K 1 29 GLY 29 29 29 GLY GLY K . n K 1 30 ALA 30 30 30 ALA ALA K . n K 1 31 ILE 31 31 31 ILE ILE K . n K 1 32 ILE 32 32 32 ILE ILE K . n K 1 33 GLY 33 33 33 GLY GLY K . n K 1 34 LEU 34 34 34 LEU LEU K . n K 1 35 MET 35 35 35 MET MET K . n K 1 36 VAL 36 36 36 VAL VAL K . n K 1 37 GLY 37 37 37 GLY GLY K . n K 1 38 GLY 38 38 38 GLY GLY K . n K 1 39 VAL 39 39 39 VAL VAL K . n K 1 40 VAL 40 40 40 VAL VAL K . n L 1 1 ASP 1 1 ? ? ? L . n L 1 2 ALA 2 2 ? ? ? L . n L 1 3 GLU 3 3 ? ? ? L . n L 1 4 PHE 4 4 ? ? ? L . n L 1 5 ARG 5 5 ? ? ? L . n L 1 6 HIS 6 6 ? ? ? L . n L 1 7 ASP 7 7 ? ? ? L . n L 1 8 SER 8 8 ? ? ? L . n L 1 9 GLY 9 9 ? ? ? L . n L 1 10 TYR 10 10 ? ? ? L . n L 1 11 GLU 11 11 ? ? ? L . n L 1 12 VAL 12 12 ? ? ? L . n L 1 13 HIS 13 13 13 HIS HIS L . n L 1 14 HIS 14 14 14 HIS HIS L . n L 1 15 GLN 15 15 15 GLN GLN L . n L 1 16 LYS 16 16 16 LYS LYS L . n L 1 17 LEU 17 17 17 LEU LEU L . n L 1 18 VAL 18 18 18 VAL VAL L . n L 1 19 PHE 19 19 19 PHE PHE L . n L 1 20 PHE 20 20 20 PHE PHE L . n L 1 21 ALA 21 21 21 ALA ALA L . n L 1 22 GLU 22 22 22 GLU GLU L . n L 1 23 ASP 23 23 23 ASP ASP L . n L 1 24 VAL 24 24 24 VAL VAL L . n L 1 25 GLY 25 25 25 GLY GLY L . n L 1 26 SER 26 26 26 SER SER L . n L 1 27 ASN 27 27 27 ASN ASN L . n L 1 28 LYS 28 28 28 LYS LYS L . n L 1 29 GLY 29 29 29 GLY GLY L . n L 1 30 ALA 30 30 30 ALA ALA L . n L 1 31 ILE 31 31 31 ILE ILE L . n L 1 32 ILE 32 32 32 ILE ILE L . n L 1 33 GLY 33 33 33 GLY GLY L . n L 1 34 LEU 34 34 34 LEU LEU L . n L 1 35 MET 35 35 35 MET MET L . n L 1 36 VAL 36 36 36 VAL VAL L . n L 1 37 GLY 37 37 37 GLY GLY L . n L 1 38 GLY 38 38 38 GLY GLY L . n L 1 39 VAL 39 39 39 VAL VAL L . n L 1 40 VAL 40 40 40 VAL VAL L . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8OT1 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8OT1 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8OT1 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 8OT1 _struct.title 'unseeded Abeta(1-40) amyloid fibril (morphology i)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8OT1 _struct_keywords.text 'Amyloid fibril, Amyloid-beta, PROTEIN FIBRIL' _struct_keywords.pdbx_keywords 'PROTEIN FIBRIL' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 1 ? H N N 1 ? I N N 1 ? J N N 1 ? K N N 1 ? L N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B4DM00_HUMAN _struct_ref.pdbx_db_accession B4DM00 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV _struct_ref.pdbx_align_begin 430 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8OT1 A 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 2 1 8OT1 B 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 3 1 8OT1 C 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 4 1 8OT1 D 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 5 1 8OT1 E 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 6 1 8OT1 F 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 7 1 8OT1 G 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 8 1 8OT1 H 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 9 1 8OT1 I 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 10 1 8OT1 J 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 11 1 8OT1 K 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 12 1 8OT1 L 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 30880 ? 1 MORE -194 ? 1 'SSA (A^2)' 11410 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 16 ? VAL A 24 ? LYS A 16 VAL A 24 AA1 2 LYS C 16 ? VAL C 24 ? LYS C 16 VAL C 24 AA1 3 LYS E 16 ? VAL E 24 ? LYS E 16 VAL E 24 AA1 4 LYS G 16 ? VAL G 24 ? LYS G 16 VAL G 24 AA1 5 LYS I 16 ? VAL I 24 ? LYS I 16 VAL I 24 AA1 6 LYS K 16 ? VAL K 24 ? LYS K 16 VAL K 24 AA2 1 LYS B 16 ? VAL B 24 ? LYS B 16 VAL B 24 AA2 2 LYS D 16 ? VAL D 24 ? LYS D 16 VAL D 24 AA2 3 LYS F 16 ? VAL F 24 ? LYS F 16 VAL F 24 AA2 4 LYS H 16 ? VAL H 24 ? LYS H 16 VAL H 24 AA2 5 LYS J 16 ? VAL J 24 ? LYS J 16 VAL J 24 AA2 6 LYS L 16 ? VAL L 24 ? LYS L 16 VAL L 24 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 18 ? N VAL A 18 O PHE C 19 ? O PHE C 19 AA1 2 3 N VAL C 18 ? N VAL C 18 O PHE E 19 ? O PHE E 19 AA1 3 4 N VAL E 18 ? N VAL E 18 O PHE G 19 ? O PHE G 19 AA1 4 5 N VAL G 18 ? N VAL G 18 O PHE I 19 ? O PHE I 19 AA1 5 6 N VAL I 18 ? N VAL I 18 O PHE K 19 ? O PHE K 19 AA2 1 2 N VAL B 18 ? N VAL B 18 O PHE D 19 ? O PHE D 19 AA2 2 3 N VAL D 18 ? N VAL D 18 O PHE F 19 ? O PHE F 19 AA2 3 4 N VAL F 18 ? N VAL F 18 O PHE H 19 ? O PHE H 19 AA2 4 5 N VAL H 18 ? N VAL H 18 O PHE J 19 ? O PHE J 19 AA2 5 6 N VAL J 18 ? N VAL J 18 O PHE L 19 ? O PHE L 19 # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 8OT1 _em_3d_fitting.method ? _em_3d_fitting.target_criteria 'corrleation coefficient' _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_space REAL _em_3d_fitting.ref_protocol 'BACKBONE TRACE' # _em_3d_reconstruction.entry_id 8OT1 _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 2.59 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles 176139 _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type HELICAL # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details ? _em_buffer.pH 7.4 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type COMPLEX _em_entity_assembly.name 'in vitro Abeta(1-40) amyloid fibril' _em_entity_assembly.details 'morphology i' _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_imaging.entry_id 8OT1 _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model ? _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 300 _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 2.7 _em_imaging.nominal_defocus_min 600 _em_imaging.nominal_defocus_max 2100 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification 130000 _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.specimen_id 1 _em_imaging.cryogen NITROGEN # _em_sample_support.id 1 _em_sample_support.film_material ? _em_sample_support.method ? _em_sample_support.grid_material COPPER _em_sample_support.grid_mesh_size 400 _em_sample_support.grid_type C-flat-1.2/1.3 _em_sample_support.details ? _em_sample_support.specimen_id 1 _em_sample_support.citation_id ? # _em_vitrification.entry_id 8OT1 _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity 95 _em_vitrification.temp ? _em_vitrification.chamber_temperature ? _em_vitrification.instrument 'LEICA PLUNGER' _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 8OT1 _em_experiment.id 1 _em_experiment.reconstruction_method HELICAL _em_experiment.aggregation_state 'HELICAL ARRAY' _em_experiment.entity_assembly_id 1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 1 ? A ASP 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A PHE 4 ? A PHE 4 5 1 Y 1 A ARG 5 ? A ARG 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A ASP 7 ? A ASP 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A GLY 9 ? A GLY 9 10 1 Y 1 A TYR 10 ? A TYR 10 11 1 Y 1 A GLU 11 ? A GLU 11 12 1 Y 1 A VAL 12 ? A VAL 12 13 1 Y 1 B ASP 1 ? B ASP 1 14 1 Y 1 B ALA 2 ? B ALA 2 15 1 Y 1 B GLU 3 ? B GLU 3 16 1 Y 1 B PHE 4 ? B PHE 4 17 1 Y 1 B ARG 5 ? B ARG 5 18 1 Y 1 B HIS 6 ? B HIS 6 19 1 Y 1 B ASP 7 ? B ASP 7 20 1 Y 1 B SER 8 ? B SER 8 21 1 Y 1 B GLY 9 ? B GLY 9 22 1 Y 1 B TYR 10 ? B TYR 10 23 1 Y 1 B GLU 11 ? B GLU 11 24 1 Y 1 B VAL 12 ? B VAL 12 25 1 Y 1 C ASP 1 ? C ASP 1 26 1 Y 1 C ALA 2 ? C ALA 2 27 1 Y 1 C GLU 3 ? C GLU 3 28 1 Y 1 C PHE 4 ? C PHE 4 29 1 Y 1 C ARG 5 ? C ARG 5 30 1 Y 1 C HIS 6 ? C HIS 6 31 1 Y 1 C ASP 7 ? C ASP 7 32 1 Y 1 C SER 8 ? C SER 8 33 1 Y 1 C GLY 9 ? C GLY 9 34 1 Y 1 C TYR 10 ? C TYR 10 35 1 Y 1 C GLU 11 ? C GLU 11 36 1 Y 1 C VAL 12 ? C VAL 12 37 1 Y 1 D ASP 1 ? D ASP 1 38 1 Y 1 D ALA 2 ? D ALA 2 39 1 Y 1 D GLU 3 ? D GLU 3 40 1 Y 1 D PHE 4 ? D PHE 4 41 1 Y 1 D ARG 5 ? D ARG 5 42 1 Y 1 D HIS 6 ? D HIS 6 43 1 Y 1 D ASP 7 ? D ASP 7 44 1 Y 1 D SER 8 ? D SER 8 45 1 Y 1 D GLY 9 ? D GLY 9 46 1 Y 1 D TYR 10 ? D TYR 10 47 1 Y 1 D GLU 11 ? D GLU 11 48 1 Y 1 D VAL 12 ? D VAL 12 49 1 Y 1 E ASP 1 ? E ASP 1 50 1 Y 1 E ALA 2 ? E ALA 2 51 1 Y 1 E GLU 3 ? E GLU 3 52 1 Y 1 E PHE 4 ? E PHE 4 53 1 Y 1 E ARG 5 ? E ARG 5 54 1 Y 1 E HIS 6 ? E HIS 6 55 1 Y 1 E ASP 7 ? E ASP 7 56 1 Y 1 E SER 8 ? E SER 8 57 1 Y 1 E GLY 9 ? E GLY 9 58 1 Y 1 E TYR 10 ? E TYR 10 59 1 Y 1 E GLU 11 ? E GLU 11 60 1 Y 1 E VAL 12 ? E VAL 12 61 1 Y 1 F ASP 1 ? F ASP 1 62 1 Y 1 F ALA 2 ? F ALA 2 63 1 Y 1 F GLU 3 ? F GLU 3 64 1 Y 1 F PHE 4 ? F PHE 4 65 1 Y 1 F ARG 5 ? F ARG 5 66 1 Y 1 F HIS 6 ? F HIS 6 67 1 Y 1 F ASP 7 ? F ASP 7 68 1 Y 1 F SER 8 ? F SER 8 69 1 Y 1 F GLY 9 ? F GLY 9 70 1 Y 1 F TYR 10 ? F TYR 10 71 1 Y 1 F GLU 11 ? F GLU 11 72 1 Y 1 F VAL 12 ? F VAL 12 73 1 Y 1 G ASP 1 ? G ASP 1 74 1 Y 1 G ALA 2 ? G ALA 2 75 1 Y 1 G GLU 3 ? G GLU 3 76 1 Y 1 G PHE 4 ? G PHE 4 77 1 Y 1 G ARG 5 ? G ARG 5 78 1 Y 1 G HIS 6 ? G HIS 6 79 1 Y 1 G ASP 7 ? G ASP 7 80 1 Y 1 G SER 8 ? G SER 8 81 1 Y 1 G GLY 9 ? G GLY 9 82 1 Y 1 G TYR 10 ? G TYR 10 83 1 Y 1 G GLU 11 ? G GLU 11 84 1 Y 1 G VAL 12 ? G VAL 12 85 1 Y 1 H ASP 1 ? H ASP 1 86 1 Y 1 H ALA 2 ? H ALA 2 87 1 Y 1 H GLU 3 ? H GLU 3 88 1 Y 1 H PHE 4 ? H PHE 4 89 1 Y 1 H ARG 5 ? H ARG 5 90 1 Y 1 H HIS 6 ? H HIS 6 91 1 Y 1 H ASP 7 ? H ASP 7 92 1 Y 1 H SER 8 ? H SER 8 93 1 Y 1 H GLY 9 ? H GLY 9 94 1 Y 1 H TYR 10 ? H TYR 10 95 1 Y 1 H GLU 11 ? H GLU 11 96 1 Y 1 H VAL 12 ? H VAL 12 97 1 Y 1 I ASP 1 ? I ASP 1 98 1 Y 1 I ALA 2 ? I ALA 2 99 1 Y 1 I GLU 3 ? I GLU 3 100 1 Y 1 I PHE 4 ? I PHE 4 101 1 Y 1 I ARG 5 ? I ARG 5 102 1 Y 1 I HIS 6 ? I HIS 6 103 1 Y 1 I ASP 7 ? I ASP 7 104 1 Y 1 I SER 8 ? I SER 8 105 1 Y 1 I GLY 9 ? I GLY 9 106 1 Y 1 I TYR 10 ? I TYR 10 107 1 Y 1 I GLU 11 ? I GLU 11 108 1 Y 1 I VAL 12 ? I VAL 12 109 1 Y 1 J ASP 1 ? J ASP 1 110 1 Y 1 J ALA 2 ? J ALA 2 111 1 Y 1 J GLU 3 ? J GLU 3 112 1 Y 1 J PHE 4 ? J PHE 4 113 1 Y 1 J ARG 5 ? J ARG 5 114 1 Y 1 J HIS 6 ? J HIS 6 115 1 Y 1 J ASP 7 ? J ASP 7 116 1 Y 1 J SER 8 ? J SER 8 117 1 Y 1 J GLY 9 ? J GLY 9 118 1 Y 1 J TYR 10 ? J TYR 10 119 1 Y 1 J GLU 11 ? J GLU 11 120 1 Y 1 J VAL 12 ? J VAL 12 121 1 Y 1 K ASP 1 ? K ASP 1 122 1 Y 1 K ALA 2 ? K ALA 2 123 1 Y 1 K GLU 3 ? K GLU 3 124 1 Y 1 K PHE 4 ? K PHE 4 125 1 Y 1 K ARG 5 ? K ARG 5 126 1 Y 1 K HIS 6 ? K HIS 6 127 1 Y 1 K ASP 7 ? K ASP 7 128 1 Y 1 K SER 8 ? K SER 8 129 1 Y 1 K GLY 9 ? K GLY 9 130 1 Y 1 K TYR 10 ? K TYR 10 131 1 Y 1 K GLU 11 ? K GLU 11 132 1 Y 1 K VAL 12 ? K VAL 12 133 1 Y 1 L ASP 1 ? L ASP 1 134 1 Y 1 L ALA 2 ? L ALA 2 135 1 Y 1 L GLU 3 ? L GLU 3 136 1 Y 1 L PHE 4 ? L PHE 4 137 1 Y 1 L ARG 5 ? L ARG 5 138 1 Y 1 L HIS 6 ? L HIS 6 139 1 Y 1 L ASP 7 ? L ASP 7 140 1 Y 1 L SER 8 ? L SER 8 141 1 Y 1 L GLY 9 ? L GLY 9 142 1 Y 1 L TYR 10 ? L TYR 10 143 1 Y 1 L GLU 11 ? L GLU 11 144 1 Y 1 L VAL 12 ? L VAL 12 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 TYR N N N N 270 TYR CA C N S 271 TYR C C N N 272 TYR O O N N 273 TYR CB C N N 274 TYR CG C Y N 275 TYR CD1 C Y N 276 TYR CD2 C Y N 277 TYR CE1 C Y N 278 TYR CE2 C Y N 279 TYR CZ C Y N 280 TYR OH O N N 281 TYR OXT O N N 282 TYR H H N N 283 TYR H2 H N N 284 TYR HA H N N 285 TYR HB2 H N N 286 TYR HB3 H N N 287 TYR HD1 H N N 288 TYR HD2 H N N 289 TYR HE1 H N N 290 TYR HE2 H N N 291 TYR HH H N N 292 TYR HXT H N N 293 VAL N N N N 294 VAL CA C N S 295 VAL C C N N 296 VAL O O N N 297 VAL CB C N N 298 VAL CG1 C N N 299 VAL CG2 C N N 300 VAL OXT O N N 301 VAL H H N N 302 VAL H2 H N N 303 VAL HA H N N 304 VAL HB H N N 305 VAL HG11 H N N 306 VAL HG12 H N N 307 VAL HG13 H N N 308 VAL HG21 H N N 309 VAL HG22 H N N 310 VAL HG23 H N N 311 VAL HXT H N N 312 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 TYR N CA sing N N 258 TYR N H sing N N 259 TYR N H2 sing N N 260 TYR CA C sing N N 261 TYR CA CB sing N N 262 TYR CA HA sing N N 263 TYR C O doub N N 264 TYR C OXT sing N N 265 TYR CB CG sing N N 266 TYR CB HB2 sing N N 267 TYR CB HB3 sing N N 268 TYR CG CD1 doub Y N 269 TYR CG CD2 sing Y N 270 TYR CD1 CE1 sing Y N 271 TYR CD1 HD1 sing N N 272 TYR CD2 CE2 doub Y N 273 TYR CD2 HD2 sing N N 274 TYR CE1 CZ doub Y N 275 TYR CE1 HE1 sing N N 276 TYR CE2 CZ sing Y N 277 TYR CE2 HE2 sing N N 278 TYR CZ OH sing N N 279 TYR OH HH sing N N 280 TYR OXT HXT sing N N 281 VAL N CA sing N N 282 VAL N H sing N N 283 VAL N H2 sing N N 284 VAL CA C sing N N 285 VAL CA CB sing N N 286 VAL CA HA sing N N 287 VAL C O doub N N 288 VAL C OXT sing N N 289 VAL CB CG1 sing N N 290 VAL CB CG2 sing N N 291 VAL CB HB sing N N 292 VAL CG1 HG11 sing N N 293 VAL CG1 HG12 sing N N 294 VAL CG1 HG13 sing N N 295 VAL CG2 HG21 sing N N 296 VAL CG2 HG22 sing N N 297 VAL CG2 HG23 sing N N 298 VAL OXT HXT sing N N 299 # _em_buffer_component.buffer_id 1 _em_buffer_component.concentration 100 _em_buffer_component.concentration_units mM _em_buffer_component.formula Na2HPO4 _em_buffer_component.id 1 _em_buffer_component.name 'Disodium phosphate' # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 9606 _em_entity_assembly_naturalsource.organism 'Homo sapiens' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.ncbi_tax_id 562 _em_entity_assembly_recombinant.organism 'Escherichia coli' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain RV308 # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.details ? _em_helical_entity.axial_symmetry C2 _em_helical_entity.angular_rotation_per_subunit -0.782 _em_helical_entity.axial_rise_per_subunit 4.763 # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time 2.9 _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 40 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'FEI FALCON IV (4k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged 1 _em_image_recording.num_real_images 4628 # _em_particle_selection.details ? _em_particle_selection.id 1 _em_particle_selection.image_processing_id 1 _em_particle_selection.method ? _em_particle_selection.num_particles_selected 227311 _em_particle_selection.reference_model ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version 'PARTICLE SELECTION' ? 1 1 ? ? RELION 3.1.3 'IMAGE ACQUISITION' ? 2 ? ? 1 SerialEM ? MASKING ? 3 ? ? ? ? ? 'CTF CORRECTION' ? 4 1 ? ? CTFFIND 4.1 'LAYERLINE INDEXING' ? 5 ? ? ? ? ? 'DIFFRACTION INDEXING' ? 6 ? ? ? ? ? 'MODEL FITTING' ? 7 ? 1 ? Coot 0.9.2 OTHER ? 8 ? ? ? ? ? 'MODEL REFINEMENT' ? 9 ? 1 ? PHENIX 1.20.1-4487 'INITIAL EULER ASSIGNMENT' ? 10 1 ? ? ? ? 'FINAL EULER ASSIGNMENT' ? 11 1 ? ? ? ? CLASSIFICATION ? 12 1 ? ? ? ? RECONSTRUCTION ? 13 1 ? ? RELION 3.1.3 # _em_specimen.concentration 0.005 _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 'FA 456/24-1' _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 8OT1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_