data_8PUP # _entry.id 8PUP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8PUP pdb_00008pup 10.2210/pdb8pup/pdb WWPDB D_1292131599 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-12-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8PUP _pdbx_database_status.recvd_initial_deposition_date 2023-07-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email milan.kozisek@uochb.cas.cz _pdbx_contact_author.name_first Milan _pdbx_contact_author.name_last Kozisek _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9476-3409 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kotacka, T.' 1 0009-0005-1681-5348 'Radilova, K.' 2 0000-0001-8917-2359 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country DE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chemmedchem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1860-7187 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first e202400577 _citation.page_last e202400577 _citation.title ;3'-Dehydroxypurpurogallin-4-Carboxamides as Influenza A Endonuclease Inhibitors: Synthesis, Structure-Activity Relationship Analysis, and Structural Characterization of Protein Complex. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cmdc.202400577 _citation.pdbx_database_id_PubMed 39400442 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kral, M.' 1 0000-0003-0334-9569 primary 'Kotacka, T.' 2 0009-0005-1681-5348 primary 'Reiberger, R.' 3 0000-0001-7878-9310 primary 'Panyrkova, G.' 4 0009-0000-8559-2284 primary 'Radilova, K.' 5 0000-0001-8917-2359 primary 'Osifova, Z.' 6 0000-0002-7165-6838 primary 'Flieger, M.' 7 ? primary 'Konvalinka, J.' 8 0000-0003-0695-9266 primary 'Majer, P.' 9 0000-0002-1804-6934 primary 'Kozisek, M.' 10 0000-0002-9476-3409 primary 'Machara, A.' 11 0000-0002-1139-2762 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein' 21640.570 1 3.1.-.- ? ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 5 ? ? ? ? 5 non-polymer syn '~{N}-[(4-hydroxyphenyl)methyl]-3,4,6-tris(oxidanyl)-5-oxidanylidene-benzo[7]annulene-8-carboxamide' 353.326 1 ? ? ? ? 6 water nat water 18.015 68 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SGSGSGSGSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTV VNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRAR IKTRLFTIRQEMASRSLWDSFRQSER ; _entity_poly.pdbx_seq_one_letter_code_can ;SGSGSGSGSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTV VNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRAR IKTRLFTIRQEMASRSLWDSFRQSER ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 'MAGNESIUM ION' MG 4 1,2-ETHANEDIOL EDO 5 '~{N}-[(4-hydroxyphenyl)methyl]-3,4,6-tris(oxidanyl)-5-oxidanylidene-benzo[7]annulene-8-carboxamide' H2I 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 GLY n 1 7 SER n 1 8 GLY n 1 9 SER n 1 10 MET n 1 11 GLU n 1 12 ASP n 1 13 PHE n 1 14 VAL n 1 15 ARG n 1 16 GLN n 1 17 CYS n 1 18 PHE n 1 19 ASN n 1 20 PRO n 1 21 MET n 1 22 ILE n 1 23 VAL n 1 24 GLU n 1 25 LEU n 1 26 ALA n 1 27 GLU n 1 28 LYS n 1 29 ALA n 1 30 MET n 1 31 LYS n 1 32 GLU n 1 33 TYR n 1 34 GLY n 1 35 GLU n 1 36 ASP n 1 37 PRO n 1 38 LYS n 1 39 ILE n 1 40 GLU n 1 41 THR n 1 42 ASN n 1 43 LYS n 1 44 PHE n 1 45 ALA n 1 46 ALA n 1 47 ILE n 1 48 CYS n 1 49 THR n 1 50 HIS n 1 51 LEU n 1 52 GLU n 1 53 VAL n 1 54 CYS n 1 55 PHE n 1 56 MET n 1 57 TYR n 1 58 SER n 1 59 ASP n 1 60 GLY n 1 61 GLY n 1 62 SER n 1 63 LYS n 1 64 HIS n 1 65 ARG n 1 66 PHE n 1 67 GLU n 1 68 ILE n 1 69 ILE n 1 70 GLU n 1 71 GLY n 1 72 ARG n 1 73 ASP n 1 74 ARG n 1 75 ILE n 1 76 MET n 1 77 ALA n 1 78 TRP n 1 79 THR n 1 80 VAL n 1 81 VAL n 1 82 ASN n 1 83 SER n 1 84 ILE n 1 85 CYS n 1 86 ASN n 1 87 THR n 1 88 THR n 1 89 GLY n 1 90 VAL n 1 91 GLU n 1 92 LYS n 1 93 PRO n 1 94 LYS n 1 95 PHE n 1 96 LEU n 1 97 PRO n 1 98 ASP n 1 99 LEU n 1 100 TYR n 1 101 ASP n 1 102 TYR n 1 103 LYS n 1 104 GLU n 1 105 ASN n 1 106 ARG n 1 107 PHE n 1 108 ILE n 1 109 GLU n 1 110 ILE n 1 111 GLY n 1 112 VAL n 1 113 THR n 1 114 ARG n 1 115 ARG n 1 116 GLU n 1 117 VAL n 1 118 HIS n 1 119 ILE n 1 120 TYR n 1 121 TYR n 1 122 LEU n 1 123 GLU n 1 124 LYS n 1 125 ALA n 1 126 ASN n 1 127 LYS n 1 128 ILE n 1 129 LYS n 1 130 SER n 1 131 GLU n 1 132 LYS n 1 133 THR n 1 134 HIS n 1 135 ILE n 1 136 HIS n 1 137 ILE n 1 138 PHE n 1 139 SER n 1 140 PHE n 1 141 THR n 1 142 GLY n 1 143 GLU n 1 144 GLU n 1 145 MET n 1 146 ALA n 1 147 THR n 1 148 LYS n 1 149 ALA n 1 150 ASP n 1 151 TYR n 1 152 THR n 1 153 LEU n 1 154 ASP n 1 155 GLU n 1 156 GLU n 1 157 SER n 1 158 ARG n 1 159 ALA n 1 160 ARG n 1 161 ILE n 1 162 LYS n 1 163 THR n 1 164 ARG n 1 165 LEU n 1 166 PHE n 1 167 THR n 1 168 ILE n 1 169 ARG n 1 170 GLN n 1 171 GLU n 1 172 MET n 1 173 ALA n 1 174 SER n 1 175 ARG n 1 176 SER n 1 177 LEU n 1 178 TRP n 1 179 ASP n 1 180 SER n 1 181 PHE n 1 182 ARG n 1 183 GLN n 1 184 SER n 1 185 GLU n 1 186 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 59 ? ? PA ? ? ? ? ? ? 'Influenza A virus (A/California/07/2009(H1N1))' 641809 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 60 186 ? ? PA ? ? ? ? ? ? 'Influenza A virus (A/California/07/2009(H1N1))' 641809 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 H2I non-polymer . '~{N}-[(4-hydroxyphenyl)methyl]-3,4,6-tris(oxidanyl)-5-oxidanylidene-benzo[7]annulene-8-carboxamide' ? 'C19 H15 N O6' 353.326 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -8 ? ? ? A . n A 1 2 GLY 2 -7 ? ? ? A . n A 1 3 SER 3 -6 ? ? ? A . n A 1 4 GLY 4 -5 ? ? ? A . n A 1 5 SER 5 -4 -4 SER SER A . n A 1 6 GLY 6 -3 -3 GLY GLY A . n A 1 7 SER 7 -2 -2 SER SER A . n A 1 8 GLY 8 -1 -1 GLY GLY A . n A 1 9 SER 9 0 0 SER SER A . n A 1 10 MET 10 1 1 MET MET A . n A 1 11 GLU 11 2 2 GLU GLU A . n A 1 12 ASP 12 3 3 ASP ASP A . n A 1 13 PHE 13 4 4 PHE PHE A . n A 1 14 VAL 14 5 5 VAL VAL A . n A 1 15 ARG 15 6 6 ARG ARG A . n A 1 16 GLN 16 7 7 GLN GLN A . n A 1 17 CYS 17 8 8 CYS CYS A . n A 1 18 PHE 18 9 9 PHE PHE A . n A 1 19 ASN 19 10 10 ASN ASN A . n A 1 20 PRO 20 11 11 PRO PRO A . n A 1 21 MET 21 12 12 MET MET A . n A 1 22 ILE 22 13 13 ILE ILE A . n A 1 23 VAL 23 14 14 VAL VAL A . n A 1 24 GLU 24 15 15 GLU GLU A . n A 1 25 LEU 25 16 16 LEU LEU A . n A 1 26 ALA 26 17 17 ALA ALA A . n A 1 27 GLU 27 18 18 GLU GLU A . n A 1 28 LYS 28 19 19 LYS LYS A . n A 1 29 ALA 29 20 20 ALA ALA A . n A 1 30 MET 30 21 21 MET MET A . n A 1 31 LYS 31 22 22 LYS LYS A . n A 1 32 GLU 32 23 23 GLU GLU A . n A 1 33 TYR 33 24 24 TYR TYR A . n A 1 34 GLY 34 25 25 GLY GLY A . n A 1 35 GLU 35 26 26 GLU GLU A . n A 1 36 ASP 36 27 27 ASP ASP A . n A 1 37 PRO 37 28 28 PRO PRO A . n A 1 38 LYS 38 29 29 LYS LYS A . n A 1 39 ILE 39 30 30 ILE ILE A . n A 1 40 GLU 40 31 31 GLU GLU A . n A 1 41 THR 41 32 32 THR THR A . n A 1 42 ASN 42 33 33 ASN ASN A . n A 1 43 LYS 43 34 34 LYS LYS A . n A 1 44 PHE 44 35 35 PHE PHE A . n A 1 45 ALA 45 36 36 ALA ALA A . n A 1 46 ALA 46 37 37 ALA ALA A . n A 1 47 ILE 47 38 38 ILE ILE A . n A 1 48 CYS 48 39 39 CYS CYS A . n A 1 49 THR 49 40 40 THR THR A . n A 1 50 HIS 50 41 41 HIS HIS A . n A 1 51 LEU 51 42 42 LEU LEU A . n A 1 52 GLU 52 43 43 GLU GLU A . n A 1 53 VAL 53 44 44 VAL VAL A . n A 1 54 CYS 54 45 45 CYS CYS A . n A 1 55 PHE 55 46 46 PHE PHE A . n A 1 56 MET 56 47 47 MET MET A . n A 1 57 TYR 57 48 48 TYR TYR A . n A 1 58 SER 58 49 49 SER SER A . n A 1 59 ASP 59 50 50 ASP ASP A . n A 1 60 GLY 60 51 51 GLY GLY A . n A 1 61 GLY 61 52 52 GLY GLY A . n A 1 62 SER 62 72 72 SER SER A . n A 1 63 LYS 63 73 73 LYS LYS A . n A 1 64 HIS 64 74 74 HIS HIS A . n A 1 65 ARG 65 75 75 ARG ARG A . n A 1 66 PHE 66 76 76 PHE PHE A . n A 1 67 GLU 67 77 77 GLU GLU A . n A 1 68 ILE 68 78 78 ILE ILE A . n A 1 69 ILE 69 79 79 ILE ILE A . n A 1 70 GLU 70 80 80 GLU GLU A . n A 1 71 GLY 71 81 81 GLY GLY A . n A 1 72 ARG 72 82 82 ARG ARG A . n A 1 73 ASP 73 83 83 ASP ASP A . n A 1 74 ARG 74 84 84 ARG ARG A . n A 1 75 ILE 75 85 85 ILE ILE A . n A 1 76 MET 76 86 86 MET MET A . n A 1 77 ALA 77 87 87 ALA ALA A . n A 1 78 TRP 78 88 88 TRP TRP A . n A 1 79 THR 79 89 89 THR THR A . n A 1 80 VAL 80 90 90 VAL VAL A . n A 1 81 VAL 81 91 91 VAL VAL A . n A 1 82 ASN 82 92 92 ASN ASN A . n A 1 83 SER 83 93 93 SER SER A . n A 1 84 ILE 84 94 94 ILE ILE A . n A 1 85 CYS 85 95 95 CYS CYS A . n A 1 86 ASN 86 96 96 ASN ASN A . n A 1 87 THR 87 97 97 THR THR A . n A 1 88 THR 88 98 98 THR THR A . n A 1 89 GLY 89 99 99 GLY GLY A . n A 1 90 VAL 90 100 100 VAL VAL A . n A 1 91 GLU 91 101 101 GLU GLU A . n A 1 92 LYS 92 102 102 LYS LYS A . n A 1 93 PRO 93 103 103 PRO PRO A . n A 1 94 LYS 94 104 104 LYS LYS A . n A 1 95 PHE 95 105 105 PHE PHE A . n A 1 96 LEU 96 106 106 LEU LEU A . n A 1 97 PRO 97 107 107 PRO PRO A . n A 1 98 ASP 98 108 108 ASP ASP A . n A 1 99 LEU 99 109 109 LEU LEU A . n A 1 100 TYR 100 110 110 TYR TYR A . n A 1 101 ASP 101 111 111 ASP ASP A . n A 1 102 TYR 102 112 112 TYR TYR A . n A 1 103 LYS 103 113 113 LYS LYS A . n A 1 104 GLU 104 114 114 GLU GLU A . n A 1 105 ASN 105 115 115 ASN ASN A . n A 1 106 ARG 106 116 116 ARG ARG A . n A 1 107 PHE 107 117 117 PHE PHE A . n A 1 108 ILE 108 118 118 ILE ILE A . n A 1 109 GLU 109 119 119 GLU GLU A . n A 1 110 ILE 110 120 120 ILE ILE A . n A 1 111 GLY 111 121 121 GLY GLY A . n A 1 112 VAL 112 122 122 VAL VAL A . n A 1 113 THR 113 123 123 THR THR A . n A 1 114 ARG 114 124 124 ARG ARG A . n A 1 115 ARG 115 125 125 ARG ARG A . n A 1 116 GLU 116 126 126 GLU GLU A . n A 1 117 VAL 117 127 127 VAL VAL A . n A 1 118 HIS 118 128 128 HIS HIS A . n A 1 119 ILE 119 129 129 ILE ILE A . n A 1 120 TYR 120 130 130 TYR TYR A . n A 1 121 TYR 121 131 131 TYR TYR A . n A 1 122 LEU 122 132 132 LEU LEU A . n A 1 123 GLU 123 133 133 GLU GLU A . n A 1 124 LYS 124 134 134 LYS LYS A . n A 1 125 ALA 125 135 135 ALA ALA A . n A 1 126 ASN 126 136 136 ASN ASN A . n A 1 127 LYS 127 137 137 LYS LYS A . n A 1 128 ILE 128 138 138 ILE ILE A . n A 1 129 LYS 129 139 139 LYS LYS A . n A 1 130 SER 130 140 140 SER SER A . n A 1 131 GLU 131 141 141 GLU GLU A . n A 1 132 LYS 132 142 142 LYS LYS A . n A 1 133 THR 133 143 143 THR THR A . n A 1 134 HIS 134 144 144 HIS HIS A . n A 1 135 ILE 135 145 145 ILE ILE A . n A 1 136 HIS 136 146 146 HIS HIS A . n A 1 137 ILE 137 147 147 ILE ILE A . n A 1 138 PHE 138 148 148 PHE PHE A . n A 1 139 SER 139 149 149 SER SER A . n A 1 140 PHE 140 150 150 PHE PHE A . n A 1 141 THR 141 151 151 THR THR A . n A 1 142 GLY 142 152 152 GLY GLY A . n A 1 143 GLU 143 153 153 GLU GLU A . n A 1 144 GLU 144 154 154 GLU GLU A . n A 1 145 MET 145 155 155 MET MET A . n A 1 146 ALA 146 156 156 ALA ALA A . n A 1 147 THR 147 157 157 THR THR A . n A 1 148 LYS 148 158 158 LYS LYS A . n A 1 149 ALA 149 159 159 ALA ALA A . n A 1 150 ASP 150 160 160 ASP ASP A . n A 1 151 TYR 151 161 161 TYR TYR A . n A 1 152 THR 152 162 162 THR THR A . n A 1 153 LEU 153 163 163 LEU LEU A . n A 1 154 ASP 154 164 164 ASP ASP A . n A 1 155 GLU 155 165 165 GLU GLU A . n A 1 156 GLU 156 166 166 GLU GLU A . n A 1 157 SER 157 167 167 SER SER A . n A 1 158 ARG 158 168 168 ARG ARG A . n A 1 159 ALA 159 169 169 ALA ALA A . n A 1 160 ARG 160 170 170 ARG ARG A . n A 1 161 ILE 161 171 171 ILE ILE A . n A 1 162 LYS 162 172 172 LYS LYS A . n A 1 163 THR 163 173 173 THR THR A . n A 1 164 ARG 164 174 174 ARG ARG A . n A 1 165 LEU 165 175 175 LEU LEU A . n A 1 166 PHE 166 176 176 PHE PHE A . n A 1 167 THR 167 177 177 THR THR A . n A 1 168 ILE 168 178 178 ILE ILE A . n A 1 169 ARG 169 179 179 ARG ARG A . n A 1 170 GLN 170 180 180 GLN GLN A . n A 1 171 GLU 171 181 181 GLU GLU A . n A 1 172 MET 172 182 182 MET MET A . n A 1 173 ALA 173 183 183 ALA ALA A . n A 1 174 SER 174 184 184 SER SER A . n A 1 175 ARG 175 185 185 ARG ARG A . n A 1 176 SER 176 186 186 SER SER A . n A 1 177 LEU 177 187 187 LEU LEU A . n A 1 178 TRP 178 188 188 TRP TRP A . n A 1 179 ASP 179 189 189 ASP ASP A . n A 1 180 SER 180 190 190 SER SER A . n A 1 181 PHE 181 191 191 PHE PHE A . n A 1 182 ARG 182 192 192 ARG ARG A . n A 1 183 GLN 183 193 193 GLN GLN A . n A 1 184 SER 184 194 194 SER SER A . n A 1 185 GLU 185 195 195 GLU GLU A . n A 1 186 ARG 186 196 196 ARG ARG A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id H2I _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id H2I _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 201 1 MN MN A . C 3 MG 1 202 2 MG MG A . D 4 EDO 1 203 1 EDO EDO A . E 4 EDO 1 204 2 EDO EDO A . F 4 EDO 1 205 3 EDO EDO A . G 4 EDO 1 206 4 EDO EDO A . H 4 EDO 1 207 5 EDO EDO A . I 5 H2I 1 208 1 H2I LIG A . J 6 HOH 1 301 62 HOH HOH A . J 6 HOH 2 302 63 HOH HOH A . J 6 HOH 3 303 23 HOH HOH A . J 6 HOH 4 304 15 HOH HOH A . J 6 HOH 5 305 71 HOH HOH A . J 6 HOH 6 306 35 HOH HOH A . J 6 HOH 7 307 14 HOH HOH A . J 6 HOH 8 308 61 HOH HOH A . J 6 HOH 9 309 2 HOH HOH A . J 6 HOH 10 310 38 HOH HOH A . J 6 HOH 11 311 30 HOH HOH A . J 6 HOH 12 312 16 HOH HOH A . J 6 HOH 13 313 49 HOH HOH A . J 6 HOH 14 314 46 HOH HOH A . J 6 HOH 15 315 53 HOH HOH A . J 6 HOH 16 316 13 HOH HOH A . J 6 HOH 17 317 3 HOH HOH A . J 6 HOH 18 318 22 HOH HOH A . J 6 HOH 19 319 1 HOH HOH A . J 6 HOH 20 320 52 HOH HOH A . J 6 HOH 21 321 45 HOH HOH A . J 6 HOH 22 322 67 HOH HOH A . J 6 HOH 23 323 40 HOH HOH A . J 6 HOH 24 324 19 HOH HOH A . J 6 HOH 25 325 43 HOH HOH A . J 6 HOH 26 326 51 HOH HOH A . J 6 HOH 27 327 8 HOH HOH A . J 6 HOH 28 328 17 HOH HOH A . J 6 HOH 29 329 10 HOH HOH A . J 6 HOH 30 330 66 HOH HOH A . J 6 HOH 31 331 25 HOH HOH A . J 6 HOH 32 332 20 HOH HOH A . J 6 HOH 33 333 12 HOH HOH A . J 6 HOH 34 334 11 HOH HOH A . J 6 HOH 35 335 21 HOH HOH A . J 6 HOH 36 336 59 HOH HOH A . J 6 HOH 37 337 9 HOH HOH A . J 6 HOH 38 338 26 HOH HOH A . J 6 HOH 39 339 24 HOH HOH A . J 6 HOH 40 340 5 HOH HOH A . J 6 HOH 41 341 44 HOH HOH A . J 6 HOH 42 342 27 HOH HOH A . J 6 HOH 43 343 4 HOH HOH A . J 6 HOH 44 344 70 HOH HOH A . J 6 HOH 45 345 7 HOH HOH A . J 6 HOH 46 346 58 HOH HOH A . J 6 HOH 47 347 6 HOH HOH A . J 6 HOH 48 348 48 HOH HOH A . J 6 HOH 49 349 47 HOH HOH A . J 6 HOH 50 350 56 HOH HOH A . J 6 HOH 51 351 65 HOH HOH A . J 6 HOH 52 352 32 HOH HOH A . J 6 HOH 53 353 42 HOH HOH A . J 6 HOH 54 354 69 HOH HOH A . J 6 HOH 55 355 50 HOH HOH A . J 6 HOH 56 356 29 HOH HOH A . J 6 HOH 57 357 54 HOH HOH A . J 6 HOH 58 358 37 HOH HOH A . J 6 HOH 59 359 39 HOH HOH A . J 6 HOH 60 360 33 HOH HOH A . J 6 HOH 61 361 28 HOH HOH A . J 6 HOH 62 362 57 HOH HOH A . J 6 HOH 63 363 36 HOH HOH A . J 6 HOH 64 364 41 HOH HOH A . J 6 HOH 65 365 31 HOH HOH A . J 6 HOH 66 366 18 HOH HOH A . J 6 HOH 67 367 68 HOH HOH A . J 6 HOH 68 368 34 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER -2 ? OG ? A SER 7 OG 2 1 Y 1 A LYS 29 ? CD ? A LYS 38 CD 3 1 Y 1 A LYS 29 ? CE ? A LYS 38 CE 4 1 Y 1 A LYS 29 ? NZ ? A LYS 38 NZ 5 1 Y 1 A LYS 73 ? CG ? A LYS 63 CG 6 1 Y 1 A LYS 73 ? CD ? A LYS 63 CD 7 1 Y 1 A LYS 73 ? CE ? A LYS 63 CE 8 1 Y 1 A LYS 73 ? NZ ? A LYS 63 NZ 9 1 Y 1 A GLU 101 ? CG ? A GLU 91 CG 10 1 Y 1 A GLU 101 ? CD ? A GLU 91 CD 11 1 Y 1 A GLU 101 ? OE1 ? A GLU 91 OE1 12 1 Y 1 A GLU 101 ? OE2 ? A GLU 91 OE2 13 1 Y 1 A LYS 104 ? CG ? A LYS 94 CG 14 1 Y 1 A LYS 104 ? CD ? A LYS 94 CD 15 1 Y 1 A LYS 104 ? CE ? A LYS 94 CE 16 1 Y 1 A LYS 104 ? NZ ? A LYS 94 NZ 17 1 Y 1 A LYS 137 ? CG ? A LYS 127 CG 18 1 Y 1 A LYS 137 ? CD ? A LYS 127 CD 19 1 Y 1 A LYS 137 ? CE ? A LYS 127 CE 20 1 Y 1 A LYS 137 ? NZ ? A LYS 127 NZ 21 1 Y 1 A LYS 139 ? CG ? A LYS 129 CG 22 1 Y 1 A LYS 139 ? CD ? A LYS 129 CD 23 1 Y 1 A LYS 139 ? CE ? A LYS 129 CE 24 1 Y 1 A LYS 139 ? NZ ? A LYS 129 NZ 25 1 Y 1 A GLU 141 ? CG ? A GLU 131 CG 26 1 Y 1 A GLU 141 ? CD ? A GLU 131 CD 27 1 Y 1 A GLU 141 ? OE1 ? A GLU 131 OE1 28 1 Y 1 A GLU 141 ? OE2 ? A GLU 131 OE2 29 1 Y 1 A LYS 142 ? CG ? A LYS 132 CG 30 1 Y 1 A LYS 142 ? CD ? A LYS 132 CD 31 1 Y 1 A LYS 142 ? CE ? A LYS 132 CE 32 1 Y 1 A LYS 142 ? NZ ? A LYS 132 NZ 33 1 Y 1 A LYS 158 ? CG ? A LYS 148 CG 34 1 Y 1 A LYS 158 ? CD ? A LYS 148 CD 35 1 Y 1 A LYS 158 ? CE ? A LYS 148 CE 36 1 Y 1 A LYS 158 ? NZ ? A LYS 148 NZ 37 1 Y 1 A GLN 193 ? CG ? A GLN 183 CG 38 1 Y 1 A GLN 193 ? CD ? A GLN 183 CD 39 1 Y 1 A GLN 193 ? OE1 ? A GLN 183 OE1 40 1 Y 1 A GLN 193 ? NE2 ? A GLN 183 NE2 41 1 Y 1 A ARG 196 ? CG ? A ARG 186 CG 42 1 Y 1 A ARG 196 ? CD ? A ARG 186 CD 43 1 Y 1 A ARG 196 ? NE ? A ARG 186 NE 44 1 Y 1 A ARG 196 ? CZ ? A ARG 186 CZ 45 1 Y 1 A ARG 196 ? NH1 ? A ARG 186 NH1 46 1 Y 1 A ARG 196 ? NH2 ? A ARG 186 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0415 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 8PUP _cell.details ? _cell.formula_units_Z ? _cell.length_a 73.950 _cell.length_a_esd ? _cell.length_b 73.950 _cell.length_b_esd ? _cell.length_c 126.610 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8PUP _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8PUP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'MDP, PEG 1000, PEG 3350, Sodium HEPES, MOPS (acid), Magnesium chloride, Calcium chloride' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-03-15 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8PUP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.93 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 28879 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 17.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.85 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.10099999999999999 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.098 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.93 2.05 ? ? ? ? ? ? 4494 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.331 ? ? 1 1 0.29600000000000004 ? ? ? ? 2.167 ? ? ? ? ? ? ? ? ? 2.05 2.19 ? ? ? ? ? ? 4375 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.167 ? ? 2 1 0.74 ? ? ? ? 1.115 ? ? ? ? ? ? ? ? ? 2.19 2.36 ? ? ? ? ? ? 4108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.6970000000000001 ? ? 3 1 0.94 ? ? ? ? 0.6779999999999999 ? ? ? ? ? ? ? ? ? 2.36 2.59 ? ? ? ? ? ? 3795 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.445 ? ? 4 1 0.981 ? ? ? ? 0.434 ? ? ? ? ? ? ? ? ? 2.59 2.89 ? ? ? ? ? ? 3416 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.245 ? ? 5 1 0.993 ? ? ? ? 0.239 ? ? ? ? ? ? ? ? ? 2.89 3.34 ? ? ? ? ? ? 3044 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.128 ? ? 6 1 0.998 ? ? ? ? 0.125 ? ? ? ? ? ? ? ? ? 3.34 4.08 ? ? ? ? ? ? 2557 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.059000000000000004 ? ? 7 1 1.0 ? ? ? ? 0.057999999999999996 ? ? ? ? ? ? ? ? ? 4.08 5.75 ? ? ? ? ? ? 1978 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.04 ? ? 8 1 1.0 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? ? 5.75 50 ? ? ? ? ? ? 1112 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.031 ? ? 9 1 1.0 ? ? ? ? 0.03 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -0.46 _refine.aniso_B[1][2] -0.23 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.46 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 1.49 _refine.B_iso_max ? _refine.B_iso_mean 44.982 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.950 _refine.correlation_coeff_Fo_to_Fc_free 0.936 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8PUP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 45.02 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13683 _refine.ls_number_reflns_R_free 721 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.45 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.21831 _refine.ls_R_factor_R_free 0.26548 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.21587 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.202 _refine.pdbx_overall_ESU_R_Free 0.183 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.850 _refine.overall_SU_ML 0.132 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 45.02 _refine_hist.number_atoms_solvent 68 _refine_hist.number_atoms_total 1566 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1450 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.012 1527 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.008 0.016 1374 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.271 1.682 2047 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.443 1.575 3146 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.852 5.000 181 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 8.240 5.000 21 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.985 10.000 252 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.058 0.200 216 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1825 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 372 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 3.995 4.848 727 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.988 4.848 727 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 5.397 8.692 907 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 5.394 8.696 908 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.114 5.083 800 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.111 5.081 801 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 6.018 9.202 1141 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.889 44.90 1761 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 7.887 44.89 1762 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.000 _refine_ls_shell.d_res_low 2.052 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 49 _refine_ls_shell.number_reflns_R_work 945 _refine_ls_shell.percent_reflns_obs 96.04 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.308 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.310 # _struct.entry_id 8PUP _struct.title 'Influenza A/California/07/2009(H1N1) endonuclease in complex with purpurogallin-like compound' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8PUP _struct_keywords.text 'RNA-dependent RNA polymerase, endonuclease inhibitor, purpurogallin, antivirals, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 4 ? I N N 5 ? J N N 6 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP C3W5X6_9INFA C3W5X6 ? 1 MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 1 2 UNP C3W5X6_9INFA C3W5X6 ? 1 ;KHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; 73 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8PUP A 10 ? 59 ? C3W5X6 1 ? 50 ? 1 50 2 2 8PUP A 63 ? 186 ? C3W5X6 73 ? 196 ? 73 196 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8PUP SER A 1 ? UNP C3W5X6 ? ? 'expression tag' -8 1 1 8PUP GLY A 2 ? UNP C3W5X6 ? ? 'expression tag' -7 2 1 8PUP SER A 3 ? UNP C3W5X6 ? ? 'expression tag' -6 3 1 8PUP GLY A 4 ? UNP C3W5X6 ? ? 'expression tag' -5 4 1 8PUP SER A 5 ? UNP C3W5X6 ? ? 'expression tag' -4 5 1 8PUP GLY A 6 ? UNP C3W5X6 ? ? 'expression tag' -3 6 1 8PUP SER A 7 ? UNP C3W5X6 ? ? 'expression tag' -2 7 1 8PUP GLY A 8 ? UNP C3W5X6 ? ? 'expression tag' -1 8 1 8PUP SER A 9 ? UNP C3W5X6 ? ? 'expression tag' 0 9 1 8PUP GLY A 60 ? UNP C3W5X6 ? ? linker 51 10 1 8PUP GLY A 61 ? UNP C3W5X6 ? ? linker 52 11 1 8PUP SER A 62 ? UNP C3W5X6 ? ? linker 72 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1250 ? 1 MORE 4 ? 1 'SSA (A^2)' 9160 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 7 ? PHE A 18 ? SER A -2 PHE A 9 1 ? 12 HELX_P HELX_P2 AA2 ASN A 19 ? GLU A 32 ? ASN A 10 GLU A 23 1 ? 14 HELX_P HELX_P3 AA3 GLU A 40 ? ASP A 59 ? GLU A 31 ASP A 50 1 ? 20 HELX_P HELX_P4 AA4 ASP A 73 ? GLY A 89 ? ASP A 83 GLY A 99 1 ? 17 HELX_P HELX_P5 AA5 GLU A 116 ? ILE A 128 ? GLU A 126 ILE A 138 1 ? 13 HELX_P HELX_P6 AA6 LYS A 148 ? ASP A 150 ? LYS A 158 ASP A 160 5 ? 3 HELX_P HELX_P7 AA7 ASP A 154 ? ARG A 175 ? ASP A 164 ARG A 185 1 ? 22 HELX_P HELX_P8 AA8 LEU A 177 ? SER A 184 ? LEU A 187 SER A 194 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 50 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 41 A MN 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc2 metalc ? ? A GLU 70 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 80 A MG 202 1_555 ? ? ? ? ? ? ? 2.123 ? ? metalc3 metalc ? ? A ASP 98 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 108 A MN 201 1_555 ? ? ? ? ? ? ? 2.212 ? ? metalc4 metalc ? ? A ASP 98 OD1 ? ? ? 1_555 C MG . MG ? ? A ASP 108 A MG 202 1_555 ? ? ? ? ? ? ? 1.949 ? ? metalc5 metalc ? ? A GLU 109 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 119 A MN 201 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc6 metalc ? ? A ILE 110 O ? ? ? 1_555 B MN . MN ? ? A ILE 120 A MN 201 1_555 ? ? ? ? ? ? ? 2.273 ? ? metalc7 metalc ? ? B MN . MN ? ? ? 1_555 I H2I . O1 ? ? A MN 201 A H2I 208 1_555 ? ? ? ? ? ? ? 1.822 ? ? metalc8 metalc ? ? B MN . MN ? ? ? 1_555 I H2I . O6 ? ? A MN 201 A H2I 208 1_555 ? ? ? ? ? ? ? 1.929 ? ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 I H2I . O5 ? ? A MG 202 A H2I 208 1_555 ? ? ? ? ? ? ? 1.954 ? ? metalc10 metalc ? ? C MG . MG ? ? ? 1_555 I H2I . O6 ? ? A MG 202 A H2I 208 1_555 ? ? ? ? ? ? ? 2.033 ? ? metalc11 metalc ? ? C MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 202 A HOH 309 1_555 ? ? ? ? ? ? ? 2.150 ? ? metalc12 metalc ? ? C MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 202 A HOH 319 1_555 ? ? ? ? ? ? ? 2.295 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 50 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD2 ? A ASP 98 ? A ASP 108 ? 1_555 100.7 ? 2 NE2 ? A HIS 50 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OE2 ? A GLU 109 ? A GLU 119 ? 1_555 169.5 ? 3 OD2 ? A ASP 98 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OE2 ? A GLU 109 ? A GLU 119 ? 1_555 85.3 ? 4 NE2 ? A HIS 50 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? A ILE 110 ? A ILE 120 ? 1_555 86.7 ? 5 OD2 ? A ASP 98 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? A ILE 110 ? A ILE 120 ? 1_555 90.0 ? 6 OE2 ? A GLU 109 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? A ILE 110 ? A ILE 120 ? 1_555 84.7 ? 7 NE2 ? A HIS 50 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O1 ? I H2I . ? A H2I 208 ? 1_555 84.8 ? 8 OD2 ? A ASP 98 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O1 ? I H2I . ? A H2I 208 ? 1_555 170.2 ? 9 OE2 ? A GLU 109 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O1 ? I H2I . ? A H2I 208 ? 1_555 88.1 ? 10 O ? A ILE 110 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O1 ? I H2I . ? A H2I 208 ? 1_555 82.2 ? 11 NE2 ? A HIS 50 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O6 ? I H2I . ? A H2I 208 ? 1_555 94.0 ? 12 OD2 ? A ASP 98 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O6 ? I H2I . ? A H2I 208 ? 1_555 102.1 ? 13 OE2 ? A GLU 109 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O6 ? I H2I . ? A H2I 208 ? 1_555 93.1 ? 14 O ? A ILE 110 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O6 ? I H2I . ? A H2I 208 ? 1_555 167.5 ? 15 O1 ? I H2I . ? A H2I 208 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O6 ? I H2I . ? A H2I 208 ? 1_555 85.4 ? 16 OE1 ? A GLU 70 ? A GLU 80 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD1 ? A ASP 98 ? A ASP 108 ? 1_555 94.3 ? 17 OE1 ? A GLU 70 ? A GLU 80 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O5 ? I H2I . ? A H2I 208 ? 1_555 88.1 ? 18 OD1 ? A ASP 98 ? A ASP 108 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O5 ? I H2I . ? A H2I 208 ? 1_555 176.8 ? 19 OE1 ? A GLU 70 ? A GLU 80 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O6 ? I H2I . ? A H2I 208 ? 1_555 105.8 ? 20 OD1 ? A ASP 98 ? A ASP 108 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O6 ? I H2I . ? A H2I 208 ? 1_555 90.2 ? 21 O5 ? I H2I . ? A H2I 208 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O6 ? I H2I . ? A H2I 208 ? 1_555 87.2 ? 22 OE1 ? A GLU 70 ? A GLU 80 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 309 ? 1_555 169.4 ? 23 OD1 ? A ASP 98 ? A ASP 108 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 309 ? 1_555 92.2 ? 24 O5 ? I H2I . ? A H2I 208 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 309 ? 1_555 85.6 ? 25 O6 ? I H2I . ? A H2I 208 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 309 ? 1_555 82.5 ? 26 OE1 ? A GLU 70 ? A GLU 80 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 319 ? 1_555 88.6 ? 27 OD1 ? A ASP 98 ? A ASP 108 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 319 ? 1_555 94.5 ? 28 O5 ? I H2I . ? A H2I 208 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 319 ? 1_555 87.5 ? 29 O6 ? I H2I . ? A H2I 208 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 319 ? 1_555 164.5 ? 30 O ? J HOH . ? A HOH 309 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 319 ? 1_555 82.6 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 66 ? ILE A 68 ? PHE A 76 ILE A 78 AA1 2 LEU A 99 ? ASP A 101 ? LEU A 109 ASP A 111 AA1 3 ARG A 106 ? THR A 113 ? ARG A 116 THR A 123 AA1 4 HIS A 134 ? SER A 139 ? HIS A 144 SER A 149 AA1 5 GLU A 144 ? ALA A 146 ? GLU A 154 ALA A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 67 ? N GLU A 77 O TYR A 100 ? O TYR A 110 AA1 2 3 N ASP A 101 ? N ASP A 111 O ARG A 106 ? O ARG A 116 AA1 3 4 N GLU A 109 ? N GLU A 119 O HIS A 134 ? O HIS A 144 AA1 4 5 N ILE A 137 ? N ILE A 147 O MET A 145 ? O MET A 155 # _pdbx_entry_details.entry_id 8PUP _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 352 ? ? O A HOH 365 ? ? 2.03 2 1 O A HOH 347 ? ? O A HOH 358 ? ? 2.11 3 1 OG1 A THR 143 ? ? O A HOH 301 ? ? 2.15 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 343 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 356 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 11_655 _pdbx_validate_symm_contact.dist 2.11 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 141 ? ? 64.14 -4.79 2 1 THR A 162 ? ? 69.73 -65.12 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 168 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.114 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -8 ? A SER 1 2 1 Y 1 A GLY -7 ? A GLY 2 3 1 Y 1 A SER -6 ? A SER 3 4 1 Y 1 A GLY -5 ? A GLY 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 H2I N1 N N N 147 H2I C4 C Y N 148 H2I C5 C N N 149 H2I C6 C N N 150 H2I C7 C N N 151 H2I C8 C N N 152 H2I C10 C Y N 153 H2I C13 C Y N 154 H2I C15 C N N 155 H2I C17 C N N 156 H2I O1 O N N 157 H2I C1 C Y N 158 H2I C2 C Y N 159 H2I C3 C Y N 160 H2I C9 C Y N 161 H2I C11 C Y N 162 H2I C12 C Y N 163 H2I O2 O N N 164 H2I C14 C Y N 165 H2I O3 O N N 166 H2I C16 C N N 167 H2I O4 O N N 168 H2I O5 O N N 169 H2I C18 C Y N 170 H2I C19 C Y N 171 H2I O6 O N N 172 H2I H1 H N N 173 H2I H2 H N N 174 H2I H3 H N N 175 H2I H4 H N N 176 H2I H5 H N N 177 H2I H6 H N N 178 H2I H7 H N N 179 H2I H8 H N N 180 H2I H9 H N N 181 H2I H10 H N N 182 H2I H11 H N N 183 H2I H12 H N N 184 H2I H13 H N N 185 H2I H14 H N N 186 H2I H15 H N N 187 HIS N N N N 188 HIS CA C N S 189 HIS C C N N 190 HIS O O N N 191 HIS CB C N N 192 HIS CG C Y N 193 HIS ND1 N Y N 194 HIS CD2 C Y N 195 HIS CE1 C Y N 196 HIS NE2 N Y N 197 HIS OXT O N N 198 HIS H H N N 199 HIS H2 H N N 200 HIS HA H N N 201 HIS HB2 H N N 202 HIS HB3 H N N 203 HIS HD1 H N N 204 HIS HD2 H N N 205 HIS HE1 H N N 206 HIS HE2 H N N 207 HIS HXT H N N 208 HOH O O N N 209 HOH H1 H N N 210 HOH H2 H N N 211 ILE N N N N 212 ILE CA C N S 213 ILE C C N N 214 ILE O O N N 215 ILE CB C N S 216 ILE CG1 C N N 217 ILE CG2 C N N 218 ILE CD1 C N N 219 ILE OXT O N N 220 ILE H H N N 221 ILE H2 H N N 222 ILE HA H N N 223 ILE HB H N N 224 ILE HG12 H N N 225 ILE HG13 H N N 226 ILE HG21 H N N 227 ILE HG22 H N N 228 ILE HG23 H N N 229 ILE HD11 H N N 230 ILE HD12 H N N 231 ILE HD13 H N N 232 ILE HXT H N N 233 LEU N N N N 234 LEU CA C N S 235 LEU C C N N 236 LEU O O N N 237 LEU CB C N N 238 LEU CG C N N 239 LEU CD1 C N N 240 LEU CD2 C N N 241 LEU OXT O N N 242 LEU H H N N 243 LEU H2 H N N 244 LEU HA H N N 245 LEU HB2 H N N 246 LEU HB3 H N N 247 LEU HG H N N 248 LEU HD11 H N N 249 LEU HD12 H N N 250 LEU HD13 H N N 251 LEU HD21 H N N 252 LEU HD22 H N N 253 LEU HD23 H N N 254 LEU HXT H N N 255 LYS N N N N 256 LYS CA C N S 257 LYS C C N N 258 LYS O O N N 259 LYS CB C N N 260 LYS CG C N N 261 LYS CD C N N 262 LYS CE C N N 263 LYS NZ N N N 264 LYS OXT O N N 265 LYS H H N N 266 LYS H2 H N N 267 LYS HA H N N 268 LYS HB2 H N N 269 LYS HB3 H N N 270 LYS HG2 H N N 271 LYS HG3 H N N 272 LYS HD2 H N N 273 LYS HD3 H N N 274 LYS HE2 H N N 275 LYS HE3 H N N 276 LYS HZ1 H N N 277 LYS HZ2 H N N 278 LYS HZ3 H N N 279 LYS HXT H N N 280 MET N N N N 281 MET CA C N S 282 MET C C N N 283 MET O O N N 284 MET CB C N N 285 MET CG C N N 286 MET SD S N N 287 MET CE C N N 288 MET OXT O N N 289 MET H H N N 290 MET H2 H N N 291 MET HA H N N 292 MET HB2 H N N 293 MET HB3 H N N 294 MET HG2 H N N 295 MET HG3 H N N 296 MET HE1 H N N 297 MET HE2 H N N 298 MET HE3 H N N 299 MET HXT H N N 300 MG MG MG N N 301 MN MN MN N N 302 PHE N N N N 303 PHE CA C N S 304 PHE C C N N 305 PHE O O N N 306 PHE CB C N N 307 PHE CG C Y N 308 PHE CD1 C Y N 309 PHE CD2 C Y N 310 PHE CE1 C Y N 311 PHE CE2 C Y N 312 PHE CZ C Y N 313 PHE OXT O N N 314 PHE H H N N 315 PHE H2 H N N 316 PHE HA H N N 317 PHE HB2 H N N 318 PHE HB3 H N N 319 PHE HD1 H N N 320 PHE HD2 H N N 321 PHE HE1 H N N 322 PHE HE2 H N N 323 PHE HZ H N N 324 PHE HXT H N N 325 PRO N N N N 326 PRO CA C N S 327 PRO C C N N 328 PRO O O N N 329 PRO CB C N N 330 PRO CG C N N 331 PRO CD C N N 332 PRO OXT O N N 333 PRO H H N N 334 PRO HA H N N 335 PRO HB2 H N N 336 PRO HB3 H N N 337 PRO HG2 H N N 338 PRO HG3 H N N 339 PRO HD2 H N N 340 PRO HD3 H N N 341 PRO HXT H N N 342 SER N N N N 343 SER CA C N S 344 SER C C N N 345 SER O O N N 346 SER CB C N N 347 SER OG O N N 348 SER OXT O N N 349 SER H H N N 350 SER H2 H N N 351 SER HA H N N 352 SER HB2 H N N 353 SER HB3 H N N 354 SER HG H N N 355 SER HXT H N N 356 THR N N N N 357 THR CA C N S 358 THR C C N N 359 THR O O N N 360 THR CB C N R 361 THR OG1 O N N 362 THR CG2 C N N 363 THR OXT O N N 364 THR H H N N 365 THR H2 H N N 366 THR HA H N N 367 THR HB H N N 368 THR HG1 H N N 369 THR HG21 H N N 370 THR HG22 H N N 371 THR HG23 H N N 372 THR HXT H N N 373 TRP N N N N 374 TRP CA C N S 375 TRP C C N N 376 TRP O O N N 377 TRP CB C N N 378 TRP CG C Y N 379 TRP CD1 C Y N 380 TRP CD2 C Y N 381 TRP NE1 N Y N 382 TRP CE2 C Y N 383 TRP CE3 C Y N 384 TRP CZ2 C Y N 385 TRP CZ3 C Y N 386 TRP CH2 C Y N 387 TRP OXT O N N 388 TRP H H N N 389 TRP H2 H N N 390 TRP HA H N N 391 TRP HB2 H N N 392 TRP HB3 H N N 393 TRP HD1 H N N 394 TRP HE1 H N N 395 TRP HE3 H N N 396 TRP HZ2 H N N 397 TRP HZ3 H N N 398 TRP HH2 H N N 399 TRP HXT H N N 400 TYR N N N N 401 TYR CA C N S 402 TYR C C N N 403 TYR O O N N 404 TYR CB C N N 405 TYR CG C Y N 406 TYR CD1 C Y N 407 TYR CD2 C Y N 408 TYR CE1 C Y N 409 TYR CE2 C Y N 410 TYR CZ C Y N 411 TYR OH O N N 412 TYR OXT O N N 413 TYR H H N N 414 TYR H2 H N N 415 TYR HA H N N 416 TYR HB2 H N N 417 TYR HB3 H N N 418 TYR HD1 H N N 419 TYR HD2 H N N 420 TYR HE1 H N N 421 TYR HE2 H N N 422 TYR HH H N N 423 TYR HXT H N N 424 VAL N N N N 425 VAL CA C N S 426 VAL C C N N 427 VAL O O N N 428 VAL CB C N N 429 VAL CG1 C N N 430 VAL CG2 C N N 431 VAL OXT O N N 432 VAL H H N N 433 VAL H2 H N N 434 VAL HA H N N 435 VAL HB H N N 436 VAL HG11 H N N 437 VAL HG12 H N N 438 VAL HG13 H N N 439 VAL HG21 H N N 440 VAL HG22 H N N 441 VAL HG23 H N N 442 VAL HXT H N N 443 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 H2I O4 C16 sing N N 138 H2I O5 C17 doub N N 139 H2I C16 C17 sing N N 140 H2I C16 C15 doub N N 141 H2I C17 C18 sing N N 142 H2I O6 C19 sing N N 143 H2I C15 C6 sing N N 144 H2I C18 C19 doub Y N 145 H2I C18 C4 sing Y N 146 H2I C19 C1 sing Y N 147 H2I C6 C5 doub N N 148 H2I C6 C7 sing N N 149 H2I N1 C7 sing N N 150 H2I N1 C8 sing N N 151 H2I C4 C5 sing N N 152 H2I C4 C3 doub Y N 153 H2I C7 O3 doub N N 154 H2I C1 O1 sing N N 155 H2I C1 C2 doub Y N 156 H2I C8 C9 sing N N 157 H2I C3 C2 sing Y N 158 H2I C9 C10 doub Y N 159 H2I C9 C14 sing Y N 160 H2I C10 C11 sing Y N 161 H2I C14 C13 doub Y N 162 H2I C11 C12 doub Y N 163 H2I C13 C12 sing Y N 164 H2I C12 O2 sing N N 165 H2I N1 H1 sing N N 166 H2I C5 H2 sing N N 167 H2I C8 H3 sing N N 168 H2I C8 H4 sing N N 169 H2I C10 H5 sing N N 170 H2I C13 H6 sing N N 171 H2I C15 H7 sing N N 172 H2I O1 H8 sing N N 173 H2I C2 H9 sing N N 174 H2I C3 H10 sing N N 175 H2I C11 H11 sing N N 176 H2I O2 H12 sing N N 177 H2I C14 H13 sing N N 178 H2I O4 H14 sing N N 179 H2I O6 H15 sing N N 180 HIS N CA sing N N 181 HIS N H sing N N 182 HIS N H2 sing N N 183 HIS CA C sing N N 184 HIS CA CB sing N N 185 HIS CA HA sing N N 186 HIS C O doub N N 187 HIS C OXT sing N N 188 HIS CB CG sing N N 189 HIS CB HB2 sing N N 190 HIS CB HB3 sing N N 191 HIS CG ND1 sing Y N 192 HIS CG CD2 doub Y N 193 HIS ND1 CE1 doub Y N 194 HIS ND1 HD1 sing N N 195 HIS CD2 NE2 sing Y N 196 HIS CD2 HD2 sing N N 197 HIS CE1 NE2 sing Y N 198 HIS CE1 HE1 sing N N 199 HIS NE2 HE2 sing N N 200 HIS OXT HXT sing N N 201 HOH O H1 sing N N 202 HOH O H2 sing N N 203 ILE N CA sing N N 204 ILE N H sing N N 205 ILE N H2 sing N N 206 ILE CA C sing N N 207 ILE CA CB sing N N 208 ILE CA HA sing N N 209 ILE C O doub N N 210 ILE C OXT sing N N 211 ILE CB CG1 sing N N 212 ILE CB CG2 sing N N 213 ILE CB HB sing N N 214 ILE CG1 CD1 sing N N 215 ILE CG1 HG12 sing N N 216 ILE CG1 HG13 sing N N 217 ILE CG2 HG21 sing N N 218 ILE CG2 HG22 sing N N 219 ILE CG2 HG23 sing N N 220 ILE CD1 HD11 sing N N 221 ILE CD1 HD12 sing N N 222 ILE CD1 HD13 sing N N 223 ILE OXT HXT sing N N 224 LEU N CA sing N N 225 LEU N H sing N N 226 LEU N H2 sing N N 227 LEU CA C sing N N 228 LEU CA CB sing N N 229 LEU CA HA sing N N 230 LEU C O doub N N 231 LEU C OXT sing N N 232 LEU CB CG sing N N 233 LEU CB HB2 sing N N 234 LEU CB HB3 sing N N 235 LEU CG CD1 sing N N 236 LEU CG CD2 sing N N 237 LEU CG HG sing N N 238 LEU CD1 HD11 sing N N 239 LEU CD1 HD12 sing N N 240 LEU CD1 HD13 sing N N 241 LEU CD2 HD21 sing N N 242 LEU CD2 HD22 sing N N 243 LEU CD2 HD23 sing N N 244 LEU OXT HXT sing N N 245 LYS N CA sing N N 246 LYS N H sing N N 247 LYS N H2 sing N N 248 LYS CA C sing N N 249 LYS CA CB sing N N 250 LYS CA HA sing N N 251 LYS C O doub N N 252 LYS C OXT sing N N 253 LYS CB CG sing N N 254 LYS CB HB2 sing N N 255 LYS CB HB3 sing N N 256 LYS CG CD sing N N 257 LYS CG HG2 sing N N 258 LYS CG HG3 sing N N 259 LYS CD CE sing N N 260 LYS CD HD2 sing N N 261 LYS CD HD3 sing N N 262 LYS CE NZ sing N N 263 LYS CE HE2 sing N N 264 LYS CE HE3 sing N N 265 LYS NZ HZ1 sing N N 266 LYS NZ HZ2 sing N N 267 LYS NZ HZ3 sing N N 268 LYS OXT HXT sing N N 269 MET N CA sing N N 270 MET N H sing N N 271 MET N H2 sing N N 272 MET CA C sing N N 273 MET CA CB sing N N 274 MET CA HA sing N N 275 MET C O doub N N 276 MET C OXT sing N N 277 MET CB CG sing N N 278 MET CB HB2 sing N N 279 MET CB HB3 sing N N 280 MET CG SD sing N N 281 MET CG HG2 sing N N 282 MET CG HG3 sing N N 283 MET SD CE sing N N 284 MET CE HE1 sing N N 285 MET CE HE2 sing N N 286 MET CE HE3 sing N N 287 MET OXT HXT sing N N 288 PHE N CA sing N N 289 PHE N H sing N N 290 PHE N H2 sing N N 291 PHE CA C sing N N 292 PHE CA CB sing N N 293 PHE CA HA sing N N 294 PHE C O doub N N 295 PHE C OXT sing N N 296 PHE CB CG sing N N 297 PHE CB HB2 sing N N 298 PHE CB HB3 sing N N 299 PHE CG CD1 doub Y N 300 PHE CG CD2 sing Y N 301 PHE CD1 CE1 sing Y N 302 PHE CD1 HD1 sing N N 303 PHE CD2 CE2 doub Y N 304 PHE CD2 HD2 sing N N 305 PHE CE1 CZ doub Y N 306 PHE CE1 HE1 sing N N 307 PHE CE2 CZ sing Y N 308 PHE CE2 HE2 sing N N 309 PHE CZ HZ sing N N 310 PHE OXT HXT sing N N 311 PRO N CA sing N N 312 PRO N CD sing N N 313 PRO N H sing N N 314 PRO CA C sing N N 315 PRO CA CB sing N N 316 PRO CA HA sing N N 317 PRO C O doub N N 318 PRO C OXT sing N N 319 PRO CB CG sing N N 320 PRO CB HB2 sing N N 321 PRO CB HB3 sing N N 322 PRO CG CD sing N N 323 PRO CG HG2 sing N N 324 PRO CG HG3 sing N N 325 PRO CD HD2 sing N N 326 PRO CD HD3 sing N N 327 PRO OXT HXT sing N N 328 SER N CA sing N N 329 SER N H sing N N 330 SER N H2 sing N N 331 SER CA C sing N N 332 SER CA CB sing N N 333 SER CA HA sing N N 334 SER C O doub N N 335 SER C OXT sing N N 336 SER CB OG sing N N 337 SER CB HB2 sing N N 338 SER CB HB3 sing N N 339 SER OG HG sing N N 340 SER OXT HXT sing N N 341 THR N CA sing N N 342 THR N H sing N N 343 THR N H2 sing N N 344 THR CA C sing N N 345 THR CA CB sing N N 346 THR CA HA sing N N 347 THR C O doub N N 348 THR C OXT sing N N 349 THR CB OG1 sing N N 350 THR CB CG2 sing N N 351 THR CB HB sing N N 352 THR OG1 HG1 sing N N 353 THR CG2 HG21 sing N N 354 THR CG2 HG22 sing N N 355 THR CG2 HG23 sing N N 356 THR OXT HXT sing N N 357 TRP N CA sing N N 358 TRP N H sing N N 359 TRP N H2 sing N N 360 TRP CA C sing N N 361 TRP CA CB sing N N 362 TRP CA HA sing N N 363 TRP C O doub N N 364 TRP C OXT sing N N 365 TRP CB CG sing N N 366 TRP CB HB2 sing N N 367 TRP CB HB3 sing N N 368 TRP CG CD1 doub Y N 369 TRP CG CD2 sing Y N 370 TRP CD1 NE1 sing Y N 371 TRP CD1 HD1 sing N N 372 TRP CD2 CE2 doub Y N 373 TRP CD2 CE3 sing Y N 374 TRP NE1 CE2 sing Y N 375 TRP NE1 HE1 sing N N 376 TRP CE2 CZ2 sing Y N 377 TRP CE3 CZ3 doub Y N 378 TRP CE3 HE3 sing N N 379 TRP CZ2 CH2 doub Y N 380 TRP CZ2 HZ2 sing N N 381 TRP CZ3 CH2 sing Y N 382 TRP CZ3 HZ3 sing N N 383 TRP CH2 HH2 sing N N 384 TRP OXT HXT sing N N 385 TYR N CA sing N N 386 TYR N H sing N N 387 TYR N H2 sing N N 388 TYR CA C sing N N 389 TYR CA CB sing N N 390 TYR CA HA sing N N 391 TYR C O doub N N 392 TYR C OXT sing N N 393 TYR CB CG sing N N 394 TYR CB HB2 sing N N 395 TYR CB HB3 sing N N 396 TYR CG CD1 doub Y N 397 TYR CG CD2 sing Y N 398 TYR CD1 CE1 sing Y N 399 TYR CD1 HD1 sing N N 400 TYR CD2 CE2 doub Y N 401 TYR CD2 HD2 sing N N 402 TYR CE1 CZ doub Y N 403 TYR CE1 HE1 sing N N 404 TYR CE2 CZ sing Y N 405 TYR CE2 HE2 sing N N 406 TYR CZ OH sing N N 407 TYR OH HH sing N N 408 TYR OXT HXT sing N N 409 VAL N CA sing N N 410 VAL N H sing N N 411 VAL N H2 sing N N 412 VAL CA C sing N N 413 VAL CA CB sing N N 414 VAL CA HA sing N N 415 VAL C O doub N N 416 VAL C OXT sing N N 417 VAL CB CG1 sing N N 418 VAL CB CG2 sing N N 419 VAL CB HB sing N N 420 VAL CG1 HG11 sing N N 421 VAL CG1 HG12 sing N N 422 VAL CG1 HG13 sing N N 423 VAL CG2 HG21 sing N N 424 VAL CG2 HG22 sing N N 425 VAL CG2 HG23 sing N N 426 VAL OXT HXT sing N N 427 # _pdbx_audit_support.funding_organization 'European Union (EU)' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number LX22NPO5103 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7NUG _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8PUP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.013523 _atom_sites.fract_transf_matrix[1][2] 0.007807 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015615 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007898 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG MN N O S # loop_