data_8OYD # _entry.id 8OYD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8OYD pdb_00008oyd 10.2210/pdb8oyd/pdb WWPDB D_1292130244 ? ? BMRB 34814 ? 10.13018/BMR34814 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8OYD _pdbx_database_status.recvd_initial_deposition_date 2023-05-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'TrkB transmembrane domain NMR structure in DMPC/DHPC bicelles' _pdbx_database_related.db_id 34814 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email konstantin.mineev@gmail.com _pdbx_contact_author.name_first Konstantin _pdbx_contact_author.name_last Mineev _pdbx_contact_author.name_mi S. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2418-9421 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kot, E.F.' 1 0000-0003-4163-8273 'Mineev, K.S.' 2 0000-0002-2418-9421 'Goncharuk, S.A.' 3 0000-0002-0263-6462 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural Basis for the transmembrane signaling and antidepressant-induced activation of the receptor tyrosine kinase TrkB' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kot, E.F.' 1 0000-0003-4163-8273 primary 'Mineev, K.S.' 2 0000-0002-2418-9421 primary 'Goncharuk, S.A.' 3 0000-0002-1785-5457 primary 'Vilar, M.' 4 0000-0002-9376-6544 primary 'Franco, M.L.' 5 ? primary 'Benito-Martinez, A.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'BDNF/NT-3 growth factors receptor' _entity.formula_weight 4975.101 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec 2.7.10.1 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'In the constraint files, the local numeration starts from M1 for chain A and from M101 for chain B.' # _entity_name_com.entity_id 1 _entity_name_com.name 'GP145-TrkB,Trk-B,Neurotrophic tyrosine kinase receptor type 2,TrkB tyrosine kinase,Tropomyosin-related kinase B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKG _entity_poly.pdbx_seq_one_letter_code_can MTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKG _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ASP n 1 4 LYS n 1 5 THR n 1 6 GLY n 1 7 ARG n 1 8 GLU n 1 9 HIS n 1 10 LEU n 1 11 SER n 1 12 VAL n 1 13 TYR n 1 14 ALA n 1 15 VAL n 1 16 VAL n 1 17 VAL n 1 18 ILE n 1 19 ALA n 1 20 SER n 1 21 VAL n 1 22 VAL n 1 23 GLY n 1 24 PHE n 1 25 CYS n 1 26 LEU n 1 27 LEU n 1 28 VAL n 1 29 MET n 1 30 LEU n 1 31 PHE n 1 32 LEU n 1 33 LEU n 1 34 LYS n 1 35 LEU n 1 36 ALA n 1 37 ARG n 1 38 HIS n 1 39 SER n 1 40 LYS n 1 41 PHE n 1 42 GLY n 1 43 MET n 1 44 LYS n 1 45 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 45 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NTRK2, TRKB' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant TK+ _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell 'Cell-free expression system, lysate-based' _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEMEX-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 422 422 MET MET A . n A 1 2 THR 2 423 423 THR THR A . n A 1 3 ASP 3 424 424 ASP ASP A . n A 1 4 LYS 4 425 425 LYS LYS A . n A 1 5 THR 5 426 426 THR THR A . n A 1 6 GLY 6 427 427 GLY GLY A . n A 1 7 ARG 7 428 428 ARG ARG A . n A 1 8 GLU 8 429 429 GLU GLU A . n A 1 9 HIS 9 430 430 HIS HIS A . n A 1 10 LEU 10 431 431 LEU LEU A . n A 1 11 SER 11 432 432 SER SER A . n A 1 12 VAL 12 433 433 VAL VAL A . n A 1 13 TYR 13 434 434 TYR TYR A . n A 1 14 ALA 14 435 435 ALA ALA A . n A 1 15 VAL 15 436 436 VAL VAL A . n A 1 16 VAL 16 437 437 VAL VAL A . n A 1 17 VAL 17 438 438 VAL VAL A . n A 1 18 ILE 18 439 439 ILE ILE A . n A 1 19 ALA 19 440 440 ALA ALA A . n A 1 20 SER 20 441 441 SER SER A . n A 1 21 VAL 21 442 442 VAL VAL A . n A 1 22 VAL 22 443 443 VAL VAL A . n A 1 23 GLY 23 444 444 GLY GLY A . n A 1 24 PHE 24 445 445 PHE PHE A . n A 1 25 CYS 25 446 446 CYS CYS A . n A 1 26 LEU 26 447 447 LEU LEU A . n A 1 27 LEU 27 448 448 LEU LEU A . n A 1 28 VAL 28 449 449 VAL VAL A . n A 1 29 MET 29 450 450 MET MET A . n A 1 30 LEU 30 451 451 LEU LEU A . n A 1 31 PHE 31 452 452 PHE PHE A . n A 1 32 LEU 32 453 453 LEU LEU A . n A 1 33 LEU 33 454 454 LEU LEU A . n A 1 34 LYS 34 455 455 LYS LYS A . n A 1 35 LEU 35 456 456 LEU LEU A . n A 1 36 ALA 36 457 457 ALA ALA A . n A 1 37 ARG 37 458 458 ARG ARG A . n A 1 38 HIS 38 459 459 HIS HIS A . n A 1 39 SER 39 460 460 SER SER A . n A 1 40 LYS 40 461 461 LYS LYS A . n A 1 41 PHE 41 462 462 PHE PHE A . n A 1 42 GLY 42 463 463 GLY GLY A . n A 1 43 MET 43 464 464 MET MET A . n A 1 44 LYS 44 465 465 LYS LYS A . n A 1 45 GLY 45 466 466 GLY GLY A . n B 1 1 MET 1 422 422 MET MET B . n B 1 2 THR 2 423 423 THR THR B . n B 1 3 ASP 3 424 424 ASP ASP B . n B 1 4 LYS 4 425 425 LYS LYS B . n B 1 5 THR 5 426 426 THR THR B . n B 1 6 GLY 6 427 427 GLY GLY B . n B 1 7 ARG 7 428 428 ARG ARG B . n B 1 8 GLU 8 429 429 GLU GLU B . n B 1 9 HIS 9 430 430 HIS HIS B . n B 1 10 LEU 10 431 431 LEU LEU B . n B 1 11 SER 11 432 432 SER SER B . n B 1 12 VAL 12 433 433 VAL VAL B . n B 1 13 TYR 13 434 434 TYR TYR B . n B 1 14 ALA 14 435 435 ALA ALA B . n B 1 15 VAL 15 436 436 VAL VAL B . n B 1 16 VAL 16 437 437 VAL VAL B . n B 1 17 VAL 17 438 438 VAL VAL B . n B 1 18 ILE 18 439 439 ILE ILE B . n B 1 19 ALA 19 440 440 ALA ALA B . n B 1 20 SER 20 441 441 SER SER B . n B 1 21 VAL 21 442 442 VAL VAL B . n B 1 22 VAL 22 443 443 VAL VAL B . n B 1 23 GLY 23 444 444 GLY GLY B . n B 1 24 PHE 24 445 445 PHE PHE B . n B 1 25 CYS 25 446 446 CYS CYS B . n B 1 26 LEU 26 447 447 LEU LEU B . n B 1 27 LEU 27 448 448 LEU LEU B . n B 1 28 VAL 28 449 449 VAL VAL B . n B 1 29 MET 29 450 450 MET MET B . n B 1 30 LEU 30 451 451 LEU LEU B . n B 1 31 PHE 31 452 452 PHE PHE B . n B 1 32 LEU 32 453 453 LEU LEU B . n B 1 33 LEU 33 454 454 LEU LEU B . n B 1 34 LYS 34 455 455 LYS LYS B . n B 1 35 LEU 35 456 456 LEU LEU B . n B 1 36 ALA 36 457 457 ALA ALA B . n B 1 37 ARG 37 458 458 ARG ARG B . n B 1 38 HIS 38 459 459 HIS HIS B . n B 1 39 SER 39 460 460 SER SER B . n B 1 40 LYS 40 461 461 LYS LYS B . n B 1 41 PHE 41 462 462 PHE PHE B . n B 1 42 GLY 42 463 463 GLY GLY B . n B 1 43 MET 43 464 464 MET MET B . n B 1 44 LYS 44 465 465 LYS LYS B . n B 1 45 GLY 45 466 466 GLY GLY B . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8OYD _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8OYD _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8OYD _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 8OYD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 8OYD _struct.title 'TrkB transmembrane domain NMR structure in DMPC/DHPC bicelles' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8OYD _struct_keywords.text 'PROTEIN, RECEPTOR, NEUROTROPHIN, BDNF, NT-4, TMD, DIMER, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NTRK2_HUMAN _struct_ref.pdbx_db_accession Q16620 _struct_ref.pdbx_db_isoform Q16620-1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKG _struct_ref.pdbx_align_begin 422 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8OYD A 1 ? 45 ? Q16620 422 ? 466 ? 422 466 2 1 8OYD B 1 ? 45 ? Q16620 422 ? 466 ? 422 466 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8OYD MET A 1 ? UNP Q16620 VAL 422 conflict 422 1 2 8OYD MET B 1 ? UNP Q16620 VAL 422 conflict 422 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1190 ? 1 MORE -17 ? 1 'SSA (A^2)' 8480 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ;In an additional experiment we added the isotopically unlabeled TMD and observed the intermolecular contacts in the 13C-filtered 3D NOESY ; # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 6 ? LYS A 40 ? GLY A 427 LYS A 461 1 ? 35 HELX_P HELX_P2 AA2 ARG B 7 ? SER B 39 ? ARG B 428 SER B 460 1 ? 33 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 461 ? ? 38.16 42.39 2 1 PHE A 462 ? ? 43.14 82.65 3 1 ASP B 424 ? ? -114.77 57.61 4 1 LYS B 461 ? ? 38.44 42.54 5 1 PHE B 462 ? ? -45.02 106.97 6 2 ARG A 428 ? ? -102.71 76.15 7 3 LYS A 461 ? ? 38.77 42.13 8 3 LYS B 461 ? ? 38.56 42.72 9 5 LYS A 461 ? ? 37.91 43.63 10 5 ARG B 428 ? ? -92.61 59.88 11 6 ARG A 428 ? ? -135.60 -76.25 12 7 LYS A 461 ? ? 30.44 50.42 13 7 MET A 464 ? ? -79.35 -74.70 14 7 ARG B 428 ? ? -106.17 43.46 15 7 LYS B 461 ? ? 30.38 50.60 16 7 MET B 464 ? ? -79.40 -74.80 17 8 LYS A 465 ? ? -68.84 88.30 18 8 PHE B 462 ? ? 48.16 29.45 19 9 LYS A 461 ? ? 30.98 49.32 20 9 PHE A 462 ? ? 51.60 90.41 21 9 LYS B 461 ? ? 31.94 48.26 22 9 PHE B 462 ? ? 52.24 90.42 23 10 LYS A 461 ? ? 31.34 48.04 24 10 THR B 423 ? ? -113.84 58.98 25 10 LYS B 461 ? ? 31.57 48.08 # _pdbx_nmr_ensemble.entry_id 8OYD _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8OYD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;5 % v/v [U-2H] D2O, 1.1 mM [U-100% 13C; U-100% 15N] High affinity receptor of neurotrophin-4 and brain-derived neurotrophic factor (TrkB), 9.6 mM [U-2H] DMPC, 42.7 mM [U-2H] DHPC, 1.0 mM n.a. TCEP, 0.01 % w/v n.a. sodium azide, 20.0 mM n.a. sodium phosphate buffer, 0.5 mM d4 TSP, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label '13C-15N-labeled TrkBtm' _pdbx_nmr_sample_details.type bicelle _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 D2O 5 ? '% v/v' '[U-2H]' 1 'High affinity receptor of neurotrophin-4 and brain-derived neurotrophic factor (TrkB)' 1.1 ? mM '[U-100% 13C; U-100% 15N]' 1 DMPC 9.6 ? mM '[U-2H]' 1 DHPC 42.7 ? mM '[U-2H]' 1 TCEP 1.0 ? mM n.a. 1 'sodium azide' 0.01 ? '% w/v' n.a. 1 'sodium phosphate buffer' 20.0 ? mM n.a. 1 TSP 0.5 ? mM d4 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label bicelles _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 2 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 3 1 1 '2D 1H-15N TROSY HSQC' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D HNCO' 1 isotropic 7 1 1 '3D HN(CO)CA' 1 isotropic 8 1 1 '3D HN(CA)CO' 1 isotropic 9 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 10 1 1 '2D HCCH-TOCSY' 1 isotropic 11 1 1 '3D 1H-13C-NOESY, 13C-filtered' 1 isotropic 12 1 1 '1D 1H' 2 isotropic 13 1 1 '2D 1H-15N HSQC' 2 isotropic # _pdbx_nmr_refine.entry_id 8OYD _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA 3.98.5 'Guntert, Mumenthaler and Wuthrich' 2 'structure calculation' CYANA 3.98.5 'Guntert, Mumenthaler and Wuthrich' 3 collection TopSpin 3.2 'Bruker Biospin' 4 'chemical shift assignment' CARA 1.9.1.7 'Keller and Wuthrich' 5 'peak picking' CARA 1.9.1.7 'Keller and Wuthrich' 6 processing TopSpin 3.2 'Bruker Biospin' 7 'structure calculation' TALOS-N ? 'Shen and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLU N N N N 71 GLU CA C N S 72 GLU C C N N 73 GLU O O N N 74 GLU CB C N N 75 GLU CG C N N 76 GLU CD C N N 77 GLU OE1 O N N 78 GLU OE2 O N N 79 GLU OXT O N N 80 GLU H H N N 81 GLU H2 H N N 82 GLU HA H N N 83 GLU HB2 H N N 84 GLU HB3 H N N 85 GLU HG2 H N N 86 GLU HG3 H N N 87 GLU HE2 H N N 88 GLU HXT H N N 89 GLY N N N N 90 GLY CA C N N 91 GLY C C N N 92 GLY O O N N 93 GLY OXT O N N 94 GLY H H N N 95 GLY H2 H N N 96 GLY HA2 H N N 97 GLY HA3 H N N 98 GLY HXT H N N 99 HIS N N N N 100 HIS CA C N S 101 HIS C C N N 102 HIS O O N N 103 HIS CB C N N 104 HIS CG C Y N 105 HIS ND1 N Y N 106 HIS CD2 C Y N 107 HIS CE1 C Y N 108 HIS NE2 N Y N 109 HIS OXT O N N 110 HIS H H N N 111 HIS H2 H N N 112 HIS HA H N N 113 HIS HB2 H N N 114 HIS HB3 H N N 115 HIS HD1 H N N 116 HIS HD2 H N N 117 HIS HE1 H N N 118 HIS HE2 H N N 119 HIS HXT H N N 120 ILE N N N N 121 ILE CA C N S 122 ILE C C N N 123 ILE O O N N 124 ILE CB C N S 125 ILE CG1 C N N 126 ILE CG2 C N N 127 ILE CD1 C N N 128 ILE OXT O N N 129 ILE H H N N 130 ILE H2 H N N 131 ILE HA H N N 132 ILE HB H N N 133 ILE HG12 H N N 134 ILE HG13 H N N 135 ILE HG21 H N N 136 ILE HG22 H N N 137 ILE HG23 H N N 138 ILE HD11 H N N 139 ILE HD12 H N N 140 ILE HD13 H N N 141 ILE HXT H N N 142 LEU N N N N 143 LEU CA C N S 144 LEU C C N N 145 LEU O O N N 146 LEU CB C N N 147 LEU CG C N N 148 LEU CD1 C N N 149 LEU CD2 C N N 150 LEU OXT O N N 151 LEU H H N N 152 LEU H2 H N N 153 LEU HA H N N 154 LEU HB2 H N N 155 LEU HB3 H N N 156 LEU HG H N N 157 LEU HD11 H N N 158 LEU HD12 H N N 159 LEU HD13 H N N 160 LEU HD21 H N N 161 LEU HD22 H N N 162 LEU HD23 H N N 163 LEU HXT H N N 164 LYS N N N N 165 LYS CA C N S 166 LYS C C N N 167 LYS O O N N 168 LYS CB C N N 169 LYS CG C N N 170 LYS CD C N N 171 LYS CE C N N 172 LYS NZ N N N 173 LYS OXT O N N 174 LYS H H N N 175 LYS H2 H N N 176 LYS HA H N N 177 LYS HB2 H N N 178 LYS HB3 H N N 179 LYS HG2 H N N 180 LYS HG3 H N N 181 LYS HD2 H N N 182 LYS HD3 H N N 183 LYS HE2 H N N 184 LYS HE3 H N N 185 LYS HZ1 H N N 186 LYS HZ2 H N N 187 LYS HZ3 H N N 188 LYS HXT H N N 189 MET N N N N 190 MET CA C N S 191 MET C C N N 192 MET O O N N 193 MET CB C N N 194 MET CG C N N 195 MET SD S N N 196 MET CE C N N 197 MET OXT O N N 198 MET H H N N 199 MET H2 H N N 200 MET HA H N N 201 MET HB2 H N N 202 MET HB3 H N N 203 MET HG2 H N N 204 MET HG3 H N N 205 MET HE1 H N N 206 MET HE2 H N N 207 MET HE3 H N N 208 MET HXT H N N 209 PHE N N N N 210 PHE CA C N S 211 PHE C C N N 212 PHE O O N N 213 PHE CB C N N 214 PHE CG C Y N 215 PHE CD1 C Y N 216 PHE CD2 C Y N 217 PHE CE1 C Y N 218 PHE CE2 C Y N 219 PHE CZ C Y N 220 PHE OXT O N N 221 PHE H H N N 222 PHE H2 H N N 223 PHE HA H N N 224 PHE HB2 H N N 225 PHE HB3 H N N 226 PHE HD1 H N N 227 PHE HD2 H N N 228 PHE HE1 H N N 229 PHE HE2 H N N 230 PHE HZ H N N 231 PHE HXT H N N 232 SER N N N N 233 SER CA C N S 234 SER C C N N 235 SER O O N N 236 SER CB C N N 237 SER OG O N N 238 SER OXT O N N 239 SER H H N N 240 SER H2 H N N 241 SER HA H N N 242 SER HB2 H N N 243 SER HB3 H N N 244 SER HG H N N 245 SER HXT H N N 246 THR N N N N 247 THR CA C N S 248 THR C C N N 249 THR O O N N 250 THR CB C N R 251 THR OG1 O N N 252 THR CG2 C N N 253 THR OXT O N N 254 THR H H N N 255 THR H2 H N N 256 THR HA H N N 257 THR HB H N N 258 THR HG1 H N N 259 THR HG21 H N N 260 THR HG22 H N N 261 THR HG23 H N N 262 THR HXT H N N 263 TYR N N N N 264 TYR CA C N S 265 TYR C C N N 266 TYR O O N N 267 TYR CB C N N 268 TYR CG C Y N 269 TYR CD1 C Y N 270 TYR CD2 C Y N 271 TYR CE1 C Y N 272 TYR CE2 C Y N 273 TYR CZ C Y N 274 TYR OH O N N 275 TYR OXT O N N 276 TYR H H N N 277 TYR H2 H N N 278 TYR HA H N N 279 TYR HB2 H N N 280 TYR HB3 H N N 281 TYR HD1 H N N 282 TYR HD2 H N N 283 TYR HE1 H N N 284 TYR HE2 H N N 285 TYR HH H N N 286 TYR HXT H N N 287 VAL N N N N 288 VAL CA C N S 289 VAL C C N N 290 VAL O O N N 291 VAL CB C N N 292 VAL CG1 C N N 293 VAL CG2 C N N 294 VAL OXT O N N 295 VAL H H N N 296 VAL H2 H N N 297 VAL HA H N N 298 VAL HB H N N 299 VAL HG11 H N N 300 VAL HG12 H N N 301 VAL HG13 H N N 302 VAL HG21 H N N 303 VAL HG22 H N N 304 VAL HG23 H N N 305 VAL HXT H N N 306 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLU N CA sing N N 67 GLU N H sing N N 68 GLU N H2 sing N N 69 GLU CA C sing N N 70 GLU CA CB sing N N 71 GLU CA HA sing N N 72 GLU C O doub N N 73 GLU C OXT sing N N 74 GLU CB CG sing N N 75 GLU CB HB2 sing N N 76 GLU CB HB3 sing N N 77 GLU CG CD sing N N 78 GLU CG HG2 sing N N 79 GLU CG HG3 sing N N 80 GLU CD OE1 doub N N 81 GLU CD OE2 sing N N 82 GLU OE2 HE2 sing N N 83 GLU OXT HXT sing N N 84 GLY N CA sing N N 85 GLY N H sing N N 86 GLY N H2 sing N N 87 GLY CA C sing N N 88 GLY CA HA2 sing N N 89 GLY CA HA3 sing N N 90 GLY C O doub N N 91 GLY C OXT sing N N 92 GLY OXT HXT sing N N 93 HIS N CA sing N N 94 HIS N H sing N N 95 HIS N H2 sing N N 96 HIS CA C sing N N 97 HIS CA CB sing N N 98 HIS CA HA sing N N 99 HIS C O doub N N 100 HIS C OXT sing N N 101 HIS CB CG sing N N 102 HIS CB HB2 sing N N 103 HIS CB HB3 sing N N 104 HIS CG ND1 sing Y N 105 HIS CG CD2 doub Y N 106 HIS ND1 CE1 doub Y N 107 HIS ND1 HD1 sing N N 108 HIS CD2 NE2 sing Y N 109 HIS CD2 HD2 sing N N 110 HIS CE1 NE2 sing Y N 111 HIS CE1 HE1 sing N N 112 HIS NE2 HE2 sing N N 113 HIS OXT HXT sing N N 114 ILE N CA sing N N 115 ILE N H sing N N 116 ILE N H2 sing N N 117 ILE CA C sing N N 118 ILE CA CB sing N N 119 ILE CA HA sing N N 120 ILE C O doub N N 121 ILE C OXT sing N N 122 ILE CB CG1 sing N N 123 ILE CB CG2 sing N N 124 ILE CB HB sing N N 125 ILE CG1 CD1 sing N N 126 ILE CG1 HG12 sing N N 127 ILE CG1 HG13 sing N N 128 ILE CG2 HG21 sing N N 129 ILE CG2 HG22 sing N N 130 ILE CG2 HG23 sing N N 131 ILE CD1 HD11 sing N N 132 ILE CD1 HD12 sing N N 133 ILE CD1 HD13 sing N N 134 ILE OXT HXT sing N N 135 LEU N CA sing N N 136 LEU N H sing N N 137 LEU N H2 sing N N 138 LEU CA C sing N N 139 LEU CA CB sing N N 140 LEU CA HA sing N N 141 LEU C O doub N N 142 LEU C OXT sing N N 143 LEU CB CG sing N N 144 LEU CB HB2 sing N N 145 LEU CB HB3 sing N N 146 LEU CG CD1 sing N N 147 LEU CG CD2 sing N N 148 LEU CG HG sing N N 149 LEU CD1 HD11 sing N N 150 LEU CD1 HD12 sing N N 151 LEU CD1 HD13 sing N N 152 LEU CD2 HD21 sing N N 153 LEU CD2 HD22 sing N N 154 LEU CD2 HD23 sing N N 155 LEU OXT HXT sing N N 156 LYS N CA sing N N 157 LYS N H sing N N 158 LYS N H2 sing N N 159 LYS CA C sing N N 160 LYS CA CB sing N N 161 LYS CA HA sing N N 162 LYS C O doub N N 163 LYS C OXT sing N N 164 LYS CB CG sing N N 165 LYS CB HB2 sing N N 166 LYS CB HB3 sing N N 167 LYS CG CD sing N N 168 LYS CG HG2 sing N N 169 LYS CG HG3 sing N N 170 LYS CD CE sing N N 171 LYS CD HD2 sing N N 172 LYS CD HD3 sing N N 173 LYS CE NZ sing N N 174 LYS CE HE2 sing N N 175 LYS CE HE3 sing N N 176 LYS NZ HZ1 sing N N 177 LYS NZ HZ2 sing N N 178 LYS NZ HZ3 sing N N 179 LYS OXT HXT sing N N 180 MET N CA sing N N 181 MET N H sing N N 182 MET N H2 sing N N 183 MET CA C sing N N 184 MET CA CB sing N N 185 MET CA HA sing N N 186 MET C O doub N N 187 MET C OXT sing N N 188 MET CB CG sing N N 189 MET CB HB2 sing N N 190 MET CB HB3 sing N N 191 MET CG SD sing N N 192 MET CG HG2 sing N N 193 MET CG HG3 sing N N 194 MET SD CE sing N N 195 MET CE HE1 sing N N 196 MET CE HE2 sing N N 197 MET CE HE3 sing N N 198 MET OXT HXT sing N N 199 PHE N CA sing N N 200 PHE N H sing N N 201 PHE N H2 sing N N 202 PHE CA C sing N N 203 PHE CA CB sing N N 204 PHE CA HA sing N N 205 PHE C O doub N N 206 PHE C OXT sing N N 207 PHE CB CG sing N N 208 PHE CB HB2 sing N N 209 PHE CB HB3 sing N N 210 PHE CG CD1 doub Y N 211 PHE CG CD2 sing Y N 212 PHE CD1 CE1 sing Y N 213 PHE CD1 HD1 sing N N 214 PHE CD2 CE2 doub Y N 215 PHE CD2 HD2 sing N N 216 PHE CE1 CZ doub Y N 217 PHE CE1 HE1 sing N N 218 PHE CE2 CZ sing Y N 219 PHE CE2 HE2 sing N N 220 PHE CZ HZ sing N N 221 PHE OXT HXT sing N N 222 SER N CA sing N N 223 SER N H sing N N 224 SER N H2 sing N N 225 SER CA C sing N N 226 SER CA CB sing N N 227 SER CA HA sing N N 228 SER C O doub N N 229 SER C OXT sing N N 230 SER CB OG sing N N 231 SER CB HB2 sing N N 232 SER CB HB3 sing N N 233 SER OG HG sing N N 234 SER OXT HXT sing N N 235 THR N CA sing N N 236 THR N H sing N N 237 THR N H2 sing N N 238 THR CA C sing N N 239 THR CA CB sing N N 240 THR CA HA sing N N 241 THR C O doub N N 242 THR C OXT sing N N 243 THR CB OG1 sing N N 244 THR CB CG2 sing N N 245 THR CB HB sing N N 246 THR OG1 HG1 sing N N 247 THR CG2 HG21 sing N N 248 THR CG2 HG22 sing N N 249 THR CG2 HG23 sing N N 250 THR OXT HXT sing N N 251 TYR N CA sing N N 252 TYR N H sing N N 253 TYR N H2 sing N N 254 TYR CA C sing N N 255 TYR CA CB sing N N 256 TYR CA HA sing N N 257 TYR C O doub N N 258 TYR C OXT sing N N 259 TYR CB CG sing N N 260 TYR CB HB2 sing N N 261 TYR CB HB3 sing N N 262 TYR CG CD1 doub Y N 263 TYR CG CD2 sing Y N 264 TYR CD1 CE1 sing Y N 265 TYR CD1 HD1 sing N N 266 TYR CD2 CE2 doub Y N 267 TYR CD2 HD2 sing N N 268 TYR CE1 CZ doub Y N 269 TYR CE1 HE1 sing N N 270 TYR CE2 CZ sing Y N 271 TYR CE2 HE2 sing N N 272 TYR CZ OH sing N N 273 TYR OH HH sing N N 274 TYR OXT HXT sing N N 275 VAL N CA sing N N 276 VAL N H sing N N 277 VAL N H2 sing N N 278 VAL CA C sing N N 279 VAL CA CB sing N N 280 VAL CA HA sing N N 281 VAL C O doub N N 282 VAL C OXT sing N N 283 VAL CB CG1 sing N N 284 VAL CB CG2 sing N N 285 VAL CB HB sing N N 286 VAL CG1 HG11 sing N N 287 VAL CG1 HG12 sing N N 288 VAL CG1 HG13 sing N N 289 VAL CG2 HG21 sing N N 290 VAL CG2 HG22 sing N N 291 VAL CG2 HG23 sing N N 292 VAL OXT HXT sing N N 293 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 22-14-00130 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 'cryogenic triple resonance probe' 2 AVANCE ? Bruker 700 'room temperature triple resonance probe' # _atom_sites.entry_id 8OYD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_