data_8OWI # _entry.id 8OWI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8OWI pdb_00008owi 10.2210/pdb8owi/pdb WWPDB D_1292130145 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-21 2 'Structure model' 1 1 2023-09-20 3 'Structure model' 1 2 2024-07-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' citation 5 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_initial_refinement_model.type' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_ASTM' 5 3 'Structure model' '_citation.journal_id_CSD' 6 3 'Structure model' '_citation.journal_id_ISSN' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.page_first' 9 3 'Structure model' '_citation.page_last' 10 3 'Structure model' '_citation.pdbx_database_id_DOI' 11 3 'Structure model' '_citation.pdbx_database_id_PubMed' 12 3 'Structure model' '_citation.title' 13 3 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8OWI _pdbx_database_status.recvd_initial_deposition_date 2023-04-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 Julie.Welburn@ed.ac.uk Julie Welburn PI 'principal investigator/group leader' 0000-0002-5440-6060 3 owen.davies@ed.ac.uk Owen Davies R 'principal investigator/group leader' 0000-0002-3806-5403 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Legal, T.' 1 ? 'Davies, O.R.' 2 0000-0002-3806-5403 'Welburn, J.P.I.' 3 0000-0002-5440-6060 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Curr.Biol. _citation.journal_id_ASTM CUBLE2 _citation.journal_id_CSD 2060 _citation.journal_id_ISSN 0960-9822 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 34 _citation.language ? _citation.page_first 1133 _citation.page_last 1141.e4 _citation.title 'A conserved CENP-E region mediates BubR1-independent recruitment to the outer corona at mitotic onset.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.cub.2024.01.042 _citation.pdbx_database_id_PubMed 38354735 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Weber, J.' 1 ? primary 'Legal, T.' 2 ? primary 'Lezcano, A.P.' 3 ? primary 'Gluszek-Kustusz, A.' 4 ? primary 'Paterson, C.' 5 ? primary 'Eibes, S.' 6 ? primary 'Barisic, M.' 7 ? primary 'Davies, O.R.' 8 ? primary 'Welburn, J.P.I.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Centromere-associated protein E' 17388.910 2 ? ? ? ? 2 water nat water 18.015 52 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Centromere protein E,CENP-E,Kinesin-7,Kinesin-related protein CENPE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPSPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLRENLRRSQQAQDTSVISEHTDPQPSNKPL TCGGGSGIVQNTKALILKSEHIRLEKEISKLKQQNEQLIKQKNELLSNNQHLSNEVKTWKERTLKREAHK ; _entity_poly.pdbx_seq_one_letter_code_can ;GPSPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLRENLRRSQQAQDTSVISEHTDPQPSNKPL TCGGGSGIVQNTKALILKSEHIRLEKEISKLKQQNEQLIKQKNELLSNNQHLSNEVKTWKERTLKREAHK ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 SER n 1 4 PRO n 1 5 TYR n 1 6 LYS n 1 7 GLU n 1 8 GLU n 1 9 ILE n 1 10 GLU n 1 11 ASP n 1 12 LEU n 1 13 LYS n 1 14 MET n 1 15 LYS n 1 16 LEU n 1 17 VAL n 1 18 LYS n 1 19 ILE n 1 20 ASP n 1 21 LEU n 1 22 GLU n 1 23 LYS n 1 24 MET n 1 25 LYS n 1 26 ASN n 1 27 ALA n 1 28 LYS n 1 29 GLU n 1 30 PHE n 1 31 GLU n 1 32 LYS n 1 33 GLU n 1 34 ILE n 1 35 SER n 1 36 ALA n 1 37 THR n 1 38 LYS n 1 39 ALA n 1 40 THR n 1 41 VAL n 1 42 GLU n 1 43 TYR n 1 44 GLN n 1 45 LYS n 1 46 GLU n 1 47 VAL n 1 48 ILE n 1 49 ARG n 1 50 LEU n 1 51 LEU n 1 52 ARG n 1 53 GLU n 1 54 ASN n 1 55 LEU n 1 56 ARG n 1 57 ARG n 1 58 SER n 1 59 GLN n 1 60 GLN n 1 61 ALA n 1 62 GLN n 1 63 ASP n 1 64 THR n 1 65 SER n 1 66 VAL n 1 67 ILE n 1 68 SER n 1 69 GLU n 1 70 HIS n 1 71 THR n 1 72 ASP n 1 73 PRO n 1 74 GLN n 1 75 PRO n 1 76 SER n 1 77 ASN n 1 78 LYS n 1 79 PRO n 1 80 LEU n 1 81 THR n 1 82 CYS n 1 83 GLY n 1 84 GLY n 1 85 GLY n 1 86 SER n 1 87 GLY n 1 88 ILE n 1 89 VAL n 1 90 GLN n 1 91 ASN n 1 92 THR n 1 93 LYS n 1 94 ALA n 1 95 LEU n 1 96 ILE n 1 97 LEU n 1 98 LYS n 1 99 SER n 1 100 GLU n 1 101 HIS n 1 102 ILE n 1 103 ARG n 1 104 LEU n 1 105 GLU n 1 106 LYS n 1 107 GLU n 1 108 ILE n 1 109 SER n 1 110 LYS n 1 111 LEU n 1 112 LYS n 1 113 GLN n 1 114 GLN n 1 115 ASN n 1 116 GLU n 1 117 GLN n 1 118 LEU n 1 119 ILE n 1 120 LYS n 1 121 GLN n 1 122 LYS n 1 123 ASN n 1 124 GLU n 1 125 LEU n 1 126 LEU n 1 127 SER n 1 128 ASN n 1 129 ASN n 1 130 GLN n 1 131 HIS n 1 132 LEU n 1 133 SER n 1 134 ASN n 1 135 GLU n 1 136 VAL n 1 137 LYS n 1 138 THR n 1 139 TRP n 1 140 LYS n 1 141 GLU n 1 142 ARG n 1 143 THR n 1 144 LEU n 1 145 LYS n 1 146 ARG n 1 147 GLU n 1 148 ALA n 1 149 HIS n 1 150 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 150 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CENPE _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 2449 ? ? ? A . n A 1 2 PRO 2 2450 ? ? ? A . n A 1 3 SER 3 2451 ? ? ? A . n A 1 4 PRO 4 2452 ? ? ? A . n A 1 5 TYR 5 2453 ? ? ? A . n A 1 6 LYS 6 2454 2454 LYS LYS A . n A 1 7 GLU 7 2455 2455 GLU GLU A . n A 1 8 GLU 8 2456 2456 GLU GLU A . n A 1 9 ILE 9 2457 2457 ILE ILE A . n A 1 10 GLU 10 2458 2458 GLU GLU A . n A 1 11 ASP 11 2459 2459 ASP ASP A . n A 1 12 LEU 12 2460 2460 LEU LEU A . n A 1 13 LYS 13 2461 2461 LYS LYS A . n A 1 14 MET 14 2462 2462 MET MET A . n A 1 15 LYS 15 2463 2463 LYS LYS A . n A 1 16 LEU 16 2464 2464 LEU LEU A . n A 1 17 VAL 17 2465 2465 VAL VAL A . n A 1 18 LYS 18 2466 2466 LYS LYS A . n A 1 19 ILE 19 2467 2467 ILE ILE A . n A 1 20 ASP 20 2468 2468 ASP ASP A . n A 1 21 LEU 21 2469 2469 LEU LEU A . n A 1 22 GLU 22 2470 2470 GLU GLU A . n A 1 23 LYS 23 2471 2471 LYS LYS A . n A 1 24 MET 24 2472 2472 MET MET A . n A 1 25 LYS 25 2473 2473 LYS LYS A . n A 1 26 ASN 26 2474 2474 ASN ASN A . n A 1 27 ALA 27 2475 2475 ALA ALA A . n A 1 28 LYS 28 2476 2476 LYS LYS A . n A 1 29 GLU 29 2477 2477 GLU GLU A . n A 1 30 PHE 30 2478 2478 PHE PHE A . n A 1 31 GLU 31 2479 2479 GLU GLU A . n A 1 32 LYS 32 2480 2480 LYS LYS A . n A 1 33 GLU 33 2481 2481 GLU GLU A . n A 1 34 ILE 34 2482 2482 ILE ILE A . n A 1 35 SER 35 2483 2483 SER SER A . n A 1 36 ALA 36 2484 2484 ALA ALA A . n A 1 37 THR 37 2485 2485 THR THR A . n A 1 38 LYS 38 2486 2486 LYS LYS A . n A 1 39 ALA 39 2487 2487 ALA ALA A . n A 1 40 THR 40 2488 2488 THR THR A . n A 1 41 VAL 41 2489 2489 VAL VAL A . n A 1 42 GLU 42 2490 2490 GLU GLU A . n A 1 43 TYR 43 2491 2491 TYR TYR A . n A 1 44 GLN 44 2492 2492 GLN GLN A . n A 1 45 LYS 45 2493 2493 LYS LYS A . n A 1 46 GLU 46 2494 2494 GLU GLU A . n A 1 47 VAL 47 2495 2495 VAL VAL A . n A 1 48 ILE 48 2496 2496 ILE ILE A . n A 1 49 ARG 49 2497 2497 ARG ARG A . n A 1 50 LEU 50 2498 2498 LEU LEU A . n A 1 51 LEU 51 2499 2499 LEU LEU A . n A 1 52 ARG 52 2500 2500 ARG ARG A . n A 1 53 GLU 53 2501 2501 GLU GLU A . n A 1 54 ASN 54 2502 2502 ASN ASN A . n A 1 55 LEU 55 2503 2503 LEU LEU A . n A 1 56 ARG 56 2504 2504 ARG ARG A . n A 1 57 ARG 57 2505 2505 ARG ARG A . n A 1 58 SER 58 2506 2506 SER SER A . n A 1 59 GLN 59 2507 2507 GLN GLN A . n A 1 60 GLN 60 2508 2508 GLN GLN A . n A 1 61 ALA 61 2509 ? ? ? A . n A 1 62 GLN 62 2510 ? ? ? A . n A 1 63 ASP 63 2511 ? ? ? A . n A 1 64 THR 64 2512 ? ? ? A . n A 1 65 SER 65 2513 ? ? ? A . n A 1 66 VAL 66 2514 ? ? ? A . n A 1 67 ILE 67 2515 ? ? ? A . n A 1 68 SER 68 2516 ? ? ? A . n A 1 69 GLU 69 2517 ? ? ? A . n A 1 70 HIS 70 2518 ? ? ? A . n A 1 71 THR 71 2519 ? ? ? A . n A 1 72 ASP 72 2520 ? ? ? A . n A 1 73 PRO 73 2521 ? ? ? A . n A 1 74 GLN 74 2522 ? ? ? A . n A 1 75 PRO 75 2523 ? ? ? A . n A 1 76 SER 76 2524 ? ? ? A . n A 1 77 ASN 77 2525 ? ? ? A . n A 1 78 LYS 78 2526 ? ? ? A . n A 1 79 PRO 79 2527 ? ? ? A . n A 1 80 LEU 80 2528 ? ? ? A . n A 1 81 THR 81 2529 ? ? ? A . n A 1 82 CYS 82 2530 ? ? ? A . n A 1 83 GLY 83 2531 ? ? ? A . n A 1 84 GLY 84 2532 ? ? ? A . n A 1 85 GLY 85 2533 ? ? ? A . n A 1 86 SER 86 2534 ? ? ? A . n A 1 87 GLY 87 2535 ? ? ? A . n A 1 88 ILE 88 2536 ? ? ? A . n A 1 89 VAL 89 2537 ? ? ? A . n A 1 90 GLN 90 2538 ? ? ? A . n A 1 91 ASN 91 2539 ? ? ? A . n A 1 92 THR 92 2540 ? ? ? A . n A 1 93 LYS 93 2541 ? ? ? A . n A 1 94 ALA 94 2542 ? ? ? A . n A 1 95 LEU 95 2543 ? ? ? A . n A 1 96 ILE 96 2544 ? ? ? A . n A 1 97 LEU 97 2545 ? ? ? A . n A 1 98 LYS 98 2546 ? ? ? A . n A 1 99 SER 99 2547 ? ? ? A . n A 1 100 GLU 100 2548 ? ? ? A . n A 1 101 HIS 101 2549 ? ? ? A . n A 1 102 ILE 102 2550 ? ? ? A . n A 1 103 ARG 103 2551 ? ? ? A . n A 1 104 LEU 104 2552 ? ? ? A . n A 1 105 GLU 105 2553 ? ? ? A . n A 1 106 LYS 106 2554 ? ? ? A . n A 1 107 GLU 107 2555 ? ? ? A . n A 1 108 ILE 108 2556 ? ? ? A . n A 1 109 SER 109 2557 ? ? ? A . n A 1 110 LYS 110 2558 ? ? ? A . n A 1 111 LEU 111 2559 ? ? ? A . n A 1 112 LYS 112 2560 ? ? ? A . n A 1 113 GLN 113 2561 ? ? ? A . n A 1 114 GLN 114 2562 ? ? ? A . n A 1 115 ASN 115 2563 ? ? ? A . n A 1 116 GLU 116 2564 ? ? ? A . n A 1 117 GLN 117 2565 ? ? ? A . n A 1 118 LEU 118 2566 ? ? ? A . n A 1 119 ILE 119 2567 ? ? ? A . n A 1 120 LYS 120 2568 ? ? ? A . n A 1 121 GLN 121 2569 ? ? ? A . n A 1 122 LYS 122 2570 ? ? ? A . n A 1 123 ASN 123 2571 ? ? ? A . n A 1 124 GLU 124 2572 ? ? ? A . n A 1 125 LEU 125 2573 ? ? ? A . n A 1 126 LEU 126 2574 ? ? ? A . n A 1 127 SER 127 2575 ? ? ? A . n A 1 128 ASN 128 2576 ? ? ? A . n A 1 129 ASN 129 2577 ? ? ? A . n A 1 130 GLN 130 2578 ? ? ? A . n A 1 131 HIS 131 2579 ? ? ? A . n A 1 132 LEU 132 2580 ? ? ? A . n A 1 133 SER 133 2581 ? ? ? A . n A 1 134 ASN 134 2582 ? ? ? A . n A 1 135 GLU 135 2583 ? ? ? A . n A 1 136 VAL 136 2584 ? ? ? A . n A 1 137 LYS 137 2585 ? ? ? A . n A 1 138 THR 138 2586 ? ? ? A . n A 1 139 TRP 139 2587 ? ? ? A . n A 1 140 LYS 140 2588 ? ? ? A . n A 1 141 GLU 141 2589 ? ? ? A . n A 1 142 ARG 142 2590 ? ? ? A . n A 1 143 THR 143 2591 ? ? ? A . n A 1 144 LEU 144 2592 ? ? ? A . n A 1 145 LYS 145 2593 ? ? ? A . n A 1 146 ARG 146 2594 ? ? ? A . n A 1 147 GLU 147 2595 ? ? ? A . n A 1 148 ALA 148 2596 ? ? ? A . n A 1 149 HIS 149 2597 ? ? ? A . n A 1 150 LYS 150 2598 ? ? ? A . n B 1 1 GLY 1 2449 ? ? ? B . n B 1 2 PRO 2 2450 ? ? ? B . n B 1 3 SER 3 2451 ? ? ? B . n B 1 4 PRO 4 2452 ? ? ? B . n B 1 5 TYR 5 2453 ? ? ? B . n B 1 6 LYS 6 2454 2454 LYS LYS B . n B 1 7 GLU 7 2455 2455 GLU GLU B . n B 1 8 GLU 8 2456 2456 GLU GLU B . n B 1 9 ILE 9 2457 2457 ILE ILE B . n B 1 10 GLU 10 2458 2458 GLU GLU B . n B 1 11 ASP 11 2459 2459 ASP ASP B . n B 1 12 LEU 12 2460 2460 LEU LEU B . n B 1 13 LYS 13 2461 2461 LYS LYS B . n B 1 14 MET 14 2462 2462 MET MET B . n B 1 15 LYS 15 2463 2463 LYS LYS B . n B 1 16 LEU 16 2464 2464 LEU LEU B . n B 1 17 VAL 17 2465 2465 VAL VAL B . n B 1 18 LYS 18 2466 2466 LYS LYS B . n B 1 19 ILE 19 2467 2467 ILE ILE B . n B 1 20 ASP 20 2468 2468 ASP ASP B . n B 1 21 LEU 21 2469 2469 LEU LEU B . n B 1 22 GLU 22 2470 2470 GLU GLU B . n B 1 23 LYS 23 2471 2471 LYS LYS B . n B 1 24 MET 24 2472 2472 MET MET B . n B 1 25 LYS 25 2473 2473 LYS LYS B . n B 1 26 ASN 26 2474 2474 ASN ASN B . n B 1 27 ALA 27 2475 2475 ALA ALA B . n B 1 28 LYS 28 2476 2476 LYS LYS B . n B 1 29 GLU 29 2477 2477 GLU GLU B . n B 1 30 PHE 30 2478 2478 PHE PHE B . n B 1 31 GLU 31 2479 2479 GLU GLU B . n B 1 32 LYS 32 2480 2480 LYS LYS B . n B 1 33 GLU 33 2481 2481 GLU GLU B . n B 1 34 ILE 34 2482 2482 ILE ILE B . n B 1 35 SER 35 2483 2483 SER SER B . n B 1 36 ALA 36 2484 2484 ALA ALA B . n B 1 37 THR 37 2485 2485 THR THR B . n B 1 38 LYS 38 2486 2486 LYS LYS B . n B 1 39 ALA 39 2487 2487 ALA ALA B . n B 1 40 THR 40 2488 2488 THR THR B . n B 1 41 VAL 41 2489 2489 VAL VAL B . n B 1 42 GLU 42 2490 2490 GLU GLU B . n B 1 43 TYR 43 2491 2491 TYR TYR B . n B 1 44 GLN 44 2492 2492 GLN GLN B . n B 1 45 LYS 45 2493 2493 LYS LYS B . n B 1 46 GLU 46 2494 2494 GLU GLU B . n B 1 47 VAL 47 2495 2495 VAL VAL B . n B 1 48 ILE 48 2496 2496 ILE ILE B . n B 1 49 ARG 49 2497 2497 ARG ARG B . n B 1 50 LEU 50 2498 2498 LEU LEU B . n B 1 51 LEU 51 2499 2499 LEU LEU B . n B 1 52 ARG 52 2500 2500 ARG ARG B . n B 1 53 GLU 53 2501 2501 GLU GLU B . n B 1 54 ASN 54 2502 2502 ASN ASN B . n B 1 55 LEU 55 2503 2503 LEU LEU B . n B 1 56 ARG 56 2504 2504 ARG ARG B . n B 1 57 ARG 57 2505 2505 ARG ARG B . n B 1 58 SER 58 2506 2506 SER SER B . n B 1 59 GLN 59 2507 2507 GLN GLN B . n B 1 60 GLN 60 2508 ? ? ? B . n B 1 61 ALA 61 2509 ? ? ? B . n B 1 62 GLN 62 2510 ? ? ? B . n B 1 63 ASP 63 2511 ? ? ? B . n B 1 64 THR 64 2512 ? ? ? B . n B 1 65 SER 65 2513 ? ? ? B . n B 1 66 VAL 66 2514 ? ? ? B . n B 1 67 ILE 67 2515 ? ? ? B . n B 1 68 SER 68 2516 ? ? ? B . n B 1 69 GLU 69 2517 ? ? ? B . n B 1 70 HIS 70 2518 ? ? ? B . n B 1 71 THR 71 2519 ? ? ? B . n B 1 72 ASP 72 2520 ? ? ? B . n B 1 73 PRO 73 2521 ? ? ? B . n B 1 74 GLN 74 2522 ? ? ? B . n B 1 75 PRO 75 2523 ? ? ? B . n B 1 76 SER 76 2524 ? ? ? B . n B 1 77 ASN 77 2525 ? ? ? B . n B 1 78 LYS 78 2526 ? ? ? B . n B 1 79 PRO 79 2527 ? ? ? B . n B 1 80 LEU 80 2528 ? ? ? B . n B 1 81 THR 81 2529 ? ? ? B . n B 1 82 CYS 82 2530 ? ? ? B . n B 1 83 GLY 83 2531 ? ? ? B . n B 1 84 GLY 84 2532 ? ? ? B . n B 1 85 GLY 85 2533 ? ? ? B . n B 1 86 SER 86 2534 ? ? ? B . n B 1 87 GLY 87 2535 ? ? ? B . n B 1 88 ILE 88 2536 ? ? ? B . n B 1 89 VAL 89 2537 ? ? ? B . n B 1 90 GLN 90 2538 ? ? ? B . n B 1 91 ASN 91 2539 ? ? ? B . n B 1 92 THR 92 2540 ? ? ? B . n B 1 93 LYS 93 2541 ? ? ? B . n B 1 94 ALA 94 2542 ? ? ? B . n B 1 95 LEU 95 2543 ? ? ? B . n B 1 96 ILE 96 2544 ? ? ? B . n B 1 97 LEU 97 2545 ? ? ? B . n B 1 98 LYS 98 2546 ? ? ? B . n B 1 99 SER 99 2547 ? ? ? B . n B 1 100 GLU 100 2548 ? ? ? B . n B 1 101 HIS 101 2549 ? ? ? B . n B 1 102 ILE 102 2550 ? ? ? B . n B 1 103 ARG 103 2551 ? ? ? B . n B 1 104 LEU 104 2552 ? ? ? B . n B 1 105 GLU 105 2553 ? ? ? B . n B 1 106 LYS 106 2554 ? ? ? B . n B 1 107 GLU 107 2555 ? ? ? B . n B 1 108 ILE 108 2556 ? ? ? B . n B 1 109 SER 109 2557 ? ? ? B . n B 1 110 LYS 110 2558 ? ? ? B . n B 1 111 LEU 111 2559 ? ? ? B . n B 1 112 LYS 112 2560 ? ? ? B . n B 1 113 GLN 113 2561 ? ? ? B . n B 1 114 GLN 114 2562 ? ? ? B . n B 1 115 ASN 115 2563 ? ? ? B . n B 1 116 GLU 116 2564 ? ? ? B . n B 1 117 GLN 117 2565 ? ? ? B . n B 1 118 LEU 118 2566 ? ? ? B . n B 1 119 ILE 119 2567 ? ? ? B . n B 1 120 LYS 120 2568 ? ? ? B . n B 1 121 GLN 121 2569 ? ? ? B . n B 1 122 LYS 122 2570 ? ? ? B . n B 1 123 ASN 123 2571 ? ? ? B . n B 1 124 GLU 124 2572 ? ? ? B . n B 1 125 LEU 125 2573 ? ? ? B . n B 1 126 LEU 126 2574 ? ? ? B . n B 1 127 SER 127 2575 ? ? ? B . n B 1 128 ASN 128 2576 ? ? ? B . n B 1 129 ASN 129 2577 ? ? ? B . n B 1 130 GLN 130 2578 ? ? ? B . n B 1 131 HIS 131 2579 ? ? ? B . n B 1 132 LEU 132 2580 ? ? ? B . n B 1 133 SER 133 2581 ? ? ? B . n B 1 134 ASN 134 2582 ? ? ? B . n B 1 135 GLU 135 2583 ? ? ? B . n B 1 136 VAL 136 2584 ? ? ? B . n B 1 137 LYS 137 2585 ? ? ? B . n B 1 138 THR 138 2586 ? ? ? B . n B 1 139 TRP 139 2587 ? ? ? B . n B 1 140 LYS 140 2588 ? ? ? B . n B 1 141 GLU 141 2589 ? ? ? B . n B 1 142 ARG 142 2590 ? ? ? B . n B 1 143 THR 143 2591 ? ? ? B . n B 1 144 LEU 144 2592 ? ? ? B . n B 1 145 LYS 145 2593 ? ? ? B . n B 1 146 ARG 146 2594 ? ? ? B . n B 1 147 GLU 147 2595 ? ? ? B . n B 1 148 ALA 148 2596 ? ? ? B . n B 1 149 HIS 149 2597 ? ? ? B . n B 1 150 LYS 150 2598 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 2601 27 HOH HOH A . C 2 HOH 2 2602 16 HOH HOH A . C 2 HOH 3 2603 19 HOH HOH A . C 2 HOH 4 2604 8 HOH HOH A . C 2 HOH 5 2605 51 HOH HOH A . C 2 HOH 6 2606 6 HOH HOH A . C 2 HOH 7 2607 4 HOH HOH A . C 2 HOH 8 2608 10 HOH HOH A . C 2 HOH 9 2609 12 HOH HOH A . C 2 HOH 10 2610 34 HOH HOH A . C 2 HOH 11 2611 50 HOH HOH A . C 2 HOH 12 2612 31 HOH HOH A . C 2 HOH 13 2613 1 HOH HOH A . C 2 HOH 14 2614 45 HOH HOH A . C 2 HOH 15 2615 26 HOH HOH A . C 2 HOH 16 2616 33 HOH HOH A . C 2 HOH 17 2617 49 HOH HOH A . C 2 HOH 18 2618 42 HOH HOH A . C 2 HOH 19 2619 35 HOH HOH A . C 2 HOH 20 2620 32 HOH HOH A . C 2 HOH 21 2621 14 HOH HOH A . D 2 HOH 1 2601 18 HOH HOH B . D 2 HOH 2 2602 17 HOH HOH B . D 2 HOH 3 2603 52 HOH HOH B . D 2 HOH 4 2604 43 HOH HOH B . D 2 HOH 5 2605 9 HOH HOH B . D 2 HOH 6 2606 25 HOH HOH B . D 2 HOH 7 2607 5 HOH HOH B . D 2 HOH 8 2608 21 HOH HOH B . D 2 HOH 9 2609 2 HOH HOH B . D 2 HOH 10 2610 7 HOH HOH B . D 2 HOH 11 2611 29 HOH HOH B . D 2 HOH 12 2612 20 HOH HOH B . D 2 HOH 13 2613 24 HOH HOH B . D 2 HOH 14 2614 15 HOH HOH B . D 2 HOH 15 2615 3 HOH HOH B . D 2 HOH 16 2616 40 HOH HOH B . D 2 HOH 17 2617 22 HOH HOH B . D 2 HOH 18 2618 36 HOH HOH B . D 2 HOH 19 2619 39 HOH HOH B . D 2 HOH 20 2620 37 HOH HOH B . D 2 HOH 21 2621 46 HOH HOH B . D 2 HOH 22 2622 48 HOH HOH B . D 2 HOH 23 2623 11 HOH HOH B . D 2 HOH 24 2624 38 HOH HOH B . D 2 HOH 25 2625 41 HOH HOH B . D 2 HOH 26 2626 30 HOH HOH B . D 2 HOH 27 2627 28 HOH HOH B . D 2 HOH 28 2628 13 HOH HOH B . D 2 HOH 29 2629 47 HOH HOH B . D 2 HOH 30 2630 23 HOH HOH B . D 2 HOH 31 2631 44 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? Arcimboldo ? ? ? . 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8OWI _cell.details ? _cell.formula_units_Z ? _cell.length_a 84.018 _cell.length_a_esd ? _cell.length_b 84.018 _cell.length_b_esd ? _cell.length_c 65.019 _cell.length_c_esd ? _cell.volume 458970.703 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8OWI _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall 'P 4n 2n' _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8OWI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Potassium citrate tribasic monohydrate pH 8.3, 20% w/v polyethene glycol 3,350, with 30% glycerol (cryoprotectant).' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-10-20 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 36.90 _reflns.entry_id 8OWI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.14 _reflns.d_resolution_low 51.42 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9178 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 68.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 24.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.026 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.14 _reflns_shell.d_res_low 2.34 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 82 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.563 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.565 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 15.0 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 53.97 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8OWI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.14 _refine.ls_d_res_low 51.42 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9174 _refine.ls_number_reflns_R_free 457 _refine.ls_number_reflns_R_work 8717 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 68.78 _refine.ls_percent_reflns_R_free 4.98 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2176 _refine.ls_R_factor_R_free 0.2455 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2161 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.0000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.4503 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2013 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.14 _refine_hist.d_res_low 51.42 _refine_hist.number_atoms_solvent 52 _refine_hist.number_atoms_total 971 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 919 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0043 ? 921 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5738 ? 1216 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0323 ? 139 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0040 ? 152 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.7008 ? 394 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.14 2.45 . . 46 894 21.70 . . . . 0.2832 . . . . . . . . . . . 0.2377 'X-RAY DIFFRACTION' 2.45 3.09 . . 178 3460 82.76 . . . . 0.2572 . . . . . . . . . . . 0.2665 'X-RAY DIFFRACTION' 3.09 51.42 . . 233 4363 99.76 . . . . 0.1981 . . . . . . . . . . . 0.2381 # _struct.entry_id 8OWI _struct.title 'Crystal structure of the corona-targeting domain of CENP-E' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8OWI _struct_keywords.text 'Kinesin motor, kinetochores, microtubules, mitosis, CELL CYCLE' _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CENPE_HUMAN _struct_ref.pdbx_db_accession Q02224 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLRENLRRSQQAQDTSVISEHTDPQPSNKPLTCG GGSGIVQNTKALILKSEHIRLEKEISKLKQQNEQLIKQKNELLSNNQHLSNEVKTWKERTLKREAHK ; _struct_ref.pdbx_align_begin 2452 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8OWI A 4 ? 150 ? Q02224 2452 ? 2598 ? 2452 2598 2 1 8OWI B 4 ? 150 ? Q02224 2452 ? 2598 ? 2452 2598 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8OWI GLY A 1 ? UNP Q02224 ? ? 'expression tag' 2449 1 1 8OWI PRO A 2 ? UNP Q02224 ? ? 'expression tag' 2450 2 1 8OWI SER A 3 ? UNP Q02224 ? ? 'expression tag' 2451 3 2 8OWI GLY B 1 ? UNP Q02224 ? ? 'expression tag' 2449 4 2 8OWI PRO B 2 ? UNP Q02224 ? ? 'expression tag' 2450 5 2 8OWI SER B 3 ? UNP Q02224 ? ? 'expression tag' 2451 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2730 ? 1 MORE -24 ? 1 'SSA (A^2)' 8750 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 6 ? GLN A 60 ? LYS A 2454 GLN A 2508 1 ? 55 HELX_P HELX_P2 AA2 GLU B 7 ? GLN B 59 ? GLU B 2455 GLN B 2507 1 ? 53 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id B _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2624 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/2 3 y+1/2,-x+1/2,z+1/2 4 x+1/2,-y+1/2,-z+1/2 5 -x+1/2,y+1/2,-z+1/2 6 -x,-y,z 7 y,x,-z 8 -y,-x,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 2449 ? A GLY 1 2 1 Y 1 A PRO 2450 ? A PRO 2 3 1 Y 1 A SER 2451 ? A SER 3 4 1 Y 1 A PRO 2452 ? A PRO 4 5 1 Y 1 A TYR 2453 ? A TYR 5 6 1 Y 1 A ALA 2509 ? A ALA 61 7 1 Y 1 A GLN 2510 ? A GLN 62 8 1 Y 1 A ASP 2511 ? A ASP 63 9 1 Y 1 A THR 2512 ? A THR 64 10 1 Y 1 A SER 2513 ? A SER 65 11 1 Y 1 A VAL 2514 ? A VAL 66 12 1 Y 1 A ILE 2515 ? A ILE 67 13 1 Y 1 A SER 2516 ? A SER 68 14 1 Y 1 A GLU 2517 ? A GLU 69 15 1 Y 1 A HIS 2518 ? A HIS 70 16 1 Y 1 A THR 2519 ? A THR 71 17 1 Y 1 A ASP 2520 ? A ASP 72 18 1 Y 1 A PRO 2521 ? A PRO 73 19 1 Y 1 A GLN 2522 ? A GLN 74 20 1 Y 1 A PRO 2523 ? A PRO 75 21 1 Y 1 A SER 2524 ? A SER 76 22 1 Y 1 A ASN 2525 ? A ASN 77 23 1 Y 1 A LYS 2526 ? A LYS 78 24 1 Y 1 A PRO 2527 ? A PRO 79 25 1 Y 1 A LEU 2528 ? A LEU 80 26 1 Y 1 A THR 2529 ? A THR 81 27 1 Y 1 A CYS 2530 ? A CYS 82 28 1 Y 1 A GLY 2531 ? A GLY 83 29 1 Y 1 A GLY 2532 ? A GLY 84 30 1 Y 1 A GLY 2533 ? A GLY 85 31 1 Y 1 A SER 2534 ? A SER 86 32 1 Y 1 A GLY 2535 ? A GLY 87 33 1 Y 1 A ILE 2536 ? A ILE 88 34 1 Y 1 A VAL 2537 ? A VAL 89 35 1 Y 1 A GLN 2538 ? A GLN 90 36 1 Y 1 A ASN 2539 ? A ASN 91 37 1 Y 1 A THR 2540 ? A THR 92 38 1 Y 1 A LYS 2541 ? A LYS 93 39 1 Y 1 A ALA 2542 ? A ALA 94 40 1 Y 1 A LEU 2543 ? A LEU 95 41 1 Y 1 A ILE 2544 ? A ILE 96 42 1 Y 1 A LEU 2545 ? A LEU 97 43 1 Y 1 A LYS 2546 ? A LYS 98 44 1 Y 1 A SER 2547 ? A SER 99 45 1 Y 1 A GLU 2548 ? A GLU 100 46 1 Y 1 A HIS 2549 ? A HIS 101 47 1 Y 1 A ILE 2550 ? A ILE 102 48 1 Y 1 A ARG 2551 ? A ARG 103 49 1 Y 1 A LEU 2552 ? A LEU 104 50 1 Y 1 A GLU 2553 ? A GLU 105 51 1 Y 1 A LYS 2554 ? A LYS 106 52 1 Y 1 A GLU 2555 ? A GLU 107 53 1 Y 1 A ILE 2556 ? A ILE 108 54 1 Y 1 A SER 2557 ? A SER 109 55 1 Y 1 A LYS 2558 ? A LYS 110 56 1 Y 1 A LEU 2559 ? A LEU 111 57 1 Y 1 A LYS 2560 ? A LYS 112 58 1 Y 1 A GLN 2561 ? A GLN 113 59 1 Y 1 A GLN 2562 ? A GLN 114 60 1 Y 1 A ASN 2563 ? A ASN 115 61 1 Y 1 A GLU 2564 ? A GLU 116 62 1 Y 1 A GLN 2565 ? A GLN 117 63 1 Y 1 A LEU 2566 ? A LEU 118 64 1 Y 1 A ILE 2567 ? A ILE 119 65 1 Y 1 A LYS 2568 ? A LYS 120 66 1 Y 1 A GLN 2569 ? A GLN 121 67 1 Y 1 A LYS 2570 ? A LYS 122 68 1 Y 1 A ASN 2571 ? A ASN 123 69 1 Y 1 A GLU 2572 ? A GLU 124 70 1 Y 1 A LEU 2573 ? A LEU 125 71 1 Y 1 A LEU 2574 ? A LEU 126 72 1 Y 1 A SER 2575 ? A SER 127 73 1 Y 1 A ASN 2576 ? A ASN 128 74 1 Y 1 A ASN 2577 ? A ASN 129 75 1 Y 1 A GLN 2578 ? A GLN 130 76 1 Y 1 A HIS 2579 ? A HIS 131 77 1 Y 1 A LEU 2580 ? A LEU 132 78 1 Y 1 A SER 2581 ? A SER 133 79 1 Y 1 A ASN 2582 ? A ASN 134 80 1 Y 1 A GLU 2583 ? A GLU 135 81 1 Y 1 A VAL 2584 ? A VAL 136 82 1 Y 1 A LYS 2585 ? A LYS 137 83 1 Y 1 A THR 2586 ? A THR 138 84 1 Y 1 A TRP 2587 ? A TRP 139 85 1 Y 1 A LYS 2588 ? A LYS 140 86 1 Y 1 A GLU 2589 ? A GLU 141 87 1 Y 1 A ARG 2590 ? A ARG 142 88 1 Y 1 A THR 2591 ? A THR 143 89 1 Y 1 A LEU 2592 ? A LEU 144 90 1 Y 1 A LYS 2593 ? A LYS 145 91 1 Y 1 A ARG 2594 ? A ARG 146 92 1 Y 1 A GLU 2595 ? A GLU 147 93 1 Y 1 A ALA 2596 ? A ALA 148 94 1 Y 1 A HIS 2597 ? A HIS 149 95 1 Y 1 A LYS 2598 ? A LYS 150 96 1 Y 1 B GLY 2449 ? B GLY 1 97 1 Y 1 B PRO 2450 ? B PRO 2 98 1 Y 1 B SER 2451 ? B SER 3 99 1 Y 1 B PRO 2452 ? B PRO 4 100 1 Y 1 B TYR 2453 ? B TYR 5 101 1 Y 1 B GLN 2508 ? B GLN 60 102 1 Y 1 B ALA 2509 ? B ALA 61 103 1 Y 1 B GLN 2510 ? B GLN 62 104 1 Y 1 B ASP 2511 ? B ASP 63 105 1 Y 1 B THR 2512 ? B THR 64 106 1 Y 1 B SER 2513 ? B SER 65 107 1 Y 1 B VAL 2514 ? B VAL 66 108 1 Y 1 B ILE 2515 ? B ILE 67 109 1 Y 1 B SER 2516 ? B SER 68 110 1 Y 1 B GLU 2517 ? B GLU 69 111 1 Y 1 B HIS 2518 ? B HIS 70 112 1 Y 1 B THR 2519 ? B THR 71 113 1 Y 1 B ASP 2520 ? B ASP 72 114 1 Y 1 B PRO 2521 ? B PRO 73 115 1 Y 1 B GLN 2522 ? B GLN 74 116 1 Y 1 B PRO 2523 ? B PRO 75 117 1 Y 1 B SER 2524 ? B SER 76 118 1 Y 1 B ASN 2525 ? B ASN 77 119 1 Y 1 B LYS 2526 ? B LYS 78 120 1 Y 1 B PRO 2527 ? B PRO 79 121 1 Y 1 B LEU 2528 ? B LEU 80 122 1 Y 1 B THR 2529 ? B THR 81 123 1 Y 1 B CYS 2530 ? B CYS 82 124 1 Y 1 B GLY 2531 ? B GLY 83 125 1 Y 1 B GLY 2532 ? B GLY 84 126 1 Y 1 B GLY 2533 ? B GLY 85 127 1 Y 1 B SER 2534 ? B SER 86 128 1 Y 1 B GLY 2535 ? B GLY 87 129 1 Y 1 B ILE 2536 ? B ILE 88 130 1 Y 1 B VAL 2537 ? B VAL 89 131 1 Y 1 B GLN 2538 ? B GLN 90 132 1 Y 1 B ASN 2539 ? B ASN 91 133 1 Y 1 B THR 2540 ? B THR 92 134 1 Y 1 B LYS 2541 ? B LYS 93 135 1 Y 1 B ALA 2542 ? B ALA 94 136 1 Y 1 B LEU 2543 ? B LEU 95 137 1 Y 1 B ILE 2544 ? B ILE 96 138 1 Y 1 B LEU 2545 ? B LEU 97 139 1 Y 1 B LYS 2546 ? B LYS 98 140 1 Y 1 B SER 2547 ? B SER 99 141 1 Y 1 B GLU 2548 ? B GLU 100 142 1 Y 1 B HIS 2549 ? B HIS 101 143 1 Y 1 B ILE 2550 ? B ILE 102 144 1 Y 1 B ARG 2551 ? B ARG 103 145 1 Y 1 B LEU 2552 ? B LEU 104 146 1 Y 1 B GLU 2553 ? B GLU 105 147 1 Y 1 B LYS 2554 ? B LYS 106 148 1 Y 1 B GLU 2555 ? B GLU 107 149 1 Y 1 B ILE 2556 ? B ILE 108 150 1 Y 1 B SER 2557 ? B SER 109 151 1 Y 1 B LYS 2558 ? B LYS 110 152 1 Y 1 B LEU 2559 ? B LEU 111 153 1 Y 1 B LYS 2560 ? B LYS 112 154 1 Y 1 B GLN 2561 ? B GLN 113 155 1 Y 1 B GLN 2562 ? B GLN 114 156 1 Y 1 B ASN 2563 ? B ASN 115 157 1 Y 1 B GLU 2564 ? B GLU 116 158 1 Y 1 B GLN 2565 ? B GLN 117 159 1 Y 1 B LEU 2566 ? B LEU 118 160 1 Y 1 B ILE 2567 ? B ILE 119 161 1 Y 1 B LYS 2568 ? B LYS 120 162 1 Y 1 B GLN 2569 ? B GLN 121 163 1 Y 1 B LYS 2570 ? B LYS 122 164 1 Y 1 B ASN 2571 ? B ASN 123 165 1 Y 1 B GLU 2572 ? B GLU 124 166 1 Y 1 B LEU 2573 ? B LEU 125 167 1 Y 1 B LEU 2574 ? B LEU 126 168 1 Y 1 B SER 2575 ? B SER 127 169 1 Y 1 B ASN 2576 ? B ASN 128 170 1 Y 1 B ASN 2577 ? B ASN 129 171 1 Y 1 B GLN 2578 ? B GLN 130 172 1 Y 1 B HIS 2579 ? B HIS 131 173 1 Y 1 B LEU 2580 ? B LEU 132 174 1 Y 1 B SER 2581 ? B SER 133 175 1 Y 1 B ASN 2582 ? B ASN 134 176 1 Y 1 B GLU 2583 ? B GLU 135 177 1 Y 1 B VAL 2584 ? B VAL 136 178 1 Y 1 B LYS 2585 ? B LYS 137 179 1 Y 1 B THR 2586 ? B THR 138 180 1 Y 1 B TRP 2587 ? B TRP 139 181 1 Y 1 B LYS 2588 ? B LYS 140 182 1 Y 1 B GLU 2589 ? B GLU 141 183 1 Y 1 B ARG 2590 ? B ARG 142 184 1 Y 1 B THR 2591 ? B THR 143 185 1 Y 1 B LEU 2592 ? B LEU 144 186 1 Y 1 B LYS 2593 ? B LYS 145 187 1 Y 1 B ARG 2594 ? B ARG 146 188 1 Y 1 B GLU 2595 ? B GLU 147 189 1 Y 1 B ALA 2596 ? B ALA 148 190 1 Y 1 B HIS 2597 ? B HIS 149 191 1 Y 1 B LYS 2598 ? B LYS 150 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Wellcome Trust' 'United Kingdom' 219413/Z/19/Z 1 'Wellcome Trust' 'United Kingdom' 207430 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ARCIMBOLDO # _space_group.name_H-M_alt 'P 42 21 2' _space_group.name_Hall 'P 4n 2n' _space_group.IT_number 94 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 8OWI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011902 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011902 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015380 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_